WorldWideScience

Sample records for scrub-jays aphelocoma californica

  1. Re-caching by Western scrub-jays (Aphelocoma californica cannot be attributed to stress.

    Directory of Open Access Journals (Sweden)

    James M Thom

    Full Text Available Western scrub-jays (Aphelocoma californica live double lives, storing food for the future while raiding the stores of other birds. One tactic scrub-jays employ to protect stores is "re-caching"-relocating caches out of sight of would-be thieves. Recent computational modelling work suggests that re-caching might be mediated not by complex cognition, but by a combination of memory failure and stress. The "Stress Model" asserts that re-caching is a manifestation of a general drive to cache, rather than a desire to protect existing stores. Here, we present evidence strongly contradicting the central assumption of these models: that stress drives caching, irrespective of social context. In Experiment (i, we replicate the finding that scrub-jays preferentially relocate food they were watched hiding. In Experiment (ii we find no evidence that stress increases caching. In light of our results, we argue that the Stress Model cannot account for scrub-jay re-caching.

  2. Interacting Cache memories: evidence for flexible memory use by Western Scrub-Jays (Aphelocoma californica).

    Science.gov (United States)

    Clayton, Nicola S; Yu, Kara Shirley; Dickinson, Anthony

    2003-01-01

    When Western Scrub-Jays (Aphelocoma californica) cached and recovered perishable crickets, N. S. Clayton, K. S. Yu, and A. Dickinson (2001) reported that the jays rapidly learned to search for fresh crickets after a 1-day retention interval (RI) between caching and recovery but to avoid searching for perished crickets after a 4-day RI. In the present experiments, the jays generalized their search preference for crickets to intermediate RIs and used novel information about the rate of decay of crickets presented during the RI to reverse these search preferences at recovery. The authors interpret this reversal as evidence that the birds can integrate information about the caching episode with new information presented during the RI.

  3. The effects of low levels of light at night upon the endocrine physiology of western scrub-jays (Aphelocoma californica).

    Science.gov (United States)

    Schoech, Stephan J; Bowman, Reed; Hahn, Thomas P; Goymann, Wolfgang; Schwabl, Ingrid; Bridge, Eli S

    2013-11-01

    Florida scrub-jays (Aphelocoma coerulescens) in the suburbs breed earlier than jays in native habitat. Amongst the possible factors that influence this advance (e.g., food availability, microclimate, predator regime, etc.), is exposure to artificial lights at night (LAN). LAN could stimulate the reproductive axis of the suburban jays. Alternatively, LAN could inhibit pineal melatonin (MEL), thus removing its inhibitory influence on the reproductive axis. Because Florida scrub-jays are a threatened species, we used western scrub-jays (Aphelocoma californica) to investigate the effects of LAN upon reproductive hormones and melatonin. Jays were held under conditions in which the dark-phase of the light:dark cycle was without illumination and then under low levels of LAN. Under both conditions, birds were exposed first to short-days (9.5L:14.5D) that were gradually increased to long-days (14.5L:9.5D). At various times, blood samples were collected during the light part of the cycle to measure reproductive hormones (luteinizing hormone, LH; testosterone, T; and estradiol, E2 ). Similarly, samples to assess melatonin were collected during the dark. In males, LAN caused a depression in LH levels and levels were ∼4× greater under long- than short-days. In females, there was no effect of LAN or photoperiod upon LH. LAN resulted in depressed T levels in females, although there was no effect on T in males. E2 levels in both sexes were lower under LAN than under an unlighted dark-phase. Paradoxically, MEL was higher in jays under LAN, and under long-days. MEL did not differ by sex. LAN disrupted the extraordinarily strong correlation between T and E2 that existed under unlighted nocturnal conditions. Overall, our findings fail to support the hypothesis that LAN stimulates the reproductive axis. Rather, the data demonstrate that LAN tends to inhibit reproductive hormone secretion, although not in a consistent fashion between the sexes. © 2013 Wiley Periodicals, Inc.

  4. Reproductive Ecology Of The Florida Scrub-Jay (Aphelocoma Coerulescens) On John F. Kennedy Space Center/Merritt Island National Wildlife Refuge: A Long-Term Study

    Science.gov (United States)

    Carter, Geoffry M.; Breininger, David R.; Larson, Vicky L.; Oddy, Donna M.; Smith, Rebecca B.; Stolen, Eric D.

    2005-01-01

    From 1988 to 2002 we studied the breeding ecology of Florida Scrub-Jays (Aphelocoma coerulescens) on John F. Kennedy Space Center/Merritt Island National Wildlife Refuge. We examined phenology, clutch size, hatching failure rates, fledgling production, nest success, predation rates, sources egg and nestling mortality, and the effects of helpers on these measures. Nesting phenology was similar among sites. Mean clutch size at Titan was significantly larger than at HC or T4. Pairs with helpers did not produce larger clutches than pairs without helpers. Fledgling production at T4 was significantly greater than at HC and similar to Titan. Pairs with helpers at HC produced significantly more fledglings than pairs without helpers; helpers did not influence fledgling production at the other sites. Nest success at HC and Titan was low, 19% and 32% respectively. Nest success at T4 was 48% and was significantly greater than at HC. Average predation rates at all sites increased with season progression. Predation rates at all sight rose sharply by early June. The main cause of nest failure at all sites was predation, 93%.

  5. Congruent population structure inferred from dispersal behaviour and intensive genetic surveys of the threatened Florida scrub-jay (Aphelocoma cœrulescens)

    Science.gov (United States)

    Coulon, A.; Fitzpatrick, J.W.; Bowman, R.; Stith, B.M.; Makarewich, C.A.; Stenzler, L.M.; Lovette, I.J.

    2008-01-01

    The delimitation of populations, defined as groups of individuals linked by gene flow, is possible by the analysis of genetic markers and also by spatial models based on dispersal probabilities across a landscape. We combined these two complimentary methods to define the spatial pattern of genetic structure among remaining populations of the threatened Florida scrub-jay, a species for which dispersal ability is unusually well-characterized. The range-wide population was intensively censused in the 1990s, and a metapopulation model defined population boundaries based on predicted dispersal-mediated demographic connectivity. We subjected genotypes from more than 1000 individual jays screened at 20 microsatellite loci to two Bayesian clustering methods. We describe a consensus method for identifying common features across many replicated clustering runs. Ten genetically differentiated groups exist across the present-day range of the Florida scrub-jay. These groups are largely consistent with the dispersal-defined metapopulations, which assume very limited dispersal ability. Some genetic groups comprise more than one metapopulation, likely because these genetically similar metapopulations were sundered only recently by habitat alteration. The combined reconstructions of population structure based on genetics and dispersal-mediated demographic connectivity provide a robust depiction of the current genetic and demographic organization of this species, reflecting past and present levels of dispersal among occupied habitat patches. The differentiation of populations into 10 genetic groups adds urgency to management efforts aimed at preserving what remains of genetic variation in this dwindling species, by maintaining viable populations of all genetically differentiated and geographically isolated populations.

  6. Factors Affecting Florida Scrub-Jay Nest Survival on Ocala National Forest, Florida

    Science.gov (United States)

    Kathleen Franzreb; Stan Zarnoch

    2011-01-01

    One of the main populations of the Florida scrub-jay (Aphelocoma coerulescens), a federally threatened species, occurs on Ocala National Forest, Florida. We determined the nest survival rate (DSR) of 474 nests of Florida scrub-jays in stands subject to sand pine reforestation management after timber harvesting or wildfire on Ocala National Forest. We used the...

  7. Hint-seeking behaviour of western scrub-jays in a metacognition task.

    Science.gov (United States)

    Watanabe, Arii; Clayton, Nicola S

    2016-01-01

    Metacognitive processes during memory retrieval can be tested by examining whether or not animals can assess their knowledge state when they are faced with a memory test. In a typical foraging task, food is hidden in one of the multiple tubes and the subjects are given an opportunity to check the contents of the tubes before choosing the one that they thought contained food. Following the findings from our previous study that western scrub-jays (Aphelocoma californica) can make prospective metacognition judgements, this study tested the scrub-jays' concurrent metacognition judgements. In a series of experiments, uncertainty about the food location was induced in three ways: by making the baiting process visibly unavailable, by inserting a delay between the baiting and food retrieval, and by moving the location of the bait. The jays looked into the tubes more often during the conditions that were consistent with high uncertainty. In addition, their looking behaviour was associated not with the sight of food but with information about the location of the food. These findings suggest that the jays can differentiate the states of knowing and not knowing about certain information and take appropriate action to complement their missing knowledge.

  8. Episodic-like memory during cache recovery by scrub jays.

    Science.gov (United States)

    Clayton, N S; Dickinson, A

    1998-09-17

    The recollection of past experiences allows us to recall what a particular event was, and where and when it occurred, a form of memory that is thought to be unique to humans. It is known, however, that food-storing birds remember the spatial location and contents of their caches. Furthermore, food-storing animals adapt their caching and recovery strategies to the perishability of food stores, which suggests that they are sensitive to temporal factors. Here we show that scrub jays (Aphelocoma coerulescens) remember 'when' food items are stored by allowing them to recover perishable 'wax worms' (wax-moth larvae) and non-perishable peanuts which they had previously cached in visuospatially distinct sites. Jays searched preferentially for fresh wax worms, their favoured food, when allowed to recover them shortly after caching. However, they rapidly learned to avoid searching for worms after a longer interval during which the worms had decayed. The recovery preference of jays demonstrates memory of where and when particular food items were cached, thereby fulfilling the behavioural criteria for episodic-like memory in non-human animals.

  9. Habitat-specific breeder survival of Florida Scrub-Jays: Inferences from multistate models

    Science.gov (United States)

    Breininger, D.R.; Nichols, J.D.; Carter, G.M.; Oddy, D.M.

    2009-01-01

    Quantifying habitat-specific survival and changes in habitat quality within disturbance-prone habitats is critical for understanding population dynamics and variation in fitness, and for managing degraded ecosystems. We used 18 years of color-banding data and multistate capture-recapture models to test whether habitat quality within territories influences survival and detection probability of breeding Florida Scrub-Jays (Aphelocoma coerulescens) and to estimate bird transition probabilities from one territory quality state to another. Our study sites were along central Florida's Atlantic coast and included two of the four largest metapopulations within the species range. We developed Markov models for habitat transitions and compared these to bird transition probabilities. Florida Scrub-Jay detection probabilities ranged from 0.88 in the tall territory state to 0.99 in the optimal state; detection probabilities were intermediate in the short state. Transition probabilities were similar for birds and habitat in grid cells mapped independently of birds. Thus, bird transitions resulted primarily from habitat transitions between states over time and not from bird movement. Survival ranged from 0.71 in the short state to 0.82 in the optimal state, with tall states being intermediate. We conclude that average Florida Scrub-Jay survival will remain at levels that lead to continued population declines because most current habitat quality is only marginally suitable across most of the species range. Improvements in habitat are likely to be slow and difficult because tall states are resistant to change and the optimal state represents an intermediate transitional stage. The multistate modeling approach to quantifying survival and habitat transition probabilities is useful for quantifying habitat transition probabilities and comparing them to bird transition probabilities to test for habitat selection in dynamic environments. ?? 2009 by the Ecological society ot America.

  10. Antibacterial activity of native California medicinal plant extracts isolated from Rhamnus californica and Umbellularia californica

    National Research Council Canada - National Science Library

    Carranza, Maria G; Sevigny, Mary B; Banerjee, Debashree; Fox-Cubley, Lacie

    2015-01-01

    .... Rhamnus californica (Rhamnaceae) and Umbellularia californica (Lauraceae) are two indigenous California plant species historically used by Native Americans to treat skin, respiratory and gastrointestinal infections...

  11. Developmental transcriptome of Aplysia californica'

    KAUST Repository

    Heyland, Andreas

    2010-12-06

    Genome-wide transcriptional changes in development provide important insight into mechanisms underlying growth, differentiation, and patterning. However, such large-scale developmental studies have been limited to a few representatives of Ecdysozoans and Chordates. Here, we characterize transcriptomes of embryonic, larval, and metamorphic development in the marine mollusc Aplysia californica and reveal novel molecular components associated with life history transitions. Specifically, we identify more than 20 signal peptides, putative hormones, and transcription factors in association with early development and metamorphic stages-many of which seem to be evolutionarily conserved elements of signal transduction pathways. We also characterize genes related to biomineralization-a critical process of molluscan development. In summary, our experiment provides the first large-scale survey of gene expression in mollusc development, and complements previous studies on the regulatory mechanisms underlying body plan patterning and the formation of larval and juvenile structures. This study serves as a resource for further functional annotation of transcripts and genes in Aplysia, specifically and molluscs in general. A comparison of the Aplysia developmental transcriptome with similar studies in the zebra fish Danio rerio, the fruit fly Drosophila melanogaster, the nematode Caenorhabditis elegans, and other studies on molluscs suggests an overall highly divergent pattern of gene regulatory mechanisms that are likely a consequence of the different developmental modes of these organisms. © 2010 Wiley-Liss, Inc., A Wiley Company.

  12. Antibacterial activity of native California medicinal plant extracts isolated from Rhamnus californica and Umbellularia californica

    OpenAIRE

    Carranza, Maria G; Sevigny, Mary B.; Banerjee, Debashree; Fox-Cubley, Lacie

    2015-01-01

    Background Antimicrobial resistance (AMR) is a major threat to global public health. Medicinal plants have long been used as remedies for infectious diseases by native cultures around the world and have the potential for providing effective treatments for antibiotic-resistant infections. Rhamnus californica (Rhamnaceae) and Umbellularia californica (Lauraceae) are two indigenous California plant species historically used by Native Americans to treat skin, respiratory and gastrointestinal infe...

  13. Encyclopedia of Autographa californica Nucleopolyhedrovirus Genes

    NARCIS (Netherlands)

    Cohen, D.P.A.; Marek, M.; Davies, B.G.; Vlak, J.M.; Oers, van M.M.

    2009-01-01

    The Autographa californica multiple capsid nucleopolyhedrovirus (AcMNPV) was the first baculovirus for which the complete nucleotide sequence became known. Since then 15 years lapsed and much research has been performed to elucidate putative functions of the annotated open reading frames of this

  14. Antibacterial activity of native California medicinal plant extracts isolated from Rhamnus californica and Umbellularia californica.

    Science.gov (United States)

    Carranza, Maria G; Sevigny, Mary B; Banerjee, Debashree; Fox-Cubley, Lacie

    2015-05-23

    Antimicrobial resistance (AMR) is a major threat to global public health. Medicinal plants have long been used as remedies for infectious diseases by native cultures around the world and have the potential for providing effective treatments for antibiotic-resistant infections. Rhamnus californica (Rhamnaceae) and Umbellularia californica (Lauraceae) are two indigenous California plant species historically used by Native Americans to treat skin, respiratory and gastrointestinal infections. This study aimed to assess the in vitro antimicrobial activity of methanolic extracts of leaves and bark of R. and U. californica against methicillin-resistant Staphylococcus aureus (MRSA) and other Gram-positive and Gram-negative bacteria. Methanolic extracts of leaves and bark of R. and U. californica were prepared by soxhlet extraction and evaluated for their antimicrobial activity against Bacillus cereus, Streptococcus pyogenes, Mycobacterium smegmatis, Staphylococcus aureus, MRSA, Escherichia coli and Pseudomonas aeruginosa using disc diffusion and minimal inhibitory concentration (MIC) assays. Chemical profiling of the extracts was performed using standard methods. All extracts inhibited the growth of MRSA and other Gram-positive bacteria with MICs of 3.3-6.0 mg/ml. Gram-negative organisms were unaffected by these extracts. U. californica extracts (leaves and bark) had the lowest MIC values. Chemical profiling detected the presence of quinones, alkaloids, flavonoids, cardenolides, tannins and saponins in these extracts. Our study is the first to report the antimicrobial properties of R. and U. californica and illustrates their promising anti-MRSA potential. Our results give scientific credence to the traditional medicinal uses of these plants by the indigenous peoples of California. Further investigation of the secondary metabolites responsible for the antimicrobial activity of these extracts against MRSA is warranted.

  15. Endangered and Threatened Species at Kennedy Space Center Merritt Island National Wildlife Refuge

    Science.gov (United States)

    Galdolfi, Catherine

    2010-01-01

    Throughout my internship, I assisted with the long-term monitoring of the Florida Scrub- Jay (Aphelocoma coerulescens), a threatened species endemic to Florida. The Florida Scrub Jay diet consists of insects and small vertebrates throughout most of the year; however, during the winter their primary diet is acorns because the insect population is low. Furthermore, the Florida Scrub-Jay is a habitat specialist that lives in a disappearing plant community called the scrub, which consists of sand live oak, myrtle oak and chapman oak. The Florida Scrub-Jay is considered threatened because its numbers are decreasing primarily due to the loss of habitat that it needs to survive. Scrub habitat is highly desirable for human development because it is high, dry, and sandy. Periodic controlled burns maintain the scrub in a low, open condition favored by Scrub-Jays. Florida Scrub-Jays build their nests approximately 3-5 feet (approximately 1.5 m) above the ground in shrubby oaks (Breininger 153), mate for life and are cooperative breeders; which means that the young jays remain in their natal territory for at least a year to help their parents defend their territory, feed the young, and mob predators. (Breininger 152). I assisted in conducting monthly censuses at long-term monitoring sites and a juvenile in July survey to determine reproductive success for the year. In addition, to Scrub-Jay monitoring, I also had the opportunity to assist with some long term monitoring of ecosystem recovery. Scrub is a fire maintained system. Fire maintains the structure of scrub necessary for many of the threatened species that reside in the scrub habitat.

  16. Studies of trichomonad protozoa in free ranging songbirds: prevalence of Trichomonas gallinae in house finches (Carpodacus mexicanus) and corvids and a novel trichomonad in mockingbirds (Mimus polyglottos).

    Science.gov (United States)

    Anderson, Nancy L; Grahn, Robert A; Van Hoosear, Karen; Bondurant, Robert H

    2009-05-12

    This study refutes the accepted dogma that significant pathogenic effects of Trichomonas gallinae are limited to columbiformes and raptors in free ranging bird populations in North America. Trichomonads were associated with morbidity and mortality amongst free ranging house finches (Carpodacus mexicanus), mockingbirds (Mimus polyglottos) and corvids (scrub jay: Aphelocoma californica; crow: Corvus brachyrhynchos; raven: Corvus corax) in northern California. Prevalence of trichomonad infection was 1.7% in house finches, 0-6.3% in corvids, and 0.9% in mockingbirds. Bird case fatality ratio was 95.5% in house finches, 0-100.0% in corvids, and 37.5% in mockingbirds. DNA sequences of parasites in house finches and corvids were identical to T. gallinae strain g7 (GeneBank AY349182.1) for the 5.8s ribosome. DNA sequences of parasites cultured from two mockingbirds were genetically distinct from that of available sequenced trichomonads. These isolates were clearly phylogenetically more closely related to the Trichomonadinae than the Tritrichomonadinae. While molecular techniques were required to differentiate between trichomonad species, wet mount preparations from the oral cavity/crop were a reliable and inexpensive method of screening for trichomonad infections in these species. Positive wet mount tests in house finches and corvids living in northern California were highly likely to indicate infection with T. gallinae, while in mockingbirds positive wet mounts most likely indicated a trichomonad other than T. gallinae.

  17. Metamorphosis of Aplysia californica in Laboratory Culture

    Science.gov (United States)

    Kriegstein, Arnold R.; Castellucci, Vincent; Kandel, Eric R.

    1974-01-01

    To utilize the advantages offered by the large identified nerve cells of the marine mollusc Aplysia californica for cellular biological studies of development, we have devised simple techniques for growing this species in the laboratory in large number with a generation time as short as nineteen weeks. We have used the cultured animals to study the life cycle from fertilized egg to reproductive adult. The major developmental and behavioral changes occur at metamorphosis, when the larvae settle on the seaweed Laurencia pacifica and the locomotor and feeding behaviors are transformed into their adult forms. We have examined the timetable for the abandonment of larval behaviors and the emergence of adult ones and found that the transition from swimming to crawling occurs first and marks the onset of metamorphosis. The change from ciliary feeding to radular feeding occurs later and signals the end of metamorphosis. Other adult behaviors, such as the reflex responses and fixed-action patterns of the mantle organs, appear after metamorphosis. PMID:4530325

  18. Dietary metal toxicity to the marine sea hare, Aplysia californica.

    Science.gov (United States)

    Jarvis, Tayler A; Capo, Thomas R; Bielmyer-Fraser, Gretchen K

    2015-01-01

    Metal pollution from anthropogenic inputs is a concern in many marine environments. Metals accumulate in tissue and in excess cause toxicity in marine organisms. This study investigated the accumulation and effects of dietary metals in a macroinvertebrate. The green seaweed, Ulva lactuca and the red seaweed, Agardhiella subulata were each concurrently exposed to two concentrations (100 or 1000 μg/L) of five metals (Cu, Ni, Pb, Cd, and Zn). Additionally, U. lactuca was exposed to 10 μg/L of the metal mixture as well as 10 or 100 μg/L of each metal individually for 48 h. The seaweeds were then used as food for the sea hare, Aplysia californica for two to three weeks depending on the exposure concentration. Body mass of A. californica was measured weekly, and at the end of the exposure duration, metal concentrations were quantified in dissected organs (mouth, esophagus, crop, gizzard, ovotestis, heart, hepatopancreas, gill, and the carcass). Metal distribution and accumulation in the organs of A. californica varied with the metal. A. californica fed the metal-exposed diets had significantly reduced body weight by the end of the exposure periods, as compared to controls; however, differences were observed in the extent of growth reductions, dependent on exposure concentration, duration, and exposure regime (metal mixture versus individual metal-exposed diet). Metal mixture diets decreased A. californica growth more so than comparable individual metal diets, despite more metal accumulating in the individual metal diets. Additionally, Zn- and Cu-contaminated algal diets decreased control-normalized growth of A. californica significantly more than comparable Cd-, Pb-, or Ni-contaminated diets. The seaweed diets in this study contained environmentally relevant tissue metal burdens. Therefore, these results have implications for metals in marine systems. Copyright © 2015. Published by Elsevier Inc.

  19. Modulatory Effects of Eschscholzia californica Alkaloids on Recombinant GABAA Receptors

    Directory of Open Access Journals (Sweden)

    Milan Fedurco

    2015-01-01

    Full Text Available The California poppy (Eschscholzia californica Cham. contains a variety of natural compounds including several alkaloids found exclusively in this plant. Because of the sedative, anxiolytic, and analgesic effects, this herb is currently sold in pharmacies in many countries. However, our understanding of these biological effects at the molecular level is still lacking. Alkaloids detected in E. californica could be hypothesized to act at GABAA receptors, which are widely expressed in the brain mainly at the inhibitory interneurons. Electrophysiological studies on a recombinant α1β2γ2 GABAA receptor showed no effect of N-methyllaurotetanine at concentrations lower than 30 μM. However, (S-reticuline behaved as positive allosteric modulator at the α3, α5, and α6 isoforms of GABAA receptors. The depressant properties of aerial parts of E. californica are assigned to chloride-current modulation by (S-reticuline at the α3β2γ2 and α5β2γ2 GABAA receptors. Interestingly, α1, α3, and α5 were not significantly affected by (R-reticuline, 1,2-tetrahydroreticuline, codeine, and morphine—suspected (S-reticuline metabolites in the rodent brain.

  20. Neurogenesis of cephalic sensory organs of Aplysia californica

    DEFF Research Database (Denmark)

    Wollesen, Tim; Wanninger, Andreas; Klussmann-Kolb, Annette

    2007-01-01

    The opisthobranch gastropod Aplysia californica serves as a model organism in experimental neurobiology because of its simple and well-known nervous system. However, its nervous periphery has been less intensely studied. We have reconstructed the ontogeny of the cephalic sensory organs (labial te...... of FMRFamide-like peptides in the modulation of peripheral sensory processes. This study is the first concerning the neurogenesis of cephalic sensory organs in A. californica and may serve as a basis for future studies of neuronal elements in gastropod molluscs.......The opisthobranch gastropod Aplysia californica serves as a model organism in experimental neurobiology because of its simple and well-known nervous system. However, its nervous periphery has been less intensely studied. We have reconstructed the ontogeny of the cephalic sensory organs (labial...... microscopy to analyze the ciliary distribution of these sensory epithelia. Labial tentacles and the lip develop during metamorphosis, whereas rhinophores appear significantly later, in stage 10 juveniles. Our study has revealed immunoreactivity against FMRFamides and serotonin in all major nerves. The common...

  1. Stabilization of Torpedo californica acetylcholinesterase by reversible inhibitors.

    Science.gov (United States)

    Weiner, Lev; Shnyrov, Valery L; Konstantinovskii, Leonid; Roth, Esther; Ashani, Yacov; Silman, Israel

    2009-01-27

    The dimeric form of Torpedo californica acetylcholinesterase provides a valuable experimental system for studying transitions between native, partially unfolded, and unfolded states since long-lived partially unfolded states can be generated by chemical modification of a nonconserved buried cysteine residue, Cys 231, by denaturing agents, by oxidative stress, and by thermal inactivation. Elucidation of the 3D structures of complexes of Torpedo californica acetylcholinesterase with a repertoire of reversible inhibitors permits their classification into three categories: (a) active-site directed inhibitors, which interact with the catalytic anionic subsite, at the bottom of the active-site gorge, such as edrophonium and tacrine; (b) peripheral anionic site inhibitors, which interact with a site at the entrance to the gorge, such as propidium and d-tubocurarine; and (c) elongated gorge-spanning inhibitors, which bridge the two sites, such as BW284c51 and decamethonium. The effects of these three categories of reversible inhibitors on the stability of Torpedo californica acetylcholinesterase were investigated using spectroscopic techniques and differential scanning calorimetry. Thermodynamic parameters obtained calorimetrically permitted quantitative comparison of the effects of the inhibitors on the enzyme's thermal stability. Peripheral site inhibitors had a relatively small effect, while gorge-spanning ligands and those binding at the catalytic anionic site, had a much larger stabilizing effect. The strongest effect was, however, observed with the polypeptide toxin, fasciculin II (FasII), even though, in terms of its binding site, it belongs to the category of peripheral site ligands. The stabilizing effect of the ligands binding at the anionic subsite of the active site, like that of the gorge-spanning ligands, may be ascribed to their capacity to stabilize the interaction between the two subdomains of the enzyme. The effect of fasciculin II may be ascribed to the

  2. The effect of within-year variation in acorn crop size on seed harvesting by avian hoarders.

    Science.gov (United States)

    Pesendorfer, Mario B; Koenig, Walter D

    2016-05-01

    Spatial and temporal variation in resource distribution affect the movement and foraging behavior of many animals. In the case of animal-dispersed trees, numerous studies have addressed masting-the synchronized variation in seed production between years-but the fitness consequences of spatial variation in seed production within a year are unclear. We investigated the effects of variable acorn production in a population of valley oaks (Quercus lobata) on the composition and behavior of the avian-disperser community. We found that western scrub-jays (Aphelocoma californica), high-quality dispersers that store seeds in the ground, were attracted to, and exhibited increased per capita dispersal rates from, trees with large acorn crops. In contrast, acorn woodpeckers (Melanerpes formicivorus), low-quality dispersers that store acorns in trees where they are unlikely to germinate, increased per capita hoarding rates but did not attend trees with large seed crops in higher numbers, suggesting that the two species responded to resources on different spatial scales. Antagonistic interactions within and between species increased with the number of birds attending a tree, resulting in a potential cost for foraging birds, but did not reduce dispersal rates. Using a simulation model, we estimated that trees with large initial crops experienced a greater proportion (77 %) of high-quality seed dispersal events than trees with small crops (62 %). Our findings provide support for a mechanistic link between seed production and foraging behavior of seed dispersers as predicted by the predator dispersal hypothesis for the functional consequences of variable seed production in hoarder-dispersed trees.

  3. Targeted oxidation of Torpedo californica acetylcholinesterase by singlet oxygen.

    Science.gov (United States)

    Weiner, Lev; Roth, Esther; Silman, Israel

    2011-01-01

    The photosensitizer, methylene blue (MB), is a strong reversible inhibitor of Torpedo californica acetylcholinesterase (AChE) in the dark. Under illumination it causes irreversible inactivation. Loss of fluorescence of the singlet oxygen ((1)O(2)) trap, 9,10-dimethylanthracene, was retarded in the presence of AChE, and the rate of photo-inactivation was increased in the presence of D(2)O, indicating that inactivation was due to (1)O(2) generated by the photosensitizer. CD revealed slightly reduced far-UV ellipticity, and slightly enhanced binding of an amphiphilic probe, indicating limited unfolding of the photo-oxidized AChE. However, both near-UV ellipticity and intrinsic fluorescence were markedly reduced, suggesting photo-oxidative damage to tryptophans, (Trp) supported by appearance of novel emission peaks ascribed to N'-formylkynurenine and/or kynurenine. Like other partially unfolded forms, the photo-oxidized AChE was sensitive to proteolysis. Photosensitized inactivation produced exclusively chemically cross-linked dimers, whereas irradiation of a partially unfolded state generated higher-order oligomers. The active-site gorge of AChE contains Trp in inhibitor-binding sites that might be targets for photo-oxidation. Indeed, reversible inhibitors retard photo-inactivation, and photo-inactivation destroys their binding sites. An excess of AChE protects paraoxonase from photo-inactivation by sequestering the photosensitizer. Affinity photo-oxidation of AChE by MB thus provides a valuable model for studying site-specific photo-inactivation of enzymes in both fundamental and clinical contexts. © 2010 The Authors. Photochemistry and Photobiology © 2010 The American Society of Photobiology.

  4. First case of synophthalmia and albinism in the Pacific angel shark Squatina californica.

    Science.gov (United States)

    Escobar-Sánchez, O; Moreno-Sánchez, X G; Aguilar-Cruz, C A; Abitia-Cárdenas, L A

    2014-08-01

    The first record in Mexican waters of albinism and synophthalmia (partial cyclopia) in the Pacific angel shark, Squatina californica is presented. Albinism is not lethal, but synophthalmia may cause the death of the individual immediately after birth. © 2014 The Fisheries Society of the British Isles.

  5. Modulation of CYPs, P-gp, and PXR by Eschscholzia californica (California poppy) and its alkaloids

    Science.gov (United States)

    Eschscholzia californica Cham., a native US plant, is traditionally used as a sedative, analgesic and anxiolytic herb. With the rapid rise in the use of herbal supplements together with over the counter (OTC) and prescription drugs, the risk for potential herb-drug interactions is also increasing. M...

  6. Cnidogenesis in the jewel anemone Corynactis californica (Carlgren, 1936) and C. viridis (Allman, 1846) (Anthozoa: Corallimorpharia)

    NARCIS (Netherlands)

    Robson, E.A.

    2004-01-01

    Precursor stages of large holotrichs in the mesenterial filaments of Corynactis californica and C.viridis have been visualised by simple methods using stained whole-mount preparations. Samples were taken from mesenterial filaments emitted during aggressive behaviour (which is reported for the first

  7. Induction of Antitumor Acquired Immunity by Baculovirus Autographa californica Multiple Nuclear Polyhedrosis Virus Infection in Mice▿

    OpenAIRE

    Kitajima, Masayuki; Takaku, Hiroshi

    2007-01-01

    The baculovirus Autographa californica multiple nuclear polyhedrosis virus (AcMNPV) has been studied as a gene therapy vector. Here, we demonstrated that AcMNPV induces antitumor acquired immunity. These results suggest that AcMNPV has the potential to be an efficient virus or tumor therapy agent which induces innate and acquired immunity.

  8. Hybridization of cultivated Vitis vinifera with wild V. californica and V. girdiana in California

    Science.gov (United States)

    The native wild grape species of northern California, Vitis californica Benth. (California wild grape), and V. girdiana Munson (desert wild grape) in southern California are under increasing pressure from loss of habitat and from interbreeding with the domesticated grapevine, V. vinifera L. For its...

  9. Identification of genes involved in DNA replication of the Autographa californica baculovirus

    NARCIS (Netherlands)

    Kool, M.; Ahrens, C. H.; Goldbach, R. W.; Rohrmann, G. F.; Vlak, J. M.

    1994-01-01

    By use of a transient replication assay, nine genes involved in DNA replication were identified in the genome of the Autographa californica baculovirus. Six genes encoding helicase, DNA polymerase, IE-1, LEF-1, LEF-2, and LEF-3 are essential for DNA replication while three genes encoding P35, IE-2,

  10. Transcriptional Correlates of Memory Maintenance Following Long-Term Sensitization of "Aplysia Californica"

    Science.gov (United States)

    Conte, Catherine; Herdegen, Samantha; Kamal, Saman; Patel, Jency; Patel, Ushma; Perez, Leticia; Rivota, Marissa; Calin-Jageman, Robert J.; Calin-Jageman, Irina E.

    2017-01-01

    We characterized the transcriptional response accompanying maintenance of long-term sensitization (LTS) memory in the pleural ganglia of "Aplysia californica" using microarray (N = 8) and qPCR (N = 11 additional samples). We found that 24 h after memory induction there is strong regulation of 1198 transcripts (748 up and 450 down) in a…

  11. Functional mapping of regions of the Autographa californica nuclear polyhedrosis viral genome required for DNA replication

    NARCIS (Netherlands)

    Kool, M.; Voeten, J. T.; Goldbach, R. W.; Vlak, J. M.

    1994-01-01

    Previous results showed that plasmids containing one of the eight putative origins (ori's) of Autographa californica nuclear polyhedrosis virus (AcMNPV) are replicated after transfection into Spodoptera frugiperda cells if essential trans-acting factors are supplied by AcMNPV infection (Kool et al.,

  12. Chemotypic Variation of Essential Oils in the Medicinal Plant, Anemopsis californica

    Science.gov (United States)

    Medina-Holguín, Andrea L.; Holguín, F. Omar; Micheletto, Sandra; Goehle, Sondra; Simon, Julian A.; O’Connell, Mary A.

    2008-01-01

    Anemopsis californica (Saururaceae) commonly called yerba mansa, is an important medicinal plant in many deserts in the southwestern region of North America. Populations of A. californica, collected throughout New Mexico, were examined for chemical variability in roots and rhizomes for select monocyclic (cymene, limonene, piperitone and thymol) and bicyclic (α-pinene, 1,8-cineole and myrtenol) monoterpenoid and phenylpropanoid (methyleugenol, isoeugenol and elemicin) derived essential oil components. Three distinct chemotypes were detected using a hierarchical clustering analysis on the concentration of 10 different analytes in three individuals from each of 17 populations. One chemotype was characterized by high elemicin concentrations, a second chemotype by high methyleugenol concentrations and the third by high piperitone and thymol concentrations. Steam distilled oil was used to screen for anticancer bioactivity. A. californica root oils demonstrated anti-proliferative activity against AN3CA and HeLa cells in vitro but no activity against lung, breast, prostate or colon cancer cells. The IC50 values for the root oil were 0.056% and 0.052% (v/v) for the AN3CA and HeLa cells respectively. PMID:18177907

  13. Storage Effect on Phenols and on the Antioxidant Activity of Extracts from Anemopsis californica and Inhibition of Elastase Enzyme

    Directory of Open Access Journals (Sweden)

    Carmen Lizette Del-Toro-Sánchez

    2015-01-01

    Full Text Available The amount of total phenols and flavonoids and the antioxidant activity of leaf, stem, and rhizome methanolic extracts from a commonly consumed Anemopsis californica under different storage conditions were investigated. Storage conditions were at 50, 25, 4, and −20°C, protected or not from light, during 180 days. The inhibition of the elastase enzyme was also evaluated. The results demonstrated that leaf, stem, and rhizome methanolic extracts of Anemopsis californica maintain approximately up to 97 and 95% stability in phenolic content and antioxidant activity, respectively, when stored during 60 days at −20°C in the dark. Additionally, these extracts, principally from leaf and rhizome, showed an elastase inhibitory effect by 75 and 71.8%, respectively. Therefore, this study provides the basis for further research on the anti-inflammatory activity. On the other hand, Anemopsis californica could comprise a good alternative of use as antioxidant in foods.

  14. Antimutagenicity of Methanolic Extracts from Anemopsis californica in Relation to Their Antioxidant Activity

    Directory of Open Access Journals (Sweden)

    Carmen Lizette Del-Toro-Sánchez

    2014-01-01

    Full Text Available Anemopsis californica has been used empirically to treat infectious diseases. However, there are no antimutagenic evaluation reports on this plant. The present study evaluated the antioxidant activity in relation to the mutagenic and antimutagenic activity properties of leaf (LME and stem (SME methanolic extracts of A. californica collected in the central Mexican state of Querétaro. Antioxidant properties and total phenols of extracts were evaluated using DPPH (1,1-diphenyl-2-picrylhydrazyl and Folin-Ciocalteu methods, respectively. Mutagenicity was evaluated using the Ames test employing Salmonella enterica serovar Typhimurium strains (TA98, TA100, and TA102, with and without an aroclor 1254 (S9 mixture. Antimutagenesis was performed against mutations induced on the Ames test with MNNG, 2AA, or 4NQO. SME presented the highest antioxidant capacity and total phenolic content. None of the extracts exhibited mutagenicity in the Ames test. The extracts produced a significant reduction in 2AA-induced mutations in S. typhimurium TA98. In both extracts, mutagenesis induced by 4NQO or methyl-N′-nitro-N-nitrosoguanidine (MNNG was reduced only if the exposure of strains was <10 μg/Petri dish. A. californca antioxidant properties and its capacity to reduce point mutations render it suitable to enhance medical cancer treatments. The significant effect against antimutagenic 2AA suggests that their consumption would provide protection against carcinogenic polycyclic aromatic compounds.

  15. Deviating from the Norm: Peculiarities of Aplysia cf. californica Early Cleavage Compared to Traditional Spiralian Models.

    Science.gov (United States)

    Chávez-Viteri, Yolanda E; Brown, Federico D; Pérez, Oscar D

    2017-01-01

    Spiralia represents one of the main clades of bilaterally symmetrical metazoans (Bilateria). This group is of particular interest due to the remarkable conservation of its early developmental pattern despite of the high diversity of larval and adult body plans. Variations during embryogenesis are considered powerful tools to determine ancestral and derived characters under a phylogenetic framework. By direct observation of embryos cultured in vitro, we analyzed the early cleavage of the euopisthobranchs Aplysia cf. californica. We used tubulin immunocytochemistry to stain mitotic spindles during early cleavages, and followed each division with the aid of an autofluorescent compound inside yolk platelets, which differed from the characteristic pink-brownish pigment of the vegetal cytoplasm in zygotes and early embryos. We found that this species exhibits an unequal cleavage characterized by ooplasmic segregation, oblique inclination of mitotic spindles, and differences in size and positioning of the asters in relation to the cellular cortex. Furthermore, we detected asynchrony in cleavage timing between the two large macromeres C and D, which increases the number of cleavage rounds required to reach a particular cell stage in comparison to other spiralians. Here, we report the presence of a transient and previously undescribed U-shaped embryo in this species. The present detailed description of A. californica early development deviates considerably from stereotypical patterns described in other spiralians. Our observations demonstrate that early spiralian development can be more plastic than previously thought. © 2016 Wiley Periodicals, Inc.

  16. Development of Screening Trials to Rank Pinus radiata Genotypes for Resistance to Defoliation by Monterey Pine Aphid (Essigella californica)

    Science.gov (United States)

    Stephen Elms; Peter Ades; Nick Collet

    2012-01-01

    The Monterey pine aphid (Essigella californica) is a recent arrival in Australia, having first been detected in 1998. It quickly spread throughout the national radiata pine (Pinus radiata D. Don) plantation estate, causing seasonal defoliation and compromising tree growth in many areas. Selection of resistant radiata...

  17. Reduced expression of Autographa californica nucleopolyhedrovirus ORF34, an essential gene, enhances heterologous gene expression

    Energy Technology Data Exchange (ETDEWEB)

    Salem, Tamer Z. [Department of Entomology, Michigan State University, East Lansing, MI 48824 (United States); Department of Microbial Molecular Biology, AGERI, Agricultural Research Center, Giza 12619 (Egypt); Division of Biomedical Sciences, Zewail University, Zewail City of Science and Technology, Giza 12588 (Egypt); Zhang, Fengrui [Department of Entomology, Michigan State University, East Lansing, MI 48824 (United States); Thiem, Suzanne M., E-mail: smthiem@msu.edu [Department of Entomology, Michigan State University, East Lansing, MI 48824 (United States); Department of Microbiology and Molecular Genetics, Michigan State University, East Lansing, MI 48824 (United States)

    2013-01-20

    Autographa californica multiple nucleopolyhedrovirus ORF34 is part of a transcriptional unit that includes ORF32, encoding a viral fibroblast growth factor (FGF) and ORF33. We identified ORF34 as a candidate for deletion to improve protein expression in the baculovirus expression system based on enhanced reporter gene expression in an RNAi screen of virus genes. However, ORF34 was shown to be an essential gene. To explore ORF34 function, deletion (KO34) and rescue bacmids were constructed and characterized. Infection did not spread from primary KO34 transfected cells and supernatants from KO34 transfected cells could not infect fresh Sf21 cells whereas the supernatant from the rescue bacmids transfection could recover the infection. In addition, budded viruses were not observed in KO34 transfected cells by electron microscopy, nor were viral proteins detected from the transfection supernatants by western blots. These demonstrate that ORF34 is an essential gene with a possible role in infectious virus production.

  18. Probing Torpedo californica acetylcholinesterase catalytic gorge with two novel bis-functional galanthamine derivatives.

    Science.gov (United States)

    Bartolucci, Cecilia; Haller, Lars A; Jordis, Ulrich; Fels, Gregor; Lamba, Doriano

    2010-01-28

    N-Piperidinopropyl-galanthamine (2) and N-saccharinohexyl-galanthamine (3) were used to investigate interaction sites along the active site gorge of Torpedo californica actylcholinesterase (TcAChE). The crystal structure of TcAChE-2 solved at 2.3 A showed that the N-piperidinopropyl group in 2 is not stretched along the gorge but is folded over the galanthamine moiety. This result was unexpected because the three carbon alkyl chain is just long enough for the bulky piperidine group to be placed above the bottleneck (Tyr121, Phe330) midway down the gorge. The crystal structure of TcAChE-3 at 2.2 A confirmed that a dual interaction with the sites at the bottom, and at the entrance of the gorge, enhances inhibitory activity: a chain of six carbon atoms has, in this class of derivatives, the correct length for optimal interactions with the peripheral anionic site (PAS).

  19. Aging in Sensory and Motor Neurons Results in Learning Failure in Aplysia californica.

    Directory of Open Access Journals (Sweden)

    Andrew T Kempsell

    Full Text Available The physiological and molecular mechanisms of age-related memory loss are complicated by the complexity of vertebrate nervous systems. This study takes advantage of a simple neural model to investigate nervous system aging, focusing on changes in learning and memory in the form of behavioral sensitization in vivo and synaptic facilitation in vitro. The effect of aging on the tail withdrawal reflex (TWR was studied in Aplysia californica at maturity and late in the annual lifecycle. We found that short-term sensitization in TWR was absent in aged Aplysia. This implied that the neuronal machinery governing nonassociative learning was compromised during aging. Synaptic plasticity in the form of short-term facilitation between tail sensory and motor neurons decreased during aging whether the sensitizing stimulus was tail shock or the heterosynaptic modulator serotonin (5-HT. Together, these results suggest that the cellular mechanisms governing behavioral sensitization are compromised during aging, thereby nearly eliminating sensitization in aged Aplysia.

  20. Proactive conservation management of an island-endemic bird species in the face of global change

    Science.gov (United States)

    Morrison, S.A.; Sillett, T. Scott; Ghalambor, Cameron K.; Fitzpatrick, J.W.; Graber, D.M.; Bakker, V.J.; Bowman, R.; Collins, C.T.; Collins, P.W.; Delaney, K.S.; Doak, D.F.; Koenig, Walter D.; Laughrin, L.; Lieberman, A.A.; Marzluff, J.M.; Reynolds, M.D.; Scott, J.M.; Stallcup, J.A.; Vickers, W.; Boyce, W.M.

    2011-01-01

    Biodiversity conservation in an era of global change and scarce funding benefits from approaches that simultaneously solve multiple problems. Here, we discuss conservation management of the island scrub-jay (Aphelocoma insularis), the only island-endemic passerine species in the continental United States, which is currently restricted to 250-square-kilometer Santa Cruz Island, California. Although the species is not listed as threatened by state or federal agencies, its viability is nonetheless threatened on multiple fronts. We discuss management actions that could reduce extinction risk, including vaccination, captive propagation, biosecurity measures, and establishing a second free-living population on a neighboring island. Establishing a second population on Santa Rosa Island may have the added benefit of accelerating the restoration and enhancing the resilience of that island's currently highly degraded ecosystem. The proactive management framework for island scrub-jays presented here illustrates how strategies for species protection, ecosystem restoration, and adaptation to and mitigation of climate change can converge into an integrated solution. ?? 2011 by American Institute of Biological Sciences. All rights reserved.

  1. Botrytis californica, a new cryptic species in the B. cinerea species complex causing gray mold in blueberries and table grapes.

    Science.gov (United States)

    Saito, S; Margosan, D; Michailides, T J; Xiao, C L

    2016-01-01

    The Botrytis cinerea species complex comprises two cryptic species, originally referred to Group I and Group II based on Bc-hch gene RFLP haplotyping. Group I was described as a new cryptic species B. pseudocinerea During a survey of Botrytis spp. causing gray mold in blueberries and table grapes in the Central Valley of California, six isolates, three from blueberries and three from table grapes, were placed in Group I but had a distinct morphological character with conidiophores significantly longer than those of B. cinerea and B. pseudocinerea We compared these with B. cinerea and B. pseudocinerea by examining morphological and physiological characters, sensitivity to fenhexamid and phylogenetic analysis inferred from sequences of three nuclear genes. Phylogenetic analysis with the three partial gene sequences encoding glyceraldehyde-3-phosate dehydrogenase (G3PDH), heat-shock protein 60 (HSP60) and DNA-dependent RNA polymerase subunit II (RPB2) supported the proposal of a new Botrytis species, B. californica, which is closely related genetically to B. cinerea, B. pseudocinerea and B. sinoviticola, all known as causal agents of gray mold of grapes. Botrytis californica caused decay on blueberry and table grape fruit inoculated with the fungus. This study suggests that B. californica is a cryptic species sympatric with B. cinerea on blueberries and table grapes in California. © 2016 by The Mycological Society of America.

  2. Integrated genomics and proteomics of the Torpedo californica electric organ: concordance with the mammalian neuromuscular junction

    Directory of Open Access Journals (Sweden)

    Mate Suzanne E

    2011-05-01

    Full Text Available Abstract Background During development, the branchial mesoderm of Torpedo californica transdifferentiates into an electric organ capable of generating high voltage discharges to stun fish. The organ contains a high density of cholinergic synapses and has served as a biochemical model for the membrane specialization of myofibers, the neuromuscular junction (NMJ. We studied the genome and proteome of the electric organ to gain insight into its composition, to determine if there is concordance with skeletal muscle and the NMJ, and to identify novel synaptic proteins. Results Of 435 proteins identified, 300 mapped to Torpedo cDNA sequences with ≥2 peptides. We identified 14 uncharacterized proteins in the electric organ that are known to play a role in acetylcholine receptor clustering or signal transduction. In addition, two human open reading frames, C1orf123 and C6orf130, showed high sequence similarity to electric organ proteins. Our profile lists several proteins that are highly expressed in skeletal muscle or are muscle specific. Synaptic proteins such as acetylcholinesterase, acetylcholine receptor subunits, and rapsyn were present in the electric organ proteome but absent in the skeletal muscle proteome. Conclusions Our integrated genomic and proteomic analysis supports research describing a muscle-like profile of the organ. We show that it is a repository of NMJ proteins but we present limitations on its use as a comprehensive model of the NMJ. Finally, we identified several proteins that may become candidates for signaling proteins not previously characterized as components of the NMJ.

  3. Integrated genomics and proteomics of the Torpedo californica electric organ: concordance with the mammalian neuromuscular junction

    Science.gov (United States)

    2011-01-01

    Background During development, the branchial mesoderm of Torpedo californica transdifferentiates into an electric organ capable of generating high voltage discharges to stun fish. The organ contains a high density of cholinergic synapses and has served as a biochemical model for the membrane specialization of myofibers, the neuromuscular junction (NMJ). We studied the genome and proteome of the electric organ to gain insight into its composition, to determine if there is concordance with skeletal muscle and the NMJ, and to identify novel synaptic proteins. Results Of 435 proteins identified, 300 mapped to Torpedo cDNA sequences with ≥2 peptides. We identified 14 uncharacterized proteins in the electric organ that are known to play a role in acetylcholine receptor clustering or signal transduction. In addition, two human open reading frames, C1orf123 and C6orf130, showed high sequence similarity to electric organ proteins. Our profile lists several proteins that are highly expressed in skeletal muscle or are muscle specific. Synaptic proteins such as acetylcholinesterase, acetylcholine receptor subunits, and rapsyn were present in the electric organ proteome but absent in the skeletal muscle proteome. Conclusions Our integrated genomic and proteomic analysis supports research describing a muscle-like profile of the organ. We show that it is a repository of NMJ proteins but we present limitations on its use as a comprehensive model of the NMJ. Finally, we identified several proteins that may become candidates for signaling proteins not previously characterized as components of the NMJ. PMID:21798097

  4. Functional characterization of Autographa californica multiple nucleopolyhedrovirus gp16 (ac130)

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Ming; Huang, Cui; Qian, Duo-Duo; Li, Lu-Lin, E-mail: lilulin@mail.ccnu.edu.cn

    2014-09-15

    To investigate the function of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) gp16, multiple gp16-knockout and repair mutants were constructed and characterized. No obvious difference in productivity of budded virus, DNA synthesis, late gene expression and morphogenesis was observed between gp16-knockout and repair viruses, but gp16 deletion resulted in six hours of lengthening in ST{sub 50} to the third instar Spodoptera exigua larvae in bioassays. GP16 was fractionated mainly in the light membrane fraction, by subcellular fractionation. A GP16-EGFP fusion protein was predominantly localized close around the nuclear membrane in infected cells, being coincident with formation of the vesicles associated with the nuclear membrane, which hosted nucleocapsids released from the nucleus. These data suggest that gp16 is not required for viral replication, but may be involved in membrane trafficking associated with the envelopment/de-envelopment of budded viruses when they cross over the nuclear membrane and pass through cytoplasm. - Highlights: • gp16 knockout and repair mutants of AcMNPV were constructed and characterized. • AcMNPV gp16 is not essential to virus replication. • Deletion of gp16 resulted in time lengthening to kill S. exigua larvae. • GP16 was localized close around the nuclear membrane of infected cells. • GP16 was fractionated in the light membrane fraction in subcellular fractionation.

  5. Stabilization of a metastable state of Torpedo californica acetylcholinesterase by chemical chaperones

    Science.gov (United States)

    Millard, Charles B.; Shnyrov, Valery L.; Newstead, Simon; Shin, Irina; Roth, Esther; Silman, Israel; Weiner, Lev

    2003-01-01

    Chemical modification of Torpedo californica acetylcholinesterase by the natural thiosulfinate allicin produces an inactive enzyme through reaction with the buried cysteine Cys 231. Optical spectroscopy shows that the modified enzyme is “native-like,” and inactivation can be reversed by exposure to reduced glutathione. The allicin-modified enzyme is, however, metastable, and is converted spontaneously and irreversibly, at room temperature, with t1/2 ≃ 100 min, to a stable, partially unfolded state with the physicochemical characteristics of a molten globule. Osmolytes, including trimethylamine-N-oxide, glycerol, and sucrose, and the divalent cations, Ca2+, Mg2+, and Mn2+ can prevent this transition of the native-like state for >24 h at room temperature. Trimethylamine-N-oxide and Mg2+ can also stabilize the native enzyme, with only slight inactivation being observed over several hours at 39°C, whereas in their absence it is totally inactivated within 5 min. The stabilizing effects of the osmolytes can be explained by their differential interaction with the native and native-like states, resulting in a shift of equilibrium toward the native state. The stabilizing effects of the divalent cations can be ascribed to direct stabilization of the native state, as supported by differential scanning calorimetry. PMID:14500892

  6. Axonal regeneration in the central nervous system of aplysia californica determined by anterograde transport of biocytin.

    Science.gov (United States)

    Johnson, S L; Schroeder, M L; Sánchez, J A; Kirk, M D

    1999-04-19

    Rhythmic biting, a component of consummatory feeding behavior in the sea hare Aplysia californica, is eliminated following bilateral cerebral-buccal connective (CBC) crushes and recovers within 14 days postlesion. To assess axonal regeneration after CBC lesions, we used biocytin backfills of CBCs followed by fluorescence labeling with streptavidin-lissamine rhodamine. Anterograde transport of biocytin showed up to 1 mm of outgrowth by regenerating axons at 3 days postlesion. At 7 days postlesion, the regenerated axons approached or had entered the ipsilateral buccal neuropil and exhibited numerous varicosities; the average rate of axonal growth was 326 microm/day for the longest, most rapidly growing axons labeled in the CBC. The number of varicosities on labeled axons, suggestive of intercellular interactions, was increased dramatically at all times postlesion. At 14 and 20 days postlesion, regenerated axons branched extensively in the ipsilateral buccal neuropil, entered the contralateral buccal neuropil, and entered peripheral nerves on both sides of the midline. At these later times postlesion, some labeled axons encircled unlabeled buccal cell bodies and exhibited branches containing numerous varicosities, indicative of axosomatic contacts. Some regenerating axons were observed in the sheath of the CBC, but the vast majority of labeled axons remained confined to the connective core, as in control preparations. The bilateral projections within the buccal ganglia of labeled cerebral-to-buccal axons and the large number of varicosities present on these processes are indicative of regenerating axons and synapses that likely contribute to the functional recovery of rhythmic biting.

  7. Synaptic vesicles isolated from the electric organ of Torpedo californica and from the central nervous system of Mus musculus contain small ribonucleic acids (sRNAs

    Directory of Open Access Journals (Sweden)

    Huinan Li

    2017-06-01

    Full Text Available Synaptic vesicles (SVs are presynaptic organelles that load and release small molecule neurotransmitters at chemical synapses. In addition to classic neurotransmitters, we have demonstrated that SVs isolated from the Peripheral Nervous Systems (PNS of the electric organ of Torpedo californica, a model cholinergic synapse, and SVs isolated from the Central Nervous System (CNS of Mus musculus (mouse contain small ribonucleic acids (sRNAs; ≤50 nucleotides (Scientific Reports, 5:1–14(14918 Li et al. (2015 [1]. Our previous publication provided the five most abundant sequences associated with the T. californica SVs, and the ten most abundant sequences associated with the mouse SVs, representing 59% and 39% of the total sRNA reads sequenced, respectively. We provide here a full repository of the SV sRNAs sequenced from T. californica and the mouse deposited in the NCBI as biosamples. Three data studies are included: SVs isolated from the electric organ of T. californica using standard techniques, SVs isolated from the electric organ of T. californica using standard techniques with an additional affinity purification step, and finally, SVs isolated from the CNS of mouse. The three biosamples are available at https://www.ncbi.nlm.nih.gov/biosample/ SRS1523467, SRS1523466, and SRS1523472 respectively.

  8. Synaptic vesicles isolated from the electric organ of Torpedo californica and from the central nervous system of Mus musculus contain small ribonucleic acids (sRNAs).

    Science.gov (United States)

    Li, Huinan; Wu, Cheng; Aramayo, Rodolfo; Sachs, Matthew S; Harlow, Mark L

    2017-06-01

    Synaptic vesicles (SVs) are presynaptic organelles that load and release small molecule neurotransmitters at chemical synapses. In addition to classic neurotransmitters, we have demonstrated that SVs isolated from the Peripheral Nervous Systems (PNS) of the electric organ of Torpedo californica, a model cholinergic synapse, and SVs isolated from the Central Nervous System (CNS) of Mus musculus (mouse) contain small ribonucleic acids (sRNAs; ≤ 50 nucleotides) (Scientific Reports, 5:1-14(14918) Li et al. (2015) [1]). Our previous publication provided the five most abundant sequences associated with the T. californica SVs, and the ten most abundant sequences associated with the mouse SVs, representing 59% and 39% of the total sRNA reads sequenced, respectively). We provide here a full repository of the SV sRNAs sequenced from T. californica and the mouse deposited in the NCBI as biosamples. Three data studies are included: SVs isolated from the electric organ of T. californica using standard techniques, SVs isolated from the electric organ of T. californica using standard techniques with an additional affinity purification step, and finally, SVs isolated from the CNS of mouse. The three biosamples are available at https://www.ncbi.nlm.nih.gov/biosample/ SRS1523467, SRS1523466, and SRS1523472 respectively.

  9. Comparison of the chemistry and diversity of endophytes isolated from wild-harvested and greenhouse-cultivated yerba mansa (Anemopsis californica)

    Science.gov (United States)

    Bussey, Robert O.; Kaur, Amninder; Todd, Daniel A.; Egan, Joseph M.; El-Elimat, Tamam; Graf, Tyler N.; Raja, Huzefa A.; Oberlies, Nicholas H.; Cech, Nadja B.

    2015-01-01

    With this study, we explored the identity and chemistry of fungal endophytes from the roots of yerba mansa [Anemopsis californica (Nutt.) Hook. & Arn. (Saururaceae)], a botanical traditionally used to treat infection. We compared the diversity of fungal endophytes isolated from a wild-harvested A. californica population, and those from plants cultivated for one year in a greenhouse environment. The wild-harvested population yielded thirteen fungal strains (eleven unique genotypes). Of the extracts prepared from these fungi, four inhibited growth of Staphylococcus aureus by >25% at 20 µg/mL, and three inhibited growth of Pseudomonas aeruginosa by ≥20% at 200 µg/mL. By comparison, A. californica roots after one year of cultivation in the greenhouse produced only two unique genotypes, neither of which displayed significant antimicrobial activity. The fungus Chaetomium cupreum isolated from wild-harvested A. californica yielded a new antimicrobial spirolactone, chaetocuprum (1). An additional fourteen known compounds were identified using LC-MS dereplication of the various fungal endophytes. This study provides new insights into the identity and chemistry of A. californica fungal endophytes, and demonstrates the importance of considering growing conditions when pursuing natural product drug discovery from endophytic fungi. PMID:25642298

  10. Two 'new' renicolid trematodes (Trematoda: Digenea: Renicolidae) from the California horn snail, Cerithidea californica (Haldeman, 1840) (Gastropoda: Potamididae).

    Science.gov (United States)

    Hechinger, Ryan F; Miura, Osamu

    2014-04-01

    This manuscript describes the daughter parthenitae (sporocysts) and cercariae of two species of renicolid xiphidiocercaria that infect the California horn snail, Cerithidea californica, which serves as first intermediate host for a diverse and ecologically important guild of digenean trematode parasitic castrators. The two species described here have previously been considered to be a single morphospecies in ecological and evolutionary research. We provide provisional species names to respect that digenean alpha taxonomy is currently focused on sexual (adult) stages, while simultaneously respecting the spirit and utility of formal nomenclature in providing unambiguously unique, species-level names that also clarify to the extent possible species' taxonomic affiliations. The first species, Renicola sp. "polychaetophila" is most readily distinguishable from previously described renicolid xiphidiocercariae by a combination of (1) having a penetration gland duct arrangement of 2[(1+3+1)+1], (2) having one pair of penetration glands positioned anteriorly to the main gland cluster, (3) lacking tegmental spines, and (4) infecting Cerithidea californica. The second species, Renicola sp. "martini", is most readily distinguishable from other renicolid xiphidiocercariae that also have tegmental spines by a combination of (1) having a simple, bullet-shaped oral stylet sclerotized for 50-80% of its length, (2) having a cystogenous-gland field with an anterior-most extent about half way between the oral and ventral suckers, and (3) in infecting Cerithidea californica. Phylogenetic analyses using DNA (COI and ITS1) sequence data support that these two trematodes represent distinct species of Renicola. We also (1) provide an emended diagnosis for renicolid cercariae, (2) highlight a few morphological characters that may be useful for future taxonomic work involving renicolid xiphidiocercariae, and (3) suggest that future descriptive work involving trematode parthenitae include

  11. Fecundity of the crustacean Mysidopsis californica (Mysida, Mysidae under semi-controlled conditions

    Directory of Open Access Journals (Sweden)

    Armando A Ortega-Salas

    2008-06-01

    Full Text Available Mysid crustaceans are frequently used in the laboratory to feed cephalopods and fish, but not along the Pacific coast, where they are scarce. There is no commercial aquaculture of mysids in the Pacific Ocean. To change this situation, we calculate fecundity, survival, and sex ratio of Mysidopsis californica under semi-controlled conditions. Mysids were collected manually using a 500 µm-mesh net along the rocky coast of Mazatlán, Sinaloa, Mexico. They were transferred to three 30 L seawater aquaria in the laboratory, and fed (ad libitum Artemia nauplii and rotifers. Two generations were obtained. The relationship between the number of juveniles born and parent female lengths showed a rate of 1.56 juveniles released per each unit of increasing parent female length. An average parent female length of 6.92 mm (SD=0.82 gave 9.96 (SD=4.29 released juveniles. The frequency of female length showed a mean of 7.3 mm (SD=0.54, whereas that of juveniles showed a mean of 1.7 mm (SD=0.16. Survival and sex ratios (females-males varied from 77.7 % to 88.6 % and 2.5:1 to 3.0:1, respectively. Rev. Biol. Trop. 56 (2: 535-539. Epub 2008 June 30.El objetivo de este trabajo fue calcular la fecundidad, supervivencia y la proporción de sexos de Mysidopsis californica en condiciones semi-controladas. Los animales fueron recolectados manualmente utilizando una red con malla de 500 µm a lo largo de la costa rocosa de Mazatlán, Sinaloa, México. Una vez en el laboratorio fueron colocados en tres acuarios de 30 L cada uno y alimentados con nauplios de Artemia y rotíferos; estudiándose dos generaciones. La relación entre el número de jóvenes nacidos y la longitud de las madres dio una tasa de 1.56 jóvenes nacidos por cada unidad de incremento de la longitud de la hembra. En promedio, hembras de 6.92 mm (SD=0.82 producían 9.96 (SD=4.29 jóvenes. La frecuencia de la longitud promedio de la hembra fue de 7.3 mm (SD=0.54, mientras que los jóvenes medían en promedio

  12. Plant-determined variation in cardenolide content and thin-layer chromatography profiles of monarch butterflies,Danaus plexippus reared on milkweed plants in California : 3. Asclepias californica.

    Science.gov (United States)

    Brower, L P; Seiber, J N; Nelson, C J; Lynch, S P; Hoggard, M P; Cohen, J A

    1984-12-01

    Variation in gross cardenolide concentration of the mature leaves of 85Asclepias californica plants collected in four different areas of California is a positively skewed distribution ranging from 9 to 199 μg of cardenolide per 0.1 g dry weight with a mean of 66 μg/0.1 g. Butterflies reared individually on these plants in their native habitats contained a normal distribution of cardenolide ranging from 59 to 410 μg of cardenolide per 0.1 g dry weight with a mean of 234 μg. Cardenolide uptake by the butterflies was a logarithmic function of plant concentration. Total cardenolide per butterfly ranged from 143 to 823 μg with a mean of 441 μg and also was normally distributed. Populational variation of plant cardenolide concentrations occurs within subspecies, but the northern subspeciesA. c. greenei does not differ significantly from the southernA. c. californica. Generally higher concentrations occur in butterflies from northern populations and in females. No evidence was adduced that cardenolides in the plants adversely affected the butterflies. Low cardenolide concentrations in the leaves and the absence of cardenolides in the latex characterize bothA. californica andA. speciosa, but notA. eriocarpa. Thin-layer chromatography in two solvent systems isolated 24 cardenolide spots in the plants, of which 18 are stored by the butterflies. There was a minor difference in the cardenolide spot patterns due to geographic origin of the plants, but as in our previous studies, none in the sexes of the butterflies. UnlikeA. eriocarpa andA. speciosa, A. californica plants lack cardenolides withRf values greater than digitoxigenin. Overall, the cardenolides of bothA. californica andA. speciosa are more polar than those inA. eriocarpa. A. californica plants contain cardenolides of the calotropagenin series including calotropin, calactin, and uscharidin, and the latter is metabolically transformed by monarch larvae to calactin and calotropin. Cardenolides of this series also

  13. Shading decreases the abundance of the herbivorous California horn snail, Cerithidea californica

    Science.gov (United States)

    Lorda, Julio; Lafferty, Kevin D.

    2012-01-01

    Most of the intertidal zone in estuaries of California, USA and Baja California, Mexico is covered with vascular vegetation. Shading by these vascular plants influences abiotic and biotic processes that shape benthic community assemblages. We present data on the effects of shading on the California horn snail, Cerithidea californica. This species is important because it is the most common benthic macrofaunal species in these systems and acts as an obligate intermediate host of several species of rematode parasites that infect several other species. Using observational and experimental studies, we found a negative effect of shade on the distribution and abundance of the California horn snail. We hypothesized that shading reduces the abundance of the epipelic diatoms that the snails feeds on, causing snails to leave haded areas. We observed a negative relationship between vascular plant cover, sub-canopy light levels, and snail density in Mugu Lagoon. Then we experimentally manipulated light regimes, by clipping vegetation and adding shade structures, and found higher snail densities at higher light levels. In Goleta Slough, we isolated the effect of shade from vegetation by documenting a negative relationship between the shade created by two bridges and diatom and snail densities. We also found that snails moved the greatest distances over shaded channel banks compared to unshaded channel banks. Further, we documented the effect of water depth and channel bank orientation on shading in this system. An additional effect of shading is the reduction of temperature, providing an alternative explanation for some of our results. These results broaden our knowledge of how variation in the light environment influences the ecology of estuarine ecosystems.

  14. Urotensin II in invertebrates: from structure to function in Aplysia californica.

    Directory of Open Access Journals (Sweden)

    Elena V Romanova

    Full Text Available Neuropeptides are ancient signaling molecules that are involved in many aspects of organism homeostasis and function. Urotensin II (UII, a peptide with a range of hormonal functions, previously has been reported exclusively in vertebrates. Here, we provide the first direct evidence that UII-like peptides are also present in an invertebrate, specifically, the marine mollusk Aplysia californica. The presence of UII in the central nervous system (CNS of Aplysia implies a more ancient gene lineage than vertebrates. Using representational difference analysis, we identified an mRNA of a protein precursor that encodes a predicted neuropeptide, we named Aplysia urotensin II (apUII, with a sequence and structural similarity to vertebrate UII. With in-situ hybridization and immunohistochemistry, we mapped the expression of apUII mRNA and its prohormone in the CNS and localized apUII-like immunoreactivity to buccal sensory neurons and cerebral A-cluster neurons. Mass spectrometry performed on individual isolated neurons, and tandem mass spectrometry on fractionated peptide extracts, allowed us to define the posttranslational processing of the apUII neuropeptide precursor and confirm the highly conserved cyclic nature of the mature neuropeptide apUII. Electrophysiological analysis of the central effects of a synthetic apUII suggests it plays a role in satiety and/or aversive signaling in feeding behaviors. Finding the homologue of vertebrate UII in the numerically small CNS of an invertebrate animal model is important for gaining insights into the molecular mechanisms and pathways mediating the bioactivity of UII in the higher metazoan.

  15. A mechanism of adaptation to hypergravity in the statocyst of Aplysia californica

    Science.gov (United States)

    Pedrozo, H. A.; Schwartz, Z.; Luther, M.; Dean, D. D.; Boyan, B. D.; Wiederhold, M. L.

    1996-01-01

    The gravity-sensing organ of Aplysia californica consists of bilaterally paired statocysts containing statoconia, which are granules composed of calcium carbonate crystals in an organic matrix. In early embryonic development, Aplysia contain a single granule called a statolith, and as the animal matures, statoconia production takes place. The objective of this study was to determine the effect of hypergravity on statoconia production and homeostasis and explore a possible physiologic mechanism for regulating this process. Embryonic Aplysia were exposed to normogravity or 3 x g or 5.7 x g and each day samples were analyzed for changes in statocyst, statolith, and body dimensions until they hatched. In addition, early metamorphosed Aplysia (developmental stages 7-10) were exposed to hypergravity (2 x g) for 3 weeks, and statoconia number and statocyst and statoconia volumes were determined. We also determined the effects of hypergravity on statoconia production and homeostasis in statocysts isolated from developmental stage 10 Aplysia. Since prior studies demonstrated that urease was important in the regulation of statocyst pH and statoconia formation, we also evaluated the effect of hypergravity on urease activity. The results show that hypergravity decreased statolith and body diameter in embryonic Aplysia in a magnitude-dependent fashion. In early metamorphosed Aplysia, hypergravity decreased statoconia number and volume. Similarly, there was an inhibition of statoconia production and a decrease in statoconia volume in isolated statocysts exposed to hypergravity in culture. Urease activity in statocysts decreased after exposure to hypergravity and was correlated with the decrease in statoconia production observed. In short, there was a decrease in statoconia production with exposure to hypergravity both in vivo and in vitro and a decrease in urease activity. It is concluded that exposure to hypergravity downregulates urease activity, resulting in a significant

  16. A model for short alpha-neurotoxin bound to nicotinic acetylcholine receptor from Torpedo californica.

    Science.gov (United States)

    Mordvintsev, Dmitry Y; Polyak, Yakov L; Kuzmine, Dmitry A; Levtsova, Olga V; Tourleigh, Yegor V; Kasheverov, Igor E

    2006-01-01

    Short- and long-chain alpha-neurotoxins from snake venoms are potent blockers of nicotinic acetylcholine receptors (nAChRs). Short alpha-neurotoxins consist of 60-62 amino acid residues and include 4 disulfide bridges, whereas long alpha-neurotoxins have 66-75 residues and 5 disulfides. The spatial structure of these toxins is built by three loops, I-III "fingers," confined by four disulfide bridges; the fifth disulfide of long-chain alpha-neurotoxins is situated close to the tip of central loop II. An accurate knowledge of the mode of alpha-neurotoxin-nAChR interaction is important for rational design of new nAChR agonists and antagonists for medical purposes. Ideas on the topography of toxin-nAChR complexes were based until recently on nAChR interactions with selectively labeled alpha-neurotoxins, mutations in toxins, nAChR, or both. Recently, crystal structures have been solved for the Torpedo marmorata nAChR (4A[Unwin, 2005]) and for the acetylcholine-binding protein (AChBP) complexed with mollusk alpha-conotoxin (2.4 A[Celie et al., 2005]) or alpha-cobratoxin, long-chain alpha-neurotoxin (4 A [Bourne et al., 2005]). However, there were no angstrom-resolution models for complexes of short-chain alpha-neurotoxins. Here, we report the model of the Torpedo californica nAChR extracellular domain complexed to a short-chain alpha-neurotoxin II (NTII) from Naja oxiana cobra venom.

  17. A mechanism for negative gene regulation in Autographa californica multinucleocapsid nuclear polyhedrosis virus

    Science.gov (United States)

    Leisy, D.J.; Rasmussen, C.; Owusu, E.O.; Rohrmann, G.F.

    1997-01-01

    The Autographa californica multinucleocapsid nuclear polyhedrosis virus (AcMNPV) ie-1 gene product (IE-1) is thought to play a central role in stimulating early viral transcription. IE-1 has been demonstrated to activate several early viral gene promoters and to negatively regulate the promoters of two other AcMNPV regulatory genes, ie-0 and ie-2. Our results indicate that IE-1 negatively regulates the expression of certain genes by binding directly, or as part of a complex, to promoter regions containing a specific IE-1-binding motif (5'-ACBYGTAA-3') near their mRNA start sites. The IE-1 binding motif was also found within the palindromic sequences of AcMNPV homologous repeat (hr) regions that have been shown to bind IE-1. The role of this IE-1 binding motif in the regulation of the ie-2 and pe-38 promoters was examined by introducing mutations in these promoters in which the central 6 bp were replaced with Bg/II sites. GUS reporter constructs containing ie-2 and pe-38 promoter fragments with and without these specific mutations were cotransfected into Sf9 cells with various amounts of an ie-1-containing plasmid (ple-1). Comparisons of GUS expression produced by the mutant and wild-type constructs demonstrated that the IE-1 binding motif mediated a significant decrease in expression from the ie-2 and pe-38 promoters in response to increasing pIe-1 concentrations. Electrophoretic mobility shift assays with pIe-1-transfected cell extracts and supershift assays with IE-1- specific antiserum demonstrated that IE-1 binds to promoter fragments containing the IE-1 binding motif but does not bind to promoter fragments lacking this motif.

  18. Functional characterization of the ubiquitin variant encoded by the baculovirus Autographa californica.

    Science.gov (United States)

    Haas, A L; Katzung, D J; Reback, P M; Guarino, L A

    1996-04-30

    The marked evolutionary conservation of ubiquitin is assumed to arise from constraints imposed by folding, stability, and interaction of the polypeptide with various components of the ATP, ubiquitin-dependent degradative pathway. The present studies characterize the most divergent (75% identity) of the species-specific ubiquitin isoforms encoded as a late gene product of the baculovirus Autographa californica [Guarino, L. A. (1990) Proc. Natl. Acad. Sci. U.S.A. 87, 409-413]. Viral ubiquitin supports 40% of the rate of ATP-dependent degradation exhibited by eukaryotic ubiquitin. Inhibition of proteolysis correlated with a lower steady-state concentration of ubiquitin-conjugated degradative intermediates. Rate studies revealed that viral ubiquitin exerts its effect at the step of isopeptide ligase-catalyzed (E3) ubiquitin conjugation since viral and eukaryotic polypeptides are identical in their abilities to support ATP-coupled activation by E1 and transthiolation to E2 carrier proteins. Other studies demonstrated viral ubiquitin severely attenuated the rate of K48-linked multiubiquitin chain formation in E3-independent conjugation catalyzed by recombination yeast CDC34 or rabbit reticulocyte E232K but not chain elongation of alternate linkages formed by yeast RAD6 or human E2EPF. The latter observations suggest nonconserved positions on viral ubiquitin constitute recognition signals for K48-linked chain formation. Sequence comparison of species-specific ubiquitin isoforms indicates that nonconserved positions localized to a defined region on the polypeptide surface distinct from the basic face required for E1 binding. These results suggest this novel ubiquitin isoform may function in baculoviral replication to block destruction of a short-lived protein(s) by the host degradative pathway, targeted through either E2-catalyzed K48-linked multibiquitin chain formation or general E3-mediated conjugation.

  19. Modulation of benzylisoquinoline alkaloid biosynthesis by heterologous expression of CjWRKY1 in Eschscholzia californica cells.

    Directory of Open Access Journals (Sweden)

    Yasuyuki Yamada

    Full Text Available Transcription factors control many processes in plants and have high potentials to manipulate specialized metabolic pathways. Transcriptional regulation of the biosynthesis of monoterpenoid indole alkaloids (MIAs, nicotine alkaloids, and benzylisoquinoline alkaloids (BIAs has been characterized using Catharanthus roseus, Nicotiana and Coptis plants. However, metabolic engineering in which specific transcription factors are used in alkaloid biosynthesis is limited. In this study, we characterized the effects of ectopic expression of CjWRKY1, which is a transcriptional activator with many targets in BIA biosynthesis in Coptis japonica (Ranunculaceae and Eschscholzia californica (California poppy, Papaveraceae. Heterologous expression of CjWRKY1 in cultured California poppy cells induced increases in transcripts of several genes encoding BIA biosynthetic enzymes. Metabolite analyses indicated that the overexpression of the CjWRKY1 gene also induced increases in the accumulation of BIAs such as sanguinarine, chelerythrine, chelirubine, protopine, allocryptopine, and 10-hydroxychelerythrine in the culture medium. Previous characterization of EcbHLH1 and current results indicated that both transcription factors, WRKY1 and bHLH1, are substantially involved in the regulation of BIA biosynthesis. We discuss the function of CjWRKY1 in E. californica cells and its potential for metabolic engineering in BIA biosynthesis.

  20. Pseudotyping Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV): F Proteins from Group II NPVs are functionally analogous to AcMNPV GP64

    NARCIS (Netherlands)

    Lung, O.; Westenberg, M.; Vlak, J.M.; Zuidema, D.; Blissard, G.W.

    2002-01-01

    GP64, the major envelope glycoprotein of budded virions of the baculovirus Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV), is involved in viral attachment, mediates membrane fusion during virus entry, and is required for efficient virion budding. Thus, GP64 is essential for viral

  1. Myogenesis in Aplysia californica (Cooper, 1863) (Mollusca, Gastropoda, Opisthobranchia) with special focus on muscular remodeling during metamorphosis.

    Science.gov (United States)

    Wollesen, Tim; Wanninger, Andreas; Klussmann-Kolb, Annette

    2008-07-01

    To date only few comparative approaches tried to reconstruct the ontogeny of the musculature in invertebrates. This may be due to the difficulties involved in reconstructing three dimensionally arranged muscle systems by means of classical histological techniques combined with light or transmission electron microscopy. Within the scope of the present study we investigated the myogenesis of premetamorphic, metamorphic, and juvenile developmental stages of the anaspidean opisthobranch Aplysia californica using fluorescence F-actin-labeling in conjunction with modern confocal laser scanning microscopy. We categorized muscles with respect to their differentiation and degeneration and found three true larval muscles that differentiate during the embryonic and veliger phase and degenerate during or slightly after metamorphosis. These are the larval retractor, the accessory larval retractor, and the metapodial retractor muscle. While the pedal retractor muscle, some transversal mantle fibers and major portions of the cephalopedal musculature are continued and elaborated during juvenile and adult life, the buccal musculature and the anterior retractor muscle constitute juvenile/adult muscles which differentiate during or after metamorphosis. The metapodial retractor muscle has never been reported for any other gastropod taxon. Our findings indicate that the late veliger larva of A. californica shares some common traits with veligers of other gastropods, such as a larval retractor muscle. However, the postmetamorphic stages exhibit only few congruencies with other gastropod taxa investigated to date, which is probably due to common larval but different adult life styles within gastropods. Accordingly, this study provides further evidence for morphological plasticity in gastropod myogenesis and stresses the importance of ontogenetic approaches to understand adult conditions and life history patterns. Copyright 2008 Wiley-Liss, Inc.

  2. Hybridization of cultivated Vitis vinifera with wild V. californica and V. girdiana in California.

    Science.gov (United States)

    Dangl, Gerald S; Mendum, Mary Lou; Yang, Judy; Walker, M Andrew; Preece, John E

    2015-12-01

    Hybridization of introduced domesticates and closely related natives is well documented in annual crops. The widespread introduction of the domesticated grapevine, Vitis vinifera, into California where it overlaps with two native congenerics, with which it is interfertile, provides opportunity to investigate hybridization between woody perennials. Although geographically widespread, the introduction over the past two centuries has been limited to a few elite clonal cultivars, providing a unique opportunity to study the effects of hybridization on the native species. The amount of hybridization with V. vinifera and the genetic diversity of wild-growing Vitis californica and Vitis girdiana were examined using nineteen microsatellite markers. STRUCTURE analysis was used to define hybrid and introgressed individuals and to analyze genetic structure of the native species. FAMOZ software was used to identify which V. vinifera cultivars served as parents of F 1 hybrids. The three species were clearly distinguished by STRUCTURE analysis. Thirty percent of 119 V. californica vines were hybrids. The domesticated parent was identified for 16 F 1 hybrid vines; the original California cultivar, 'Mission', was the parent of eight. Backcrosses were also found, showing introgression into subsequent generations. Similar results were obtained for a small sample of V. girdiana. Removing hybrids greatly reduced the genetic variation of the presumed pure species, among which there was essentially no genetic structure. Limited genetic variability indicates the California natives may be threatened by genetic erosion. The discovery of F 1 hybrids of 'Mission', a cultivar not grown in the areas for ~100 years, suggests long generation times for wild vines that, often, grow into expansive liana and propagate by layering, all factors that limit recruitment in populations already disjunct by habitat lose. Hermaphroditic flowers and fruit that is more attractive to birds may favor the

  3. Draft de novo transcriptome assembly and proteome characterization of the electric lobe of Tetronarce californica: a molecular tool for the study of cholinergic neurotransmission in the electric organ.

    Science.gov (United States)

    Stavrianakou, Maria; Perez, Ricardo; Wu, Cheng; Sachs, Matthew S; Aramayo, Rodolfo; Harlow, Mark

    2017-08-14

    The electric organ of Tetronarce californica (an electric ray formerly known as Torpedo californica) is a classic preparation for biochemical studies of cholinergic neurotransmission. To broaden the usefulness of this preparation, we have performed a transcriptome assembly of the presynaptic component of the electric organ (the electric lobe). We combined our assembled transcriptome with a previous transcriptome of the postsynaptic electric organ, to define a MetaProteome containing pre- and post-synaptic components of the electric organ. Sequencing yielded 102 million paired-end 100 bp reads. De novo Trinity assembly was performed at Kmer 25 (default) and Kmers 27, 29, and 31. Trinity, generated around 103,000 transcripts, and 78,000 genes per assembly. Assemblies were evaluated based on the number of bases/transcripts assembled, RSEM-EVAL scores and informational content and completeness. We found that different assemblies scored differently according to the evaluation criteria used, and that while each individual assembly contained unique information, much of the assembly information was shared by all assemblies. To generate the presynaptic transcriptome (electric lobe), while capturing all information, assemblies were first clustered and then combined with postsynaptic transcripts (electric organ) downloaded from NCBI. The completness of the resulting clustered predicted MetaProteome was rigorously evaluated by comparing its information against the predicted proteomes from Homo sapiens, Callorhinchus milli, and the Transporter Classification Database (TCDB). In summary, we obtained a MetaProteome containing 92%, 88.5%, and 66% of the expected set of ultra-conserved sequences (i.e., BUSCOs), expected to be found for Eukaryotes, Metazoa, and Vertebrata, respectively. We cross-annotated the conserved set of proteins shared between the T. californica MetaProteome and the proteomes of H. sapiens and C. milli, using the H. sapiens genome as a reference. This

  4. Autographa californica multiple nucleopolyhedrovirus DNA polymerase C terminus is required for nuclear localization and viral DNA replication.

    Science.gov (United States)

    Feng, Guozhong; Krell, Peter J

    2014-09-01

    The DNA polymerase (DNApol) of the baculovirus Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is essential for viral DNA replication. The DNApol exonuclease and polymerase domains are highly conserved and are considered functional in DNA replication. However, the role of the DNApol C terminus has not yet been characterized. To identify whether only the exonuclease and polymerase domains are sufficient for viral DNA replication, several DNApol C-terminal truncations were cloned into a dnapol-null AcMNPV bacmid with a green fluorescent protein (GFP) reporter. Surprisingly, most of the truncation constructs, despite containing both exonuclease and polymerase domains, could not rescue viral DNA replication and viral production in bacmid-transfected Sf21 cells. Moreover, GFP fusions of these same truncations failed to localize to the nucleus. Truncation of the C-terminal amino acids 950 to 984 showed nuclear localization but allowed for only limited and delayed viral spread. The C terminus contains a typical bipartite nuclear localization signal (NLS) motif at residues 804 to 827 and a monopartite NLS motif at residues 939 to 948. Each NLS, as a GFP fusion peptide, localized to the nucleus, but both NLSs were required for nuclear localization of DNApol. Alanine substitutions in a highly conserved baculovirus DNApol sequence at AcMNPV DNApol amino acids 972 to 981 demonstrated its importance for virus production and DNA replication. Collectively, the data indicated that the C terminus of AcMNPV DNApol contains two NLSs and a conserved motif, all of which are required for nuclear localization of DNApol, viral DNA synthesis, and virus production. The baculovirus DNA polymerase (DNApol) is a highly specific polymerase that allows viral DNA synthesis and hence virus replication in infected insect cells. We demonstrated that the exonuclease and polymerase domains of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) alone are insufficient for viral

  5. Oak habitat recovery on California's largest islands: Scenarios for the role of corvid seed dispersal

    Science.gov (United States)

    Pesendorfer, Mario B.; Baker, Christopher M.; Stringer, Martin; McDonald-Madden, Eve; Bode, Michael; McEachern, A. Kathryn; Morrison, Scott A.; Sillett, T. Scott

    2017-01-01

    Seed dispersal by birds is central to the passive restoration of many tree communities. Reintroduction of extinct seed dispersers can therefore restore degraded forests and woodlands. To test this, we constructed a spatially explicit simulation model, parameterized with field data, to consider the effect of different seed dispersal scenarios on the extent of oak populations. We applied the model to two islands in California's Channel Islands National Park (USA), one of which has lost a key seed disperser.We used an ensemble modelling approach to simulate island scrub oak (Quercus pacifica) demography. The model was developed and trained to recreate known population changes over a 20-year period on 250-km2 Santa Cruz Island, and incorporated acorn dispersal by island scrub-jays (Aphelocoma insularis), deer mice (Peromyscus maniculatus) and gravity, as well as seed predation. We applied the trained model to 215-km2 Santa Rosa Island to examine how reintroducing island scrub-jays would affect the rate and pattern of oak population expansion. Oak habitat on Santa Rosa Island has been greatly reduced from its historical extent due to past grazing by introduced ungulates, the last of which were removed by 2011.Our simulation model predicts that a seed dispersal scenario including island scrub-jays would increase the extent of the island scrub oak population on Santa Rosa Island by 281% over 100 years, and by 544% over 200 years. Scenarios without jays would result in little expansion. Simulated long-distance seed dispersal by jays also facilitates establishment of discontinuous patches of oaks, and increases their elevational distribution.Synthesis and applications. Scenario planning provides powerful decision support for conservation managers. We used ensemble modelling of plant demographic and seed dispersal processes to investigate whether the reintroduction of seed dispersers could provide cost-effective means of achieving broader ecosystem restoration goals on

  6. Deconstructing isolation-by-distance: The genomic consequences of limited dispersal.

    Science.gov (United States)

    Aguillon, Stepfanie M; Fitzpatrick, John W; Bowman, Reed; Schoech, Stephan J; Clark, Andrew G; Coop, Graham; Chen, Nancy

    2017-08-01

    Geographically limited dispersal can shape genetic population structure and result in a correlation between genetic and geographic distance, commonly called isolation-by-distance. Despite the prevalence of isolation-by-distance in nature, to date few studies have empirically demonstrated the processes that generate this pattern, largely because few populations have direct measures of individual dispersal and pedigree information. Intensive, long-term demographic studies and exhaustive genomic surveys in the Florida Scrub-Jay (Aphelocoma coerulescens) provide an excellent opportunity to investigate the influence of dispersal on genetic structure. Here, we used a panel of genome-wide SNPs and extensive pedigree information to explore the role of limited dispersal in shaping patterns of isolation-by-distance in both sexes, and at an exceedingly fine spatial scale (within ~10 km). Isolation-by-distance patterns were stronger in male-male and male-female comparisons than in female-female comparisons, consistent with observed differences in dispersal propensity between the sexes. Using the pedigree, we demonstrated how various genealogical relationships contribute to fine-scale isolation-by-distance. Simulations using field-observed distributions of male and female natal dispersal distances showed good agreement with the distribution of geographic distances between breeding individuals of different pedigree relationship classes. Furthermore, we built coalescent simulations parameterized by the observed dispersal curve, population density, and immigration rate, and showed how incorporating these extensions to Malécot's theory of isolation-by-distance allows us to accurately reconstruct observed sex-specific isolation-by-distance patterns in autosomal and Z-linked SNPs. Therefore, patterns of fine-scale isolation-by-distance in the Florida Scrub-Jay can be well understood as a result of limited dispersal over contemporary timescales.

  7. Deconstructing isolation-by-distance: The genomic consequences of limited dispersal.

    Directory of Open Access Journals (Sweden)

    Stepfanie M Aguillon

    2017-08-01

    Full Text Available Geographically limited dispersal can shape genetic population structure and result in a correlation between genetic and geographic distance, commonly called isolation-by-distance. Despite the prevalence of isolation-by-distance in nature, to date few studies have empirically demonstrated the processes that generate this pattern, largely because few populations have direct measures of individual dispersal and pedigree information. Intensive, long-term demographic studies and exhaustive genomic surveys in the Florida Scrub-Jay (Aphelocoma coerulescens provide an excellent opportunity to investigate the influence of dispersal on genetic structure. Here, we used a panel of genome-wide SNPs and extensive pedigree information to explore the role of limited dispersal in shaping patterns of isolation-by-distance in both sexes, and at an exceedingly fine spatial scale (within ~10 km. Isolation-by-distance patterns were stronger in male-male and male-female comparisons than in female-female comparisons, consistent with observed differences in dispersal propensity between the sexes. Using the pedigree, we demonstrated how various genealogical relationships contribute to fine-scale isolation-by-distance. Simulations using field-observed distributions of male and female natal dispersal distances showed good agreement with the distribution of geographic distances between breeding individuals of different pedigree relationship classes. Furthermore, we built coalescent simulations parameterized by the observed dispersal curve, population density, and immigration rate, and showed how incorporating these extensions to Malécot's theory of isolation-by-distance allows us to accurately reconstruct observed sex-specific isolation-by-distance patterns in autosomal and Z-linked SNPs. Therefore, patterns of fine-scale isolation-by-distance in the Florida Scrub-Jay can be well understood as a result of limited dispersal over contemporary timescales.

  8. A conformational change in the peripheral anionic site of Torpedo californica acetylcholinesterase induced by a bis-imidazolium oxime.

    Science.gov (United States)

    Legler, Patricia M; Soojhawon, Iswarduth; Millard, Charles B

    2015-09-01

    As part of ongoing efforts to design improved nerve agent antidotes, two X-ray crystal structures of Torpedo californica acetylcholinesterase (TcAChE) bound to the bis-pyridinium oxime, Ortho-7, or its experimental bis-imidazolium analogue, 2BIM-7, were determined. Bis-oximes contain two oxime groups connected by a hydrophobic linker. One oxime group of Ortho-7 binds at the entrance to the active-site gorge near Trp279, and the second binds at the bottom near Trp84 and Phe330. In the Ortho-7-TcAChE complex the oxime at the bottom of the gorge was directed towards the nucleophilic Ser200. In contrast, the oxime group of 2BIM-7 was rotated away from Ser200 and the oxime at the entrance induced a significant conformational change in the peripheral anionic site (PAS) residue Trp279. The conformational change alters the surface of the PAS and positions the imidazolium oxime of 2BIM-7 further from Ser200. The relatively weaker binding and poorer reactivation of VX-inhibited, tabun-inhibited or sarin-inhibited human acetylcholinesterase by 2BIM-7 compared with Ortho-7 may in part be owing to the unproductively bound states caught in crystallo. Overall, the reactivation efficiency of 2BIM-7 was comparable to that of 2-pyridine aldoxime methyl chloride (2-PAM), but unlike 2-PAM the bis-imidazolium oxime lacks a fixed charge, which may affect its membrane permeability.

  9. Kinetics of Torpedo californica acetylcholinesterase inhibition by bisnorcymserine and crystal structure of the complex with its leaving group.

    Science.gov (United States)

    Bartolucci, Cecilia; Stojan, Jure; Yu, Qian-sheng; Greig, Nigel H; Lamba, Doriano

    2012-06-01

    Natural and synthetic carbamates act as pseudo-irreversible inhibitors of AChE (acetylcholinesterase) as well as BChE (butyrylcholinesterase), two enzymes involved in neuronal function as well as in the development and progression of AD (Alzheimer's disease). The AChE mode of action is characterized by a rapid carbamoylation of the active-site Ser(200) with release of a leaving group followed by a slow regeneration of enzyme action due to subsequent decarbamoylation. The experimental AD therapeutic bisnorcymserine, a synthetic carbamate, shows an interesting activity and selectivity for BChE, and its clinical development is currently being pursued. We undertook detailed kinetic studies on the activity of the carbamate bisnorcymserine with Tc (Torpedo californica) AChE and, on the basis of the results, crystallized the complex between TcAChE and bisnorcymserine. The X-ray crystal structure showed only the leaving group, bisnoreseroline, trapped at the bottom of the aromatic enzyme gorge. Specifically, bisnoreseroline interacts in a non-covalent way with Ser(200) and His(440), disrupting the existing interactions within the catalytic triad, and it stacks with Trp(84) at the bottom of the gorge, giving rise to an unprecedented hydrogen-bonding contact. These interactions point to a dominant reversible inhibition mechanism attributable to the leaving group, bisnoreseroline, as revealed by kinetic analysis.

  10. Autographa californica multiple nucleopolyhedrovirus GP64 protein: Analysis of domain I and V amino acid interactions and membrane fusion activity

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Qianlong [State Key Laboratory of Crop Stress Biology for Arid Areas, Key Laboratory of Northwest Loess Plateau Crop Pest Management of Ministry of Agriculture, College of Plant Protection, Northwest A& F University, Yangling, Shaanxi 712100 (China); Blissard, Gary W. [Boyce Thompson Institute, Cornell University, Ithaca, NY 14853, United State (United States); Liu, Tong-Xian [State Key Laboratory of Crop Stress Biology for Arid Areas, Key Laboratory of Northwest Loess Plateau Crop Pest Management of Ministry of Agriculture, College of Plant Protection, Northwest A& F University, Yangling, Shaanxi 712100 (China); Li, Zhaofei, E-mail: zhaofeili73@outlook.com [State Key Laboratory of Crop Stress Biology for Arid Areas, Key Laboratory of Northwest Loess Plateau Crop Pest Management of Ministry of Agriculture, College of Plant Protection, Northwest A& F University, Yangling, Shaanxi 712100 (China)

    2016-01-15

    The Autographa californica multiple nucleopolyhedrovirus GP64 is a class III viral fusion protein. Although the post-fusion structure of GP64 has been solved, its pre-fusion structure and the detailed mechanism of conformational change are unknown. In GP64, domain V is predicted to interact with two domain I segments that flank fusion loop 2. To evaluate the significance of the amino acids involved in these interactions, we examined 24 amino acid positions that represent interacting and conserved residues within domains I and V. In several cases, substitution of a single amino acid involved in a predicted interaction disrupted membrane fusion activity, but no single amino acid pair appears to be absolutely required. We identified 4 critical residues in domain V (G438, W439, T452, and T456) that are important for membrane fusion, and two residues (G438 and W439) that appear to be important for formation or stability of the pre-fusion conformation of GP64. - Highlights: • The baculovirus envelope glycoprotein GP64 is a class III viral fusion protein. • The detailed mechanism of conformational change of GP64 is unknown. • We analyzed 24 positions that might stabilize the post-fusion structure of GP64. • We identified 4 residues in domain V that were critical for membrane fusion. • Two residues are critical for formation of the pre-fusion conformation of GP64.

  11. Cloning and Characterization of Sf9 Cell Lamin and the Lamin Conformational Changes during Autographa californica multiple nucleopolyhedrovirus Infection

    Directory of Open Access Journals (Sweden)

    Wenqiang Wei

    2016-05-01

    Full Text Available At present, the details of lamina alterations after baculovirus infection remain elusive. In this study, a lamin gene in the Sf9 cell line of Spodoptera frugiperda was cloned. The open reading frame (orf of the Sf9 lamin was 1860 bp and encoded a protein with a molecular weight of 70 kDa. A transfection assay with a red fluorescence protein (rfp-lamin fusion protein indicated that Sf9 lamin was localized in the nuclear rim. Transmission electron microscopy observations indicated that Autographa californica multiple nucleopolyhedrovirus (AcMNPV nucleocapsids may pass through the nuclear envelope. Immunofluorescence assay indicated that the lamina showed a ruffled staining pattern with the formation of invaginations in the Sf9 cells infected with AcMNPV, while it was evenly distributed at the nuclear periphery of mock-infected cells. Western blotting results indicated that the total amount of lamin in the baculovirus-infected Sf9 cells was significantly decreased compared with the mock-infected cells. These results imply that AcMNPV infection induces structural and biochemical rearrangements of lamina of Sf9 cells.

  12. Tightly Regulated Expression of Autographa californica Multicapsid Nucleopolyhedrovirus Immediate Early Genes Emerges from Their Interactions and Possible Collective Behaviors

    Science.gov (United States)

    Taka, Hitomi; Asano, Shin-ichiro; Matsuura, Yoshiharu; Bando, Hisanori

    2015-01-01

    To infect their hosts, DNA viruses must successfully initiate the expression of viral genes that control subsequent viral gene expression and manipulate the host environment. Viral genes that are immediately expressed upon infection play critical roles in the early infection process. In this study, we investigated the expression and regulation of five canonical regulatory immediate-early (IE) genes of Autographa californica multicapsid nucleopolyhedrovirus: ie0, ie1, ie2, me53, and pe38. A systematic transient gene-expression analysis revealed that these IE genes are generally transactivators, suggesting the existence of a highly interactive regulatory network. A genetic analysis using gene knockout viruses demonstrated that the expression of these IE genes was tolerant to the single deletions of activator IE genes in the early stage of infection. A network graph analysis on the regulatory relationships observed in the transient expression analysis suggested that the robustness of IE gene expression is due to the organization of the IE gene regulatory network and how each IE gene is activated. However, some regulatory relationships detected by the genetic analysis were contradictory to those observed in the transient expression analysis, especially for IE0-mediated regulation. Statistical modeling, combined with genetic analysis using knockout alleles for ie0 and ie1, showed that the repressor function of ie0 was due to the interaction between ie0 and ie1, not ie0 itself. Taken together, these systematic approaches provided insight into the topology and nature of the IE gene regulatory network. PMID:25816136

  13. Protection against Amoebic Liver Abscess in Hamster by Intramuscular Immunization with an Autographa californica Baculovirus Driving the Expression of the Gal-Lectin LC3 Fragment

    OpenAIRE

    Dulce María Meneses-Ruiz; Hugo Aguilar-Diaz; Raúl José Bobes; Alicia Sampieri; Luis Vaca; Juan Pedro Laclette; Julio César Carrero

    2015-01-01

    In a previous study, we demonstrated that oral immunization using Autographa californica baculovirus driving the expression of the Gal-lectin LC3 fragment (AcNPV-LC3) of Entamoeba histolytica conferred protection against ALA development in hamsters. In this study, we determined the ability of AcNPV-LC3 to protect against ALA by the intramuscular route as well as the liver immune response associated with protection. Results showed that 55% of hamsters IM immunized with AcNPV-LC3 showed sterile...

  14. Functional analysis of Torpedo californica nicotinic acetylcholine receptors in multiple activation states by SSM-based electrophysiology.

    Science.gov (United States)

    Niessen, K V; Muschik, S; Langguth, F; Rappenglück, S; Seeger, T; Thiermann, H; Worek, F

    2016-04-15

    Organophosphorus compounds (OPC), i.e. nerve agents or pesticides, are highly toxic due to their strong inhibition potency against acetylcholinesterase (AChE). Inhibited AChE results in accumulation of acetylcholine in the synaptic cleft and thus the desensitisation of the nicotinic acetylcholine receptor (nAChR) in the postsynaptic membrane is provoked. Direct targeting of nAChR to reduce receptor desensitisation might be an alternative therapeutic approach. For drug discovery, functional properties of potent therapeutic candidates need to be investigated in addition to affinity properties. Solid supported membrane (SSM)-based electrophysiology is useful for functional characterisation of ligand-gated ion channels like nAChRs, as charge translocations via capacitive coupling of the supporting membrane can be measured. By varying the agonist (carbamoylcholine) concentration, different functional states of the nAChR were initiated. Using plasma membrane preparations obtained from Torpedo californica electric organ, functional properties of selected nAChR ligands and non-oxime bispyridinium compounds were investigated. Depending on overall-size, the bispyridinium compounds enhanced or inhibited cholinergic signals induced by 100 μM carbamoylcholine. Applying excessive concentrations of the agonist carbamoylcholine provoked desensitisation of the nAChRs, whereas addition of bispyridinium compounds bearing short alkyl linkers exhibited functional recovery of previously desensitised nAChRs. The results suggest that these non-oxime bispyridinium compounds possibly interacted with nAChR subtypes in a manner of a positive allosteric modulator (PAM). The described newly developed functional assay is a valuable tool for the assessment of functional properties of potential compounds such as nAChR modulating ligands, which might be a promising approach in the therapeutically treatment of OPC-poisonings. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  15. Structural and functional characterization of the interaction of the photosensitizing probe methylene blue with Torpedo californica acetylcholinesterase.

    Science.gov (United States)

    Paz, Aviv; Roth, Esther; Ashani, Yacov; Xu, Yechun; Shnyrov, Valery L; Sussman, Joel L; Silman, Israel; Weiner, Lev

    2012-08-01

    The photosensitizer, methylene blue (MB), generates singlet oxygen that irreversibly inhibits Torpedo californica acetylcholinesterase (TcAChE). In the dark, it inhibits reversibly. Binding is accompanied by a bathochromic absorption shift, used to demonstrate displacement by other acetylcholinesterase inhibitors interacting with the catalytic "anionic" subsite (CAS), the peripheral "anionic" subsite (PAS), or bridging them. MB is a noncompetitive inhibitor of TcAChE, competing with reversible inhibitors directed at both "anionic" subsites, but a single site is involved in inhibition. MB also quenches TcAChE's intrinsic fluorescence. It binds to TcAChE covalently inhibited by a small organophosphate (OP), but not an OP containing a bulky pyrene. Differential scanning calorimetry shows an ~8° increase in the denaturation temperature of the MB/TcAChE complex relative to native TcAChE, and a less than twofold increase in cooperativity of the transition. The crystal structure reveals a single MB stacked against Trp279 in the PAS, oriented down the gorge toward the CAS; it is plausible that irreversible inhibition is associated with photooxidation of this residue and others within the active-site gorge. The kinetic and spectroscopic data showing that inhibitors binding at the CAS can impede binding of MB are reconciled by docking studies showing that the conformation adopted by Phe330, midway down the gorge, in the MB/TcAChE crystal structure, precludes simultaneous binding of a second MB at the CAS. Conversely, binding of ligands at the CAS dislodges MB from its preferred locus at the PAS. The data presented demonstrate that TcAChE is a valuable model for understanding the molecular basis of local photooxidative damage. Copyright © 2012 The Protein Society.

  16. Clinal adaptation and adaptive plasticity in Artemisia californica: implications for the response of a foundation species to predicted climate change.

    Science.gov (United States)

    Pratt, Jessica D; Mooney, Kailen A

    2013-08-01

    Local adaptation and plasticity pose significant obstacles to predicting plant responses to future climates. Although local adaptation and plasticity in plant functional traits have been documented for many species, less is known about population-level variation in plasticity and whether such variation is driven by adaptation to environmental variation. We examined clinal variation in traits and performance - and plastic responses to environmental change - for the shrub Artemisia californica along a 700 km gradient characterized (from south to north) by a fourfold increase in precipitation and a 61% decrease in interannual precipitation variation. Plants cloned from five populations along this gradient were grown for 3 years in treatments approximating the precipitation regimes of the north and south range margins. Most traits varying among populations did so clinally; northern populations (vs. southern) had higher water-use efficiencies and lower growth rates, C : N ratios and terpene concentrations. Notably, there was variation in plasticity for plant performance that was strongly correlated with source site interannual precipitation variability. The high-precipitation treatment (vs. low) increased growth and flower production more for plants from southern populations (181% and 279%, respectively) than northern populations (47% and 20%, respectively). Overall, precipitation variability at population source sites predicted 86% and 99% of variation in plasticity in growth and flowering, respectively. These striking, clinal patterns in plant traits and plasticity are indicative of adaptation to both the mean and variability of environmental conditions. Furthermore, our analysis of long-term coastal climate data in turn indicates an increase in interannual precipitation variation consistent with most global change models and, unexpectedly, this increased variation is especially pronounced at historically stable, northern sites. Our findings demonstrate the

  17. The pnk/pnl gene (ORF 86) of Autographa californica nucleopolyhedrovirus is a non-essential, immediate early gene.

    Science.gov (United States)

    Durantel, D; Croizier, L; Ayres, M D; Croizier, G; Possee, R D; López-Ferber, M

    1998-03-01

    Autographa californica nucleopolyhedrovirus (AcMNPV) ORF 86, located within the HindIII C fragment, potentially encodes a protein which shares sequence similarity with two T4 bacteriophage gene products, RNA ligase and polynucleotide kinase. This AcMNPV gene has been designated pnk/pnl but has yet to be assigned a function in virus replication. It has been classified as an immediate early virus gene, since the promoter was active in uninfected insect cells and mRNA transcripts were detectable from 4 to 48 h post-infection and in the presence of cycloheximide or aphidicolin in virus-infected cells. The extremities of the transcript have been mapped by primer extension and 3' RACE-PCR to positions -18 from the translational start codon and +15 downstream of the stop codon. The function of pnk/pnl was investigated by producing a recombinant virus (Acdel86lacZ) with the coding region replaced with that of lacZ. This virus replicated normally in Spodoptera frugiperda (Sf 21) cells, indicating that pnk/pnl is not essential for propagation in these cells. Virus protein production in Acdel86lacZ-infected Sf 21 cells also appeared to be unaffected, with normal synthesis of the IE-1, GP64, VP39 and polyhedrin proteins. Shut-down of host protein synthesis was not abolished in recombinant infection. When other baculovirus genomes were examined for the presence of pnk/pnl by restriction enzyme digestion and PCR, a deletion was found in AcMNPV 1.2, Galleria mellonella NPV (GmMNPV) and Bombyx mori NPV (BmNPV), suggesting that in many isolates this gene has either never been acquired or has been lost during genome evolution. This is one of the first baculovirus immediate early genes that appears to be nonessential for virus survival.

  18. The Autographa californica Multiple Nucleopolyhedrovirus ac83 Gene Contains a cis-Acting Element That Is Essential for Nucleocapsid Assembly.

    Science.gov (United States)

    Huang, Zhihong; Pan, Mengjia; Zhu, Silei; Zhang, Hao; Wu, Wenbi; Yuan, Meijin; Yang, Kai

    2017-03-01

    Baculoviridae is a family of insect-specific viruses that have a circular double-stranded DNA genome packaged within a rod-shaped capsid. The mechanism of baculovirus nucleocapsid assembly remains unclear. Previous studies have shown that deletion of the ac83 gene of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) blocks viral nucleocapsid assembly. Interestingly, the ac83-encoded protein Ac83 is not a component of the nucleocapsid, implying a particular role for ac83 in nucleocapsid assembly that may be independent of its protein product. To examine this possibility, Ac83 synthesis was disrupted by insertion of a chloramphenicol resistance gene into its coding sequence or by deleting its promoter and translation start codon. Both mutants produced progeny viruses normally, indicating that the Ac83 protein is not required for nucleocapsid assembly. Subsequently, complementation assays showed that the production of progeny viruses required the presence of ac83 in the AcMNPV genome instead of its presence in trans Therefore, we reasoned that ac83 is involved in nucleocapsid assembly via an internal cis-acting element, which we named the nucleocapsid assembly-essential element (NAE). The NAE was identified to lie within nucleotides 1651 to 1850 of ac83 and had 8 conserved A/T-rich regions. Sequences homologous to the NAE were found only in alphabaculoviruses and have a conserved positional relationship with another essential cis-acting element that was recently identified. The identification of the NAE may help to connect the data of viral cis-acting elements and related proteins in the baculovirus nucleocapsid assembly, which is important for elucidating DNA-protein interaction events during this process.IMPORTANCE Virus nucleocapsid assembly usually requires specific cis-acting elements in the viral genome for various processes, such as the selection of the viral genome from the cellular nucleic acids, the cleavage of concatemeric viral genome

  19. Suburban immigrants to wildlands disrupt honest signaling in ultra-violet plumage

    Directory of Open Access Journals (Sweden)

    Angela Tringali

    2015-06-01

    Full Text Available Urbanization changes habitat in a multitude of ways, including altering food availability. Access to human-provided food can change the relationship between body condition and honest advertisements of fitness, which may result in changes to behavior, demography, and metapopulation dynamics. We compared plumage color, its relationship with body condition and feather growth, and use as signal of dominance between a suburban and a wildland population of Florida Scrub-Jay (Aphelocoma coerulescens. Although plumage color was not related to body condition at either site, suburban birds had plumage with a greater proportion of total reflectance in the ultra-violet (UV and peak reflectance at shorter wavelengths. Despite the use of plumage reflectance as a signal of dominance among individuals in the wildlands, we found no evidence of status signaling at the suburban site. However, birds emigrating from the suburban site to the wildland site tended to be more successful at acquiring breeder status but less successful at reproducing than were immigrants from an adjacent wildland site, suggesting that signaled and realized quality differ. These differences in signaling content among populations could have demographic effects at metapopulation scales and may represent an evolutionary trap whereby suburban immigrants are preferred as mates even though their reproductive success relative to effort is lower.

  20. Protection against Amoebic Liver Abscess in Hamster by Intramuscular Immunization with an Autographa californica Baculovirus Driving the Expression of the Gal-Lectin LC3 Fragment

    Directory of Open Access Journals (Sweden)

    Dulce María Meneses-Ruiz

    2015-01-01

    Full Text Available In a previous study, we demonstrated that oral immunization using Autographa californica baculovirus driving the expression of the Gal-lectin LC3 fragment (AcNPV-LC3 of Entamoeba histolytica conferred protection against ALA development in hamsters. In this study, we determined the ability of AcNPV-LC3 to protect against ALA by the intramuscular route as well as the liver immune response associated with protection. Results showed that 55% of hamsters IM immunized with AcNPV-LC3 showed sterile protection against ALA, whereas other 20% showed reduction in the size and extent of abscesses, resulting in some protection in 75% of animals compared to the sham control group. Levels of protection showed a linear correlation with the development and intensity of specific antiamoeba cellular and humoral responses, evaluated in serum and spleen of hamsters, respectively. Evaluation of the Th1/Th2 cytokine patterns expressed in the liver of hamsters showed that sterile protection was associated with the production of high levels of IFNγ and IL-4. These results suggest that the baculovirus system is equally efficient by the intramuscular as well as the oral routes for ALA protection and that the Gal-lectin LC3 fragment is a highly protective antigen against hepatic amoebiasis through the local induction of IFNγ and IL-4.

  1. Protection against Amoebic Liver Abscess in Hamster by Intramuscular Immunization with an Autographa californica Baculovirus Driving the Expression of the Gal-Lectin LC3 Fragment.

    Science.gov (United States)

    Meneses-Ruiz, Dulce María; Aguilar-Diaz, Hugo; Bobes, Raúl José; Sampieri, Alicia; Vaca, Luis; Laclette, Juan Pedro; Carrero, Julio César

    2015-01-01

    In a previous study, we demonstrated that oral immunization using Autographa californica baculovirus driving the expression of the Gal-lectin LC3 fragment (AcNPV-LC3) of Entamoeba histolytica conferred protection against ALA development in hamsters. In this study, we determined the ability of AcNPV-LC3 to protect against ALA by the intramuscular route as well as the liver immune response associated with protection. Results showed that 55% of hamsters IM immunized with AcNPV-LC3 showed sterile protection against ALA, whereas other 20% showed reduction in the size and extent of abscesses, resulting in some protection in 75% of animals compared to the sham control group. Levels of protection showed a linear correlation with the development and intensity of specific antiamoeba cellular and humoral responses, evaluated in serum and spleen of hamsters, respectively. Evaluation of the Th1/Th2 cytokine patterns expressed in the liver of hamsters showed that sterile protection was associated with the production of high levels of IFNγ and IL-4. These results suggest that the baculovirus system is equally efficient by the intramuscular as well as the oral routes for ALA protection and that the Gal-lectin LC3 fragment is a highly protective antigen against hepatic amoebiasis through the local induction of IFNγ and IL-4.

  2. Interaction of bispyridinium compounds with the orthosteric binding site of human α7 and Torpedo californica nicotinic acetylcholine receptors (nAChRs).

    Science.gov (United States)

    Niessen, K V; Tattersall, J E H; Timperley, C M; Bird, M; Green, C; Seeger, T; Thiermann, H; Worek, F

    2011-09-25

    Standard treatment of poisoning by organophosphorus (OP) nerve agents with atropine and oximes lacks efficacy with different nerve agents. A direct pharmacologic intervention at the nicotinic acetylcholine receptor (nAChR) was proposed as an alternative therapeutic approach and promising in vitro and in vivo results were obtained with the bispyridinium compound SAD-128. In addition, a number of SAD-128 analogues improved neuromuscular transmission of soman-poisoned diaphragms in vitro. We investigated the interaction of six of these SAD-128 analogues with the orthosteric binding site of the human α7 nAChR and Torpedo californica nAChR with a high-throughput assay using radioactive ligands. The determined affinity constants indicate a weak interaction of three test compounds (K(i) in the micromolar range) with both receptors, but no interaction could be recorded with the other three test compounds. The six SAD-128 analogues showed a low intrinsic inhibitory potency with human acetylcholinesterase (IC₅₀ > 400 μM). In conclusion, the results of the present study do not indicate a correlation between the affinity to the orthosteric binding site and the functional improvement of neuromuscular transmission and it is assumed that other mechanisms contribute to the therapeutic effect of the tested compounds. Crown Copyright © 2011. Published by Elsevier Ireland Ltd. All rights reserved.

  3. Standardization of the experimental autoimmune myasthenia gravis (EAMG) model by immunization of rats with Torpedo californica acetylcholine receptors--Recommendations for methods and experimental designs.

    Science.gov (United States)

    Losen, Mario; Martinez-Martinez, Pilar; Molenaar, Peter C; Lazaridis, Konstantinos; Tzartos, Socrates; Brenner, Talma; Duan, Rui-Sheng; Luo, Jie; Lindstrom, Jon; Kusner, Linda

    2015-08-01

    Myasthenia gravis (MG) with antibodies against the acetylcholine receptor (AChR) is characterized by a chronic, fatigable weakness of voluntary muscles. The production of autoantibodies involves the dysregulation of T cells which provide the environment for the development of autoreactive B cells. The symptoms are caused by destruction of the postsynaptic membrane and degradation of the AChR by IgG autoantibodies, predominantly of the G1 and G3 subclasses. Active immunization of animals with AChR from mammalian muscles, AChR from Torpedo or Electrophorus electric organs, and recombinant or synthetic AChR fragments generates a chronic model of MG, termed experimental autoimmune myasthenia gravis (EAMG). This model covers cellular mechanisms involved in the immune response against the AChR, e.g. antigen presentation, T cell-help and regulation, B cell selection and differentiation into plasma cells. Our aim is to define standard operation procedures and recommendations for the rat EAMG model using purified AChR from the Torpedo californica electric organ, in order to facilitate more rapid translation of preclinical proof of concept or efficacy studies into clinical trials and, ultimately, clinical practice. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  4. Effects of CO2-induced pH reduction on the exoskeleton structure and biophotonic properties of the shrimp Lysmata californica.

    Science.gov (United States)

    Taylor, Jennifer R A; Gilleard, Jasmine M; Allen, Michael C; Deheyn, Dimitri D

    2015-06-01

    The anticipated effects of CO2-induced ocean acidification on marine calcifiers are generally negative, and include dissolution of calcified elements and reduced calcification rates. Such negative effects are not typical of crustaceans for which comparatively little ocean acidification research has been conducted. Crustaceans, however, depend on their calcified exoskeleton for many critical functions. Here, we conducted a short-term study on a common caridean shrimp, Lysmata californica, to determine the effect of CO2-driven reduction in seawater pH on exoskeleton growth, structure, and mineralization and animal cryptic coloration. Shrimp exposed to ambient (7.99 ± 0.04) and reduced pH (7.53 ± 0.06) for 21 days showed no differences in exoskeleton growth (percent increase in carapace length), but the calcium weight percent of their cuticle increased significantly in reduced pH conditions, resulting in a greater Ca:Mg ratio. Cuticle thickness did not change, indicating an increase in the mineral to matrix ratio, which may have mechanical consequences for exoskeleton function. Furthermore, there was a 5-fold decrease in animal transparency, but no change in overall shrimp coloration (red). These results suggest that even short-term exposure to CO2-induced pH reduction can significantly affect exoskeleton mineralization and shrimp biophotonics, with potential impacts on crypsis, physical defense, and predator avoidance.

  5. Three-dimensional visualization of the Autographa californica multiple nucleopolyhedrovirus occlusion-derived virion envelopment process gives new clues as to its mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Yang; Li, Kunpeng [State Key Laboratory of Biocontrol, School of Life Sciences, Sun Yat-sen University, Guangzhou (China); Tang, Peiping [State Key Laboratory of Biocontrol, School of Life Sciences, Sun Yat-sen University, Guangzhou (China); Hefei National Laboratory for Physical Sciences at the Microscale, and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui (China); Li, Yinyin; Zhou, Qiang; Yang, Kai [State Key Laboratory of Biocontrol, School of Life Sciences, Sun Yat-sen University, Guangzhou (China); Zhang, Qinfen, E-mail: lsszqf@mail.sysu.edu.cn [State Key Laboratory of Biocontrol, School of Life Sciences, Sun Yat-sen University, Guangzhou (China)

    2015-02-15

    Baculoviruses produce two virion phenotypes, occlusion-derived virion (ODV) and budded virion (BV). ODV envelopment occurs in the nucleus. Morphogenesis of the ODV has been studied extensively; however, the mechanisms underlying microvesicle formation and ODV envelopment in nuclei remain unclear. In this study, we used electron tomography (ET) together with the conventional electron microscopy to study the envelopment of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ODV. Our results demonstrate that not only the inner but also the outer nuclear membrane can invaginate and vesiculate into microvesicles and that intranuclear microvesicles are the direct source of the ODV membrane. Five main events in the ODV envelopment process are summarized, from which we propose a model to explain this process. - Highlights: • Both the inner and outer nuclear membranes could invaginate. • Both the inner and outer nuclear membranes could vesiculate into microvesicles. • Five main events in the ODV envelopment process are summarized. • A model is proposed to explain this ODV envelopment.

  6. Evidence for the involvement of carbonic anhydrase and urease in calcium carbonate formation in the gravity-sensing organ of Aplysia californica

    Science.gov (United States)

    Pedrozo, H. A.; Schwartz, Z.; Dean, D. D.; Harrison, J. L.; Campbell, J. W.; Wiederhold, M. L.; Boyan, B. D.

    1997-01-01

    To better understand the mechanisms that could modulate the formation of otoconia, calcium carbonate granules in the inner ear of vertebrate species, we examined statoconia formation in the gravity-sensing organ, the statocyst, of the gastropod mollusk Aplysia californica using an in vitro organ culture model. We determined the type of calcium carbonate present in the statoconia and investigated the role of carbonic anhydrase (CA) and urease in regulating statocyst pH as well as the role of protein synthesis and urease in statoconia production and homeostasis in vitro. The type of mineral present in statoconia was found to be aragonitic calcium carbonate. When the CA inhibitor, acetazolamide (AZ), was added to cultures of statocysts, the pH initially (30 min) increased and then decreased. The urease inhibitor, acetohydroxamic acid (AHA), decreased statocyst pH. Simultaneous addition of AZ and AHA caused a decrease in pH. Inhibition of urease activity also reduced total statoconia number, but had no effect on statoconia volume. Inhibition of protein synthesis reduced statoconia production and increased statoconia volume. In a previous study, inhibition of CA was shown to decrease statoconia production. Taken together, these data show that urease and CA play a role in regulating statocyst pH and the formation and maintenance of statoconia. CA produces carbonate ion for calcium carbonate formation and urease neutralizes the acid formed due to CA action, by production of ammonia.

  7. Fourier transform coupled tryptophan scanning mutagenesis identifies a bending point on the lipid-exposed δM3 transmembrane domain of the Torpedo californica nicotinic acetylcholine receptor

    Science.gov (United States)

    Caballero-Rivera, Daniel; Cruz-Nieves, Omar A; Oyola-Cintrón, Jessica; Torres-Núñez, David A; Otero-Cruz, José D

    2011-01-01

    The nicotinic acetylcholine receptor (nAChR) is a member of a family of ligand-gated ion channels that mediate diverse physiological functions, including fast synaptic transmission along the peripheral and central nervous systems. Several studies have made significant advances toward determining the structure and dynamics of the lipid-exposed domains of the nAChR. However, a high-resolution atomic structure of the nAChR still remains elusive. In this study, we extended the Fourier transform coupled tryptophan scanning mutagenesis (FT-TrpScanM) approach to gain insight into the secondary structure of the δM3 transmembrane domain of the Torpedo californica nAChR, to monitor conformational changes experienced by this domain during channel gating, and to identify which lipid-exposed positions are linked to the regulation of ion channel kinetics. The perturbations produced by periodic tryptophan substitutions along the δM3 transmembrane domain were characterized by two-electrode voltage clamp and 125I-labeled α-bungarotoxin binding assays. The periodicity profiles and Fourier transform spectra of this domain revealed similar helical structures for the closed- and open-channel states. However, changes in the oscillation patterns observed between positions Val-299 and Val-304 during transition between the closed- and open-channel states can be explained by the structural effects caused by the presence of a bending point introduced by a Thr-Gly motif at positions 300–301. The changes in periodicity and localization of residues between the closed-and open-channel states could indicate a structural transition between helix types in this segment of the domain. Overall, the data further demonstrate a functional link between the lipid-exposed transmembrane domain and the nAChR gating machinery. PMID:21785268

  8. Tryptophan scanning mutagenesis reveals distortions in the helical structure of the δM4 transmembrane domain of the Torpedo californica nicotinic acetylcholine receptor.

    Science.gov (United States)

    Caballero-Rivera, Daniel; Cruz-Nieves, Omar A; Oyola-Cintrón, Jessica; Torres-Nunez, David A; Otero-Cruz, Jose D; Lasalde-Dominicci, José A

    2012-01-01

    The lipid-protein interface is an important domain of the nicotinic acetylcholine receptor (nAChR) that has recently garnered increased relevance. Several studies have made significant advances toward determining the structure and dynamics of the lipid-exposed domains of the nAChR. However, there is still a need to gain insight into the mechanism by which lipid-protein interactions regulate the function and conformational transitions of the nAChR. In this study, we extended the tryptophan scanning mutagenesis (TrpScanM) approach to dissect secondary structure and monitor the conformational changes experienced by the δM4 transmembrane domain (TMD) of the Torpedo californica nAChR, and to identify which positions on this domain are potentially linked to the regulation of ion channel kinetics. The difference in oscillation patterns between the closed- and open-channel states suggests a substantial conformational change along this domain as a consequence of channel activation. Furthermore, TrpScanM revealed distortions along the helical structure of this TMD that are not present on current models of the nAChR. Our results show that a Thr-Pro motif at positions 462-463 markedly bends the helical structure of the TMD, consistent with the recent crystallographic structure of the GluCl Cys-loop receptor which reveals a highly bent TMD4 in each subunit. This Thr-Pro motif acts as a molecular hinge that delineates two gating blocks in the δM4 TMD. These results suggest a model in which a hinge-bending motion that tilts the helical structure is combined with a spring-like motion during transition between the closed- and open-channel states of the δM4 TMD.

  9. Fourier transform coupled tryptophan scanning mutagenesis identifies a bending point on the lipid-exposed δM3 transmembrane domain of the Torpedo californica nicotinic acetylcholine receptor.

    Science.gov (United States)

    Caballero-Rivera, Daniel; Cruz-Nieves, Omar A; Oyola-Cintrón, Jessica; Torres-Núñez, David A; Otero-Cruz, Jose D; Lasalde-Dominicci, José A

    2011-01-01

    The nicotinic acetylcholine receptor (nAChR) is a member of a family of ligand-gated ion channels that mediate diverse physiological functions, including fast synaptic transmission along the peripheral and central nervous systems. Several studies have made significant advances toward determining the structure and dynamics of the lipid-exposed domains of the nAChR. However, a high-resolution atomic structure of the nAChR still remains elusive. In this study, we extended the Fourier transform coupled tryptophan scanning mutagenesis (FT-TrpScanM) approach to gain insight into the secondary structure of the δM3 transmembrane domain of the Torpedo californica nAChR, to monitor conformational changes experienced by this domain during channel gating, and to identify which lipid-exposed positions are linked to the regulation of ion channel kinetics. The perturbations produced by periodic tryptophan substitutions along the δM3 transmembrane domain were characterized by two-electrode voltage clamp and (125)I-labeled α-bungarotoxin binding assays. The periodicity profiles and Fourier transform spectra of this domain revealed similar helical structures for the closed- and open-channel states. However, changes in the oscillation patterns observed between positions Val-299 and Val-304 during transition between the closed- and open-channel states can be explained by the structural effects caused by the presence of a bending point introduced by a Thr-Gly motif at positions 300-301. The changes in periodicity and localization of residues between the closed-and open-channel states could indicate a structural transition between helix types in this segment of the domain. Overall, the data further demonstrate a functional link between the lipid-exposed transmembrane domain and the nAChR gating machinery.

  10. Tryptophan Substitutions at Lipid-exposed Positions of the Gamma M3 Transmembrane Domain Increase the Macroscopic Ionic Current Response of the Torpedo californica Nicotinic Acetylcholine Receptor

    Science.gov (United States)

    Cruz-Martín, A.; Mercado, J.L.; Rojas, L.V.; McNamee, M.G.; Lasalde-Dominicci, J.A.

    2015-01-01

    Our previous amino-acid substitutions at the postulated lipid-exposed transmembrane segment M4 of the Torpedo californica acetylcholine receptor (AChR) focused on the alpha subunit. In this study we have extended the mutagenesis analysis using single tryptophan replacements in seven positions (I288, M291, F292, S294, L296, M299 and N300) near the center of the third transmembrane domain of the gamma subunit (γM3). All the tryptophan substitution mutants were expressed in Xenopus laevis oocytes following mRNA injections at levels close to wild type. The functional response of these mutants was evaluated using macroscopic current analysis in voltage-clamped oocytes. For all the substitutions the concentration for half-maximal activation, EC50, is similar to wild type using acetylcholine. For F292W, L296W and M299W the normalized macroscopic responses are 2- to 3-fold higher than for wild type. Previous photolabeling studies demonstrated that these three positions were in contact with membrane lipids. Each of these M3 mutations was co-injected with the previously characterized αC418W mutant to examine possible synergistic effects of single lipid-exposed mutations on two different subunits. For the γM3/αM4 double mutants, the EC50s were similar to those measured for the αC418W mutant alone. Tryptophan substitutions at positions that presumably face the interior of the protein (S294 and M291) or neighboring helices (I288) did not cause significant inhibition of channel function or surface expression of AChRs. PMID:11547353

  11. Autographa californica multiple nucleopolyhedrovirus ac75 is required for egress of nucleocapsids from the nucleus and formation of de novo intranuclear membrane microvesicles.

    Directory of Open Access Journals (Sweden)

    Ya-Jun Guo

    Full Text Available In this study, Autographa californica multiple nucleopolyhedrovirus ac75 was functionally characterized. Ac75 has homologs in all sequenced genomes of alphabaculoviruses, betabaculoviruses, and gammabaculoviruses. It was determined to encode a protein that is associated with the nucleocapsid of budded virus and with both envelope and nucleocapsids of occlusion-derived virus. Sf9 cells transfected by an ac75-knockout bacmid resulted in the infection being restricted to single cells. No budded virus were detected although viral DNA replication and late gene expression were unaffected. Electron microscopy revealed that the virogenic stroma, nucleocapsids and occlusion bodies appeared normal in the cells transfected by an ac75-knockout bacmid. However, the nucleocapsids were unenveloped, the occlusion bodies did not contain any virions or nucleocapsids, and no nucleocapsids were found outside the nucleus or spanning the nuclear membrane. In addition, de novo intranuclear membrane microvesicles that are the precursor of occlusion-derived virus envelopes were absent in the nuclei of transfected cells. Confocal microscopy showed that AC75 protein appeared in the cytoplasm as early as 6 hours post infection. It localized to the ring zone at the periphery of the nucleus from 15 to 24 hours post infection and demonstrated light blocky cloud-like distribution in the center of the nucleus. AC75 was found to co-immunoprecipitate with BV and ODV associated envelope protein ODV-E25. The data from this study suggest that ac75 is essential for induction of the intranuclear membrane microvesicles, it appears to be required for the intranuclear envelopment of nucleocapsids, and is also essential for egress of nucleocapsids from the nuclei, in infected cells.

  12. Crystal structure of thioflavin T bound to the peripheral site of Torpedo californica acetylcholinesterase reveals how thioflavin T acts as a sensitive fluorescent reporter of ligand binding to the acylation site.

    Science.gov (United States)

    Harel, Michal; Sonoda, Leilani K; Silman, Israel; Sussman, Joel L; Rosenberry, Terrone L

    2008-06-25

    Acetylcholinesterase plays a key role in cholinergic synaptic transmission by hydrolyzing the neurotransmitter acetylcholine with one of the highest known catalytic rate constants. Hydrolysis occurs in a narrow and deep gorge that contains two sites of ligand binding: A peripheral site, or P-site, near the gorge entrance that contributes to catalytic efficiency both by transiently trapping substrate molecules as they enter the gorge and by allosterically accelerating the transfer of the substrate acyl group to a serine hydroxyl in an acylation site or A-site at the base of the gorge. Thioflavin T is a useful reporter of ligand interactions with the A-site. It binds specifically to the P-site with fluorescence that is enhanced approximately 1000-fold over that of unbound thioflavin T, and the enhanced fluorescence is quenched 1.5- to 4-fold when another ligand binds to the A-site in a ternary complex. To clarify the structural basis of this advantageous signal change, we here report the X-ray structure of the complex of thioflavin T with Torpedo californica acetylcholinesterase. The two aromatic rings in thioflavin T are coplanar and are packed snugly parallel to the aromatic side chains of Trp279, Tyr334, and Phe330. Overlays of this structure with the crystal structures of Torpedo californica acetylcholinesterase complexes with either edrophonium or m-( N, N, N-trimethylammonio)-2,2,2-trifluoroacetophenone, two small aromatic ligands that bind specifically to the A-site, indicate that the phenyl side chain of Phe330 must rotate to sterically accommodate both thioflavin T and the A-site ligand in the ternary complex. This rotation may allow some relaxation of the strict coplanarity of the aromatic rings in the bound thioflavin T and result in partial quenching of its fluorescence.

  13. Targeted oxidation of Torpedo californica acetylcholinesterase by singlet oxygen: identification of N-formylkynurenine tryptophan derivatives within the active-site gorge of its complex with the photosensitizer methylene blue.

    Science.gov (United States)

    Triquigneaux, Mathilde M; Ehrenshaft, Marilyn; Roth, Esther; Silman, Israel; Ashani, Yakov; Mason, Ronald P; Weiner, Lev; Deterding, Leesa J

    2012-11-15

    The principal role of AChE (acetylcholinesterase) is termination of impulse transmission at cholinergic synapses by rapid hydrolysis of the neurotransmitter acetylcholine. The active site of AChE is near the bottom of a long and narrow gorge lined with aromatic residues. It contains a CAS (catalytic 'anionic' subsite) and a second PAS (peripheral 'anionic' site), the gorge mouth, both of which bind acetylcholine via π-cation interactions, primarily with two conserved tryptophan residues. It was shown previously that generation of (1)O(2) by illumination of MB (Methylene Blue) causes irreversible inactivation of TcAChE (Torpedo californica AChE), and suggested that photo-oxidation of tryptophan residues might be responsible. In the present study, structural modification of the TcAChE tryptophan residues induced by MB-sensitized oxidation was investigated using anti-N-formylkynurenine antibodies and MS. From these analyses, we determined that N-formylkynurenine derivatives were specifically produced from Trp(84) and Trp(279), present at the CAS and PAS respectively. Peptides containing these two oxidized tryptophan residues were not detected when the competitive inhibitors, edrophonium and propidium (which should displace MB from the gorge) were present during illumination, in agreement with their efficient protection against the MB-induced photo-inactivation. Thus the bound MB elicited selective action of (1)O(2) on the tryptophan residues facing on to the water-filled active-site gorge. The findings of the present study thus demonstrate the localized action and high specificity of MB-sensitized photo-oxidation of TcAChE, as well as the value of this enzyme as a model system for studying the mechanism of action and specificity of photosensitizing agents.

  14. Mechanisms of Action of Escapin, a Bactericidal Agent in the Ink Secretion of the Sea Hare Aplysia californica: Rapid and Long-Lasting DNA Condensation and Involvement of the OxyR-Regulated Oxidative Stress Pathway

    Science.gov (United States)

    Ko, Ko-Chun; Tai, Phang C.

    2012-01-01

    The marine snail Aplysia californica produces escapin, an l-amino acid oxidase, in its defensive ink. Escapin uses l-lysine to produce diverse products called escapin intermediate products of l-lysine (EIP-K), including α-amino-ε-caproic acid, Δ1-piperidine-2-carboxylic acid, and Δ2-piperidine-2-carboxylic acid. EIP-K and H2O2 together, but neither alone, is a powerful bactericide. Here, we report bactericidal mechanisms of escapin products on Escherichia coli. We show that EIP-K and H2O2 together cause rapid and long-lasting DNA condensation: 2-min treatment causes significant DNA condensation and killing, and 10-min treatment causes maximal effect, lasting at least 70 h. We isolated two mutants resistant to EIP-K plus H2O2, both having a single missense mutation in the oxidation regulatory gene, oxyR. A complementation assay showed that the mutated gene, oxyR(A233V), renders resistance to EIP-K plus H2O2, and a gene dosage effect leads to reduction of resistance for strains carrying wild-type oxyR. Temperature stress with EIP-K does not produce the bactericidal effect, suggesting the effect is due to a specific response to oxidative stress. The null mutant for any single DNA-binding protein—Dps, H-NS, Hup, Him, or MukB—was not resistant to EIP-K plus H2O2, suggesting that no single DNA-binding protein is necessary to mediate this bactericidal effect, but allowing for the possibility that EIP-K plus H2O2 could function through a combination of DNA-binding proteins. The bactericidal effect of EIP-K plus H2O2 was eliminated by the ferrous ion chelator 1,10-phenanthroline, and it was reduced by the hydroxyl radical scavenger thiourea, suggesting hydroxyl radicals mediate the effects of EIP-K plus H2O2. PMID:22232273

  15. Health assessment of pine forest as affected by geothermal activities: Presence of Monterey pine aphid, Essigella californica (Essig (Homoptera: Aphidae associated with higher concentrations of boron on pine needles

    Directory of Open Access Journals (Sweden)

    Adolfo Arturo Del Rio Mora

    2014-06-01

    Full Text Available Studies on assessments of the air pollution and deposition caused by geothermal fields on the forest health and presence of pests have been few documented to date. In the geothermal field "Los Humeros", located between the borders of the states of Puebla and Veracruz, Mexico was realized a forest health monitoring to know the assessment could have these emissions of sulphur (S and other two chemical elements measured by their concentrations on leaf tissues in the surrounding forests. For it were evaluated the forest healthy and pest insects registered at 20 stands of which were chosen completely at random 40 trees in total/site of the species Pinus montezumae and P. teocotein natural stands and plantations and picked up leaf tissue samples representatives per stand to determine the contents of sulphur (S, boron (B and arsenic (As representing each forest stand. The results of the study revealed that the presence of forest pests are not related to the proximity of the sites to emissions from stationary sources of emissions and moreover the amount of these 3 chemical substances monitored do not have none influence on the forest healthy sites condition, except for the Monterey pine aphid Essigella californica Essig, which seems to be directly associated with higher Boron content in the needles (mean=167.47±32.15, and peak 635.46 ppm and proximity of emission sources geothermal vents or where it is believed all these chemical elements are carried down by air currents to specific points and deposited in the stands. The general model obtained and with significance of R2=56.6 and P value 0.0033 for the presence of Monterey Pine aphid and the three main pollutants released from smoke plumes in geothermal systems is [D: Essigella]= -0.2088 + 1.880E-0.5 (A:SO4+ 0.002245 (B:B + 1.248 (C:As. The results suggest the use of aphid species as bioindicators of polluted sites.

  16. Hierarchical distance-sampling models to estimate population size and habitat-specific abundance of an island endemic.

    Science.gov (United States)

    Sillett, T Scott; Chandler, Richard B; Royle, J Andrew; Kery, Marc; Morrison, Scott A

    2012-10-01

    Population size and habitat-specific abundance estimates are essential for conservation management. A major impediment to obtaining such estimates is that few statistical models are able to simultaneously account for both spatial variation in abundance and heterogeneity in detection probability, and still be amenable to large-scale applications. The hierarchical distance-sampling model of J. A. Royle, D. K. Dawson, and S. Bates provides a practical solution. Here, we extend this model to estimate habitat-specific abundance and rangewide population size of a bird species of management concern, the Island Scrub-Jay (Aphelocoma insularis), which occurs solely on Santa Cruz Island, California, USA. We surveyed 307 randomly selected, 300 m diameter, point locations throughout the 250-km2 island during October 2008 and April 2009. Population size was estimated to be 2267 (95% CI 1613-3007) and 1705 (1212-2369) during the fall and spring respectively, considerably lower than a previously published but statistically problematic estimate of 12 500. This large discrepancy emphasizes the importance of proper survey design and analysis for obtaining reliable information for management decisions. Jays were most abundant in low-elevation chaparral habitat; the detection function depended primarily on the percent cover of chaparral and forest within count circles. Vegetation change on the island has been dramatic in recent decades, due to release from herbivory following the eradication of feral sheep (Ovis aries) from the majority of the island in the mid-1980s. We applied best-fit fall and spring models of habitat-specific jay abundance to a vegetation map from 1985, and estimated the population size of A. insularis was 1400-1500 at that time. The 20-30% increase in the jay population suggests that the species has benefited from the recovery of native vegetation since sheep removal. Nevertheless, this jay's tiny range and small population size make it vulnerable to natural

  17. Final Environmental Assessment for the Skid Strip Area Development Plan at Cape Canaveral Air Force Station Florida

    Science.gov (United States)

    2009-07-01

    Florida scrub-jay. Wildlife Society Bulletin 27(3 ):81 0-822. Carr, A.E., Jr. I 940. A contribution to the herpetology of Florida. University of...in Georgia. Journal of Herpetology 17(3):256-264. Dreschel, T.W., R.B. Smith, and D.R. Breininger. 1990. Florida scrub jay mortality on roadsides... Herpetological Review 8(3):76-79. Layne, J.N. and T.M. Steiner. 1996. Eastern indigo snake (Drymarchon corais couperi): summary of research conducted on

  18. 76 FR 37142 - Endangered and Threatened Wildlife and Plants; Incidental Take Permit Application; Proposed Low...

    Science.gov (United States)

    2011-06-24

    ... minimization measures proposed to address the effects of the project on the scrub-jay. DATES: Written comments... project qualifies as a low-effect plan on the following three criteria: (1) Implementation of the project... Application; Proposed Low-Effect Habitat Conservation Plan and Associated Documents; Charlotte County, FL...

  19. American River Watershed Investigation, California. Volume 7. Appendix S. Part 2

    Science.gov (United States)

    1991-12-01

    productivity and diversity of tree, shrub and forbs provides abundant fruits, seeds , nectar, and forage for wildlife species. Natomas Cross Canal--Sacramento...abundant fruits, seeds , and nectar resources for species such as hummingbirds, scrub jay, black-headed grosbeak, rufous-sided towhee, Virginia opossum...1980. Population studies in the genus Orcuttia ( Poaceae ). Davis, CA: University of California, Davis; 1980. 98 p. Dissertation. Griggs, F. Thomas

  20. Environmental Assessment for the Beddown and Flight Operations of Unmanned Aircraft Systems at Cape Canaveral Air Force Station, Florida

    Science.gov (United States)

    2011-07-01

    jay. Wildlife Society Bulletin 27(3):810-822. Carr, A.E., Jr. 1940. A contribution to the herpetology of Florida. University of Florida...Journal of Herpetology 17(3):256-264. Dreschel, T.W., R.B. Smith, and D.R. Breininger. 1990. Florida scrub jay mortality on roadsides. Florida Field...Lawler, H.A. 1977. The status of Drymarchon corais couperi (Holbrook), the eastern indigo snake, in the southeastern United States. Herpetological Review

  1. Supplemental Environmental Assessment: Lighthouse Substation Cape Canaveral Air Force Station Florida

    Science.gov (United States)

    2007-10-01

    Cuban tree frogs (Osteopilus septentrionalis), brown anoles (Anolis sagrei), and other exotic animal species. These exotic species may compete with...moth) larvae, form most of the animal diet throughout most of the year (Woolfenden and Fitzpatrick 1984). Acorns are the most important plant food...Recreational, Scientific, or Educational Purposes: Reported shooting of scrub-jays and collection of the species as pets were considered threats. Disease

  2. Proteotoxic stress induced by Autographa californica nucleopolyhedrovirus infection of Spodoptera frugiperda Sf9 cells

    Energy Technology Data Exchange (ETDEWEB)

    Lyupina, Yulia V.; Abaturova, Svetlana B.; Erokhov, Pavel A. [N.K. Koltzov Institute of Developmental Biology, Russian Academy of Sciences, 26 Vavilova Str., Moscow 119334 (Russian Federation); Orlova, Olga V.; Beljelarskaya, Svetlana N. [V.A. Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, 32 Vavilova Str., Moscow 119334 (Russian Federation); Mikhailov, Victor S., E-mail: mikhailov48@mail.ru [N.K. Koltzov Institute of Developmental Biology, Russian Academy of Sciences, 26 Vavilova Str., Moscow 119334 (Russian Federation)

    2013-02-05

    Baculovirus AcMNPV causes proteotoxicity in Sf9 cells as revealed by accumulation of ubiquitinated proteins and aggresomes in the course of infection. Inhibition of proteasomes by lactacystin increased markedly the stock of ubiquitinated proteins indicating a primary role of proteasomes in detoxication. The proteasomes were present in Sf9 cells as 26S and 20S complexes whose protease activity did not change during infection. Proteasome inhibition caused a delay in the initiation of viral DNA replication suggesting an important role of proteasomes at early stages in infection. However, lactacystin did not affect ongoing replication indicating that active proteasomes are not required for genome amplification. At late stages in infection (24-48 hpi), aggresomes containing the ubiquitinated proteins and HSP/HSC70s showed gradual fusion with the vacuole-like structures identified as lysosomes by antibody to cathepsin D. This result suggests that lysosomes may assist in protection against proteotoxicity caused by baculoviruses absorbing the ubiquitinated proteins.

  3. The Use of California Sagebrush (Artemisia californica Liniment to Control Pain

    Directory of Open Access Journals (Sweden)

    James D. Adams

    2012-09-01

    Full Text Available The incidence of arthritis is increasing every year, as does the need for pain medication. The current work reviews an American Indian liniment that is traditionally used for pain therapy. The chemistry, therapeutic use and safety of the liniment are reviewed. The liniment contains monoterpenoids, sesquiterpenes, flavonoids, alkaloids and other compounds.

  4. Functional magnetic resonance microscopy at single-cell resolution in Aplysia californica

    Science.gov (United States)

    Radecki, Guillaume; Nargeot, Romuald; Jelescu, Ileana Ozana; Le Bihan, Denis; Ciobanu, Luisa

    2014-01-01

    In this work, we show the feasibility of performing functional MRI studies with single-cell resolution. At ultrahigh magnetic field, manganese-enhanced magnetic resonance microscopy allows the identification of most motor neurons in the buccal network of Aplysia at low, nontoxic Mn2+ concentrations. We establish that Mn2+ accumulates intracellularly on injection into the living Aplysia and that its concentration increases when the animals are presented with a sensory stimulus. We also show that we can distinguish between neuronal activities elicited by different types of stimuli. This method opens up a new avenue into probing the functional organization and plasticity of neuronal networks involved in goal-directed behaviors with single-cell resolution. PMID:24872449

  5. Autographa californica multiple nucleopolyhedrovirus PK-1 is essential for nucleocapsid assembly

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Changyong, E-mail: cyliang@yzu.edu.cn [College of Bioscience and Biotechnology, Yangzhou University, Yangzhou 225009 (China); Li, Min; Dai, Xuejuan; Zhao, Shuling; Hou, Yanling; Zhang, Yongli; Lan, Dandan [College of Bioscience and Biotechnology, Yangzhou University, Yangzhou 225009 (China); Wang, Yun; Chen, Xinwen [State Key Laboratory of Virology, Wuhan Institute of Virology, Chinese Academy of Sciences, Wuhan 430071 (China)

    2013-09-01

    PK-1 (Ac10) is a baculovirus-encoded serine/threonine kinase and its function is unclear. Our results showed that a pk-1 knockout AcMNPV failed to produce infectious progeny, while the pk-1 repair virus could rescue this defect. qPCR analysis demonstrated that pk-1 deletion did not affect viral DNA replication. Analysis of the repaired recombinants with truncated pk-1 mutants demonstrated that the catalytic domain of protein kinases of PK-1 was essential to viral infectivity. Moreover, those PK-1 mutants that could rescue the infectious BV production defect exhibited kinase activity in vitro. Therefore, it is suggested that the kinase activity of PK-1 is essential in regulating viral propagation. Electron microscopy revealed that pk-1 deletion affected the formation of normal nucleocapsids. Masses of electron-lucent tubular structures were present in cell transfected with pk-1 knockout bacmid. Therefore, PK-1 appears to phosphorylate some viral or cellular proteins that are essential for DNA packaging to regulate nucleocapsid assembly. - Highlights: • A pk-1 knockout AcMNPV failed to produce infectious progeny. • The pk-1 deletion did not affect viral DNA replication. • The catalytic domain of protein kinases (PKc) of PK-1 was essential to viral infectivity. • The kinase activity of PK-1 is essential in regulating viral propagation. • PK-1 appears to phosphorylate some viral proteins that are essential for DNA packaging to regulate nucleocapsid assembly.

  6. Biocompatibility of adhesive complex coacervates modeled after the Sandcastle glue of P. californica for craniofacial reconstruction

    Science.gov (United States)

    Winslow, Brent D.; Shao, Hui; Stewart, Russell J.; Tresco, Patrick A.

    2011-01-01

    Craniofacial reconstruction would benefit from a degradable adhesive capable of holding bone fragments in three-dimensional alignment and gradually being replaced by new bone without loss of alignment or volume changes. Modeled after a natural adhesive secreted by the sandcastle worm, we studied the biocompatibility of adhesive complex coacervates in vitro and in vivo with two different rat calvarial models. We found that the adhesive was non-cytotoxic and supported the attachment, spreading, and migration of a commonly used osteoblastic cell line over the course of several days. In animal studies we found that the adhesive was capable of maintaining three-dimensional bone alignment in freely moving rats over a 12 week indwelling period. Histological evidence indicated that the adhesive was gradually resorbed and replaced by new bone that became lamellar across the defect without loss of alignment, changes in volume, or changes in the adjacent uninjured bone. The presence of inflammatory cells was consistent with what has been reported with other craniofacial fixation methods including metal plates, screws, tacks, calcium phosphate cements and cyanoacrylate adhesives. Collectively, the results suggest that the new bioadhesive formulation is degradable, osteoconductive and appears suitable for use in the reconstruction of craniofacial fractures. PMID:20950851

  7. Animals Represent the past and the Future

    Directory of Open Access Journals (Sweden)

    Thomas R. Zentall

    2013-07-01

    Full Text Available It has been proposed by some that only humans have the ability to mentally travel back in time (i.e., have episodic memory and forward in time (i.e., have the ability to simulate the future. However, there is evidence from a variety of nonhuman animals (e.g., primates, dolphins, scrub jays, rats, and pigeons that they have some ability to recover personal memories of what-where-when an event occurred (an earlier requirement of the ability to recover an episodic memory and answer unexpected questions (another requirement to distinguish between semantic and episodic memory. Also, perhaps more critically, according to Tulving's more recent definition of mental time-travel, several animals (primates and scrub jays have been shown to be able to pass the spoon test. That is, they are able to plan for the future. Thus, although humans show an advanced ability to mentally travel backward and forward in time, there is growing evidence that nonhuman animals have some of this capacity as well.

  8. Taxonomy Icon Data: Pacific electric ray [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Pacific electric ray Torpedo californica Chordata/Vertebrata/Pisciformes Torpedo_californica_L.png Torpedo..._californica_NL.png Torpedo_californica_S.png Torpedo_californica_NS.png http://biosc...iencedbc.jp/taxonomy_icon/icon.cgi?i=Torpedo+californica&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Torpedo...+californica&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Torpedo...+californica&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Torpedo+californica&t=NS ...

  9. Biophysical and ion channel functional characterization of the Torpedo californica nicotinic acetylcholine receptor in varying detergent-lipid environments.

    Science.gov (United States)

    Asmar-Rovira, Guillermo A; Asseo-García, Aloysha M; Quesada, Orestes; Hanson, Michael A; Cheng, Anchi; Nogueras, Carlos; Lasalde-Dominicci, José A; Stevens, Raymond C

    2008-05-01

    The nicotinic acetylcholine receptor (nAChR) of Torpedo electric rays has been extensively characterized over the last three decades. However, high-resolution structural studies have been hampered by the lack of mechanistic molecular models that describe how detergents influence membrane protein stability and function. Furthermore, elucidation of the dynamic detergent-lipid-protein interactions of solubilized membrane proteins is a largely unexplored research field. This study examines the effects of nine detergents on: (1) nAChR-lipid composition (gas chromatography with flame ionization; GC-FID and/or mass selective detectors; GC-MSD), (2) stability and aggregation state (analytical size exclusion chromatography; A-SEC and electron microscopy; EM) and (3) ion channel function (planar lipid bilayers). Detergent solubilization of nAChR-enriched membranes did not result in significant native lipid depletion or destabilization. Upon purification, native lipid depletion occurred in all detergents, with lipid-analogue detergents CHAPS {(3-[(3-cholamidopropyl)-dimethylammonio]-1-propane sulfonate}, FC-12 (n-dodecylphosphocholine) and sodium cholate (3alpha,7alpha,12alpha-trihydroxy-5beta-cholan-24-oic acid) maintaining stability and supporting ion channel function, and non-lipid-analogue detergents Cymal-6 (6-cyclohexyl-1-hexyl-beta-D-maltoside), DDM (n-dodecyl-beta-D-maltopyranoside), LDAO (lauryldimethylamine-N-oxide) and OG (n-octyl-beta-d-glucopyranoside) decreasing stability and significantly reducing or completely suppressing ion channel function. Anapoe-C(12)E(9 )(polyoxyethylene-[9]-dodecyl ether) and BigCHAP (N,N'-bis-[3-d-gluconamidopropyl] cholamide) retained residual amounts of native lipid, maintaining moderate stability and ion channel function compared to lipid-analogue detergents. Therefore, the nAChR can be stable and functional in lipid-analogue detergents or in detergents that retain moderate amounts of residual native lipids, but not in non-lipid-analogue detergents.

  10. Monthly trematode infections of the snail Cerithideopsis (Cerithidea) californica at Carpinteria Salt Marsh, California USA, February 2012 to January 2014

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Each month (except March 2012), we collected detailed data on the infection status of intertidal snails from ten fixed sites as part of a broader effort to...

  11. Myogenesis in Aplysia californica (Cooper, 1863) (Mollusca, Gastropoda, Opisthobranchia) with special focus on muscular remodeling during metamorphosis

    DEFF Research Database (Denmark)

    Wollesen, Tim; Wanninger, Andreas; Klussmann-Kolb, Annette

    2008-01-01

    To date only few comparative approaches tried to reconstruct the ontogeny of the musculature in invertebrates. This may be due to the difficulties involved in reconstructing three dimensionally arranged muscle systems by means of classical histological techniques combined with light or transmission...

  12. Botrytis californica, a new cryptic species in the B. cinerea species complex causing gray mold in blueberries and table grapes

    Science.gov (United States)

    Botrytis cinerea consists of two cryptic species, referred to as Group I and Group II based on Bc-hch gene RFLP haplotyping, and Group I has been described as a new cryptic species B. pseudocinerea. During a survey for Botrytis spp. causing gray mold in blueberries and table grapes in the Central Va...

  13. Transforming Growth Factor ß Recruits Persistent MAPK Signaling to Regulate Long-Term Memory Consolidation in "Aplysia Californica"

    Science.gov (United States)

    Shobe, Justin; Philips, Gary T.; Carew, Thomas J.

    2016-01-01

    In this study, we explore the mechanistic relationship between growth factor signaling and kinase activity that supports the protein synthesis-dependent phase of long-term memory (LTM) consolidation for sensitization of "Aplysia." Specifically, we examine LTM for tail shock-induced sensitization of the tail-elicited siphon withdrawal…

  14. Distribution and mapping of the snail Cerithideopsis (Cerithidea) californica at Carpinteria Salt Marsh, California USA, June to August 2012

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — We collected detailed spatial data on the density and size distribution of intertidal snails as part of a broader effort to understand food webs in California...

  15. Monthly densities of the snail Cerithideopsis (Cerithidea) californica at Carpinteria Salt Marsh, California USA, February 2012 to January 2014

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Each month (except March 2012), we collected detailed data on the density, size distribution, and infection status of intertidal snails from ten fixed sites as part...

  16. Protection against Amoebic Liver Abscess in Hamster by Intramuscular Immunization with an Autographa californica Baculovirus Driving the Expression of the Gal-Lectin LC3 Fragment

    National Research Council Canada - National Science Library

    Meneses-Ruiz, Dulce María; Aguilar-Diaz, Hugo; Bobes, Raúl José; Sampieri, Alicia; Vaca, Luis; Laclette, Juan Pedro; Carrero, Julio César

    2015-01-01

    ...) of Entamoeba histolytica conferred protection against ALA development in hamsters. In this study, we determined the ability of AcNPV-LC3 to protect against ALA by the intramuscular route as well as the liver immune response associated with protection...

  17. Affinities of bispyridinium non-oxime compounds to [(3)H]epibatidine binding sites of Torpedo californica nicotinic acetylcholine receptors depend on linker length.

    Science.gov (United States)

    Niessen, K V; Seeger, T; Tattersall, J E H; Timperley, C M; Bird, M; Green, C; Thiermann, H; Worek, F

    2013-12-05

    The toxicity of organophosphorus nerve agents or pesticides arises from accumulation of acetylcholine and overstimulation of both muscarinic and nicotinic acetylcholine receptors (mAChRs and nAChRs) due to inhibition of acetylcholinesterase (AChE). Standard treatment by administration of atropine and oximes, e.g., obidoxime or pralidoxime, focuses on antagonism of mAChRs and reactivation of AChE, whereas nicotinic malfunction is not directly treated. An alternative approach would be to use nAChR active substances to counteract the effects of accumulated acetylcholine. Promising in vitro and in vivo results were obtained with the bispyridinium compounds SAD-128 (1,1'-oxydimethylene bis(4-tert-butylpyridinium) dichloride) and MB327 (1,1'-(propane-1,3-diyl)bis(4-tert-butylpyridinium) di(iodide)), which were partly attributed to their interaction with nAChRs. In this study, a homologous series of unsubstituted and 4-tert-butyl-substituted bispyridinium compounds with different alkane linker lengths was investigated in competition binding experiments using [(3)H]epibatidine as a reporter ligand. Additionally, the effect of the well-characterised MB327 on the [(3)H]epibatidine equilibrium dissociation (KD) constant in different buffers was determined. This study demonstrated that divalent cations increased the affinity of [(3)H]epibatidine. Since quaternary ammonium molecules are known to inhibit AChE, the obtained affinity constants of the tested bispyridinium compounds were compared with the inhibition of human AChE. In competition experiments, bispyridinium derivatives of longer linker length displaced [(3)H]epibatidine and inhibited AChE strongly. Bispyridinium compounds with short linkers, at most, have an allosteric interaction with the [(3)H]epibatidine binding sites and barely inhibited AChE. In dependence on alkane linker length, the bispyridinium compounds seemed to interact at different binding sites. However, the exact binding sites of the bispyridinium compounds responsible for the positive pharmacological effects have still not been identified, making predictive drug design difficult. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  18. Alpha-conotoxin analogs with additional positive charge show increased selectivity towards Torpedo californica and some neuronal subtypes of nicotinic acetylcholine receptors

    NARCIS (Netherlands)

    Kasheverov, I.E.; Zhmak, M.N.; Vulfius, C.A.; Corbacheva, E.V.; Mordvintsev, D.Y.; Utkin, Y.N.; van Elk, R.; Smit, A.B.; Tsetlin, V.I.

    2006-01-01

    α-Conotoxins from Conus snails are indispensable tools for distinguishing various subtypes of nicotinic acetylcholine receptors (nAChRs), and synthesis of α-conotoxin analogs may yield novel antagonists of higher potency and selectivity. We incorporated additional positive charges into α-conotoxins

  19. Looking for episodic memory in animals and young children: prospects for a new minimalism.

    Science.gov (United States)

    Clayton, Nicola S; Russell, James

    2009-09-01

    Because animals and young children cannot be interrogated about their experiences it is difficult to conduct research into their episodic memories. The approach to this issue adopted by Clayton and Dickinson [Clayton, N. S., & Dickinson, A. (1998). Episodic-like memory during cache recovery by scrub jays. Nature, 395, 272-274] was to take a conceptually minimalist definition of episodic memory, in terms of integrating information about what was done where and when [Tulving, E. (1972). Episodic and semantic memory. In E. Tulving, & W. Donaldson (Eds.), Organisation of memory (pp. 381-403). New York: Academic Press], and to refer to such memories as 'episodic-like'. Some claim, however, that because animals supposedly lack the conceptual abilities necessary for episodic recall one should properly call these memories 'semantic'. We address this debate with a novel approach to episodic memory, which is minimalist insofar as it focuses on the non-conceptual content of a re-experienced situation. It rests on Kantian assumptions about the necessary 'perspectival' features of any objective experience or re-experience. We show how adopting this perspectival approach can render an episodic interpretation of the animal data more plausible and can also reveal patterns in the mosaic of developmental evidence for episodic memory in humans.

  20. Modeling abundance using hierarchical distance sampling

    Science.gov (United States)

    Royle, Andy; Kery, Marc

    2016-01-01

    In this chapter, we provide an introduction to classical distance sampling ideas for point and line transect data, and for continuous and binned distance data. We introduce the conditional and the full likelihood, and we discuss Bayesian analysis of these models in BUGS using the idea of data augmentation, which we discussed in Chapter 7. We then extend the basic ideas to the problem of hierarchical distance sampling (HDS), where we have multiple point or transect sample units in space (or possibly in time). The benefit of HDS in practice is that it allows us to directly model spatial variation in population size among these sample units. This is a preeminent concern of most field studies that use distance sampling methods, but it is not a problem that has received much attention in the literature. We show how to analyze HDS models in both the unmarked package and in the BUGS language for point and line transects, and for continuous and binned distance data. We provide a case study of HDS applied to a survey of the island scrub-jay on Santa Cruz Island, California.

  1. Abundance and Bloodfeeding Patterns of Mosquitoes (Diptera: Culicidae) in an Oak Woodland on the Eastern Slope of the Northern Coast Range of California.

    Science.gov (United States)

    Thiemann, Tara C; Woodward, David L; Fang, Ying; Ryan, Bonnie M; Nelms, Brittany M; Scott, Jamesina J; Reisen, William K

    2017-09-01

    The abundance and bloodfeeding patterns of mosquitoes was studied from 2008 to 2010 at an 18 ha. oak woodland in Lake County, CA. Host-seeking females were collected weekly from sunset to sunrise by paired dry-ice-baited CDC style traps, whereas resting females were aspirated from paired walk-in red boxes. Sequences of the COI gene amplified from bloodmeals from engorged resting females were used to identify the bloodmeal hosts. Aedes sierrensis (Ludlow) and Aedes increpitus Dyar complex mosquitoes were univoltine, although the timing of emergence and abundance varied temporally and seemed weather dependent. Abundance of both Anopheles franciscanus McCracken and Anopheles freeborni Aitken peaked in mid to late summer. Females of both genera bloodfed primarily on mule deer and black-tailed jackrabbits, and few fed on either dogs or humans that were consistently present within the woodland. In contrast, multivoltine Culex tarsalis Coquillett and Culex stigmatosoma Dyar were abundant throughout summer, especially from July to September. Both Culex species bloodfed on a wide variety of avian hosts, with most bloodmeals originating from California scrub-jay, wild turkey, oak titmouse, and house finch. Culex tarsalis fed on proportionately more mammals as summer progressed, peaking at 33% in September. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  2. An Overview of My Internship with the Ecological Program at John F. Kennedy Space Center

    Science.gov (United States)

    Owen, Samantha

    2010-01-01

    During my internship with Innovative Health Applications, I participated in numerous longterm research projects involving the study of various plant and animal life at the Kennedy Space Center (KSC). I observed the monitoring of nesting sea turtles. I learned about the transfer of egg clutches from the northern Gulf Coast in an effort to help the hatchlings avoid the oil spill in the Gulf of Mexico. I gained knowledge of tracking the movements of important sport fish and sharks in this area using a hydro-acoustic tag and receiver system. This effort included routinely taking water quality data at multiple sites around KSC. Alligator population and nesting assessments was another part of my internship. I observed the biologists take morphometric measurements, blood, urine and tissue samples from alligators found in KSC waterways. I assisted in taking photosynthesis and reflectance measurements on various scrub oaks and palmettos. I participated in Florida Scrub-Jay surveys in an effort to monitor their population trends and was involved in Southeastern beach mouse trapping and identification. I also assisted in seagrass surveys monitoring the health of the seagrass beds.

  3. Corvid caching: Insights from a cognitive model.

    Science.gov (United States)

    van der Vaart, Elske; Verbrugge, Rineke; Hemelrijk, Charlotte K

    2011-07-01

    Caching and recovery of food by corvids is well-studied, but some ambiguous results remain. To help clarify these, we built a computational cognitive model. It is inspired by similar models built for humans, and it assumes that memory strength depends on frequency and recency of use. We compared our model's behavior to that of real birds in previously published experiments. Our model successfully replicated the outcomes of two experiments on recovery behavior and two experiments on cache site choice. Our "virtual birds" reproduced declines in recovery accuracy across sessions, revisits to previously emptied cache sites, a lack of correlation between caching and recovery order, and a preference for caching in safe locations. The model also produced two new explanations. First, that Clark's nutcrackers may become less accurate as recovery progresses not because of differential memory for different cache sites, as was once assumed, but because of chance effects. And second, that Western scrub jays may choose their cache sites not on the basis of negative recovery experiences only, as was previously thought, but on the basis of positive recovery experiences instead. Alternatively, both "punishment" and "reward" may be playing a role. We conclude with a set of new insights, a testable prediction, and directions for future work. PsycINFO Database Record (c) 2011 APA, all rights reserved

  4. Sex, estradiol, and spatial memory in a food-caching corvid.

    Science.gov (United States)

    Rensel, Michelle A; Ellis, Jesse M S; Harvey, Brigit; Schlinger, Barney A

    2015-09-01

    Estrogens significantly impact spatial memory function in mammalian species. Songbirds express the estrogen synthetic enzyme aromatase at relatively high levels in the hippocampus and there is evidence from zebra finches that estrogens facilitate performance on spatial learning and/or memory tasks. It is unknown, however, whether estrogens influence hippocampal function in songbirds that naturally exhibit memory-intensive behaviors, such as cache recovery observed in many corvid species. To address this question, we examined the impact of estradiol on spatial memory in non-breeding Western scrub-jays, a species that routinely participates in food caching and retrieval in nature and in captivity. We also asked if there were sex differences in performance or responses to estradiol. Utilizing a combination of an aromatase inhibitor, fadrozole, with estradiol implants, we found that while overall cache recovery rates were unaffected by estradiol, several other indices of spatial memory, including searching efficiency and efficiency to retrieve the first item, were impaired in the presence of estradiol. In addition, males and females differed in some performance measures, although these differences appeared to be a consequence of the nature of the task as neither sex consistently out-performed the other. Overall, our data suggest that a sustained estradiol elevation in a food-caching bird impairs some, but not all, aspects of spatial memory on an innate behavioral task, at times in a sex-specific manner. Copyright © 2015 Elsevier Inc. All rights reserved.

  5. Dicty_cDB: VSA527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AF462563.1 Hemibagrus nemurus clone PCTB3-1 microsatellite sequence. 44 5e-05 2 BF610997 |BF610997.1 dd96d11...|AF520891.1 Aphelocoma coerulescens clone ApCo31 microsatellite sequence. 46 1e-04 2 CD329868 |CD329868.1 AGENCOURT_14291777

  6. Structure of peptide fragments of a cross-linked complex of [Lys(Abz){sup 26}]neurotoxin II from Naja naja oxiana with the nicotinic acetylcholine receptor from Torpedo californica

    Energy Technology Data Exchange (ETDEWEB)

    Utkin, Yu.N.; Machold, J.; Franke, P. [M.M. Shemyakin and Yu.A. Ovchinnikov Institute of Bioorganic Chemistry, Moscow (Russian Federation)] [and others

    1994-09-10

    After irradiation of a complex of the nicotinic acetylcholine receptor (AChR) with iodinated [Lys(Abz){sup 26}]neurotoxin II, the labeled {delta}-subunit of AChR was isolated, and it was cleaved with the aid of LysC endoproteinase, the hydrolysate being separated by rfHPLC. In a mass-spectrometric analysis of the radioactive fraction, the peptide of the {delta}-subunit (M{sub r} 2593) was detected. By purification of the radioactive rfHPLC fraction with the aid of electrophoresis in tricine gel, three radioactive bands were obtained (M {approximately} 16, 10, and 8 kDa). Edman degradation gave for all of them the sequence of a fragment of the {delta}-subunit beginning from Phe{sup 148}. On further cleavage of the radioactive fraction within the gel by the action of AspN proteinase, followed by rfHPLC, the radioactive peak was eluted under conditions close to those for the elution of the single radioactive peptide 30-44 obtained by the successive cleavage of the [{sup 125}I] neurotoxin II by LysC/AspN proteinases. This result shows the presence of the corresponding neurotoxin fragment in the sample in which the above-mentioned sequence of the receptor was detected. Since no sequences of the neurotoxin were detected in the radioactive products of the cross-linkages in model experiments at the picomolar level, neurotoxin II and its fragments were investigated by Edman degradation at the picomole level and so was the influence of the p-azidobenzyl group and its photoactivation on the degradation. On the whole, the sequencing of neurotoxin II and its fragments containing photolabeled and iodinated residues took place with extremely low initial yields; a further fall in the yields was observed on the degradation of irradiated Lys{sup 26}-peptides. The results obtained explain the difficulties in the detection of the sequences of the neurotoxin in cross-linkage products available in amounts of only 10-20 pmole.

  7. The Effects of Vegetative Type, Edges, Fire History, Rainfall and Management in Fire-Maintained Ecosystems

    Science.gov (United States)

    Breininger, David R.; Foster, Tammy E.; Carter, Geoffrey M.; Duncan, Brean W.; Stolen, Eric D.; Lyon, James E.

    2017-01-01

    The combined effects of repeated fires, climate, and landscape features (e.g., edges) need greater focus in fire ecology studies, which usually emphasize characteristics of the most recent fire and not fire history. Florida scrub-jays are an imperiled, territorial species that prefer medium (1.2-1.7 m) shrub heights. We measured short, medium, and tall habitat quality states annually within 10 ha grid cells that represented potential territories because frequent fires and vegetative recovery cause annual variation in habitat quality. We used multistate models and model selection to test competing hypotheses about how transition probabilities between states varied annually as functions of environmental covariates. Covariates included vegetative type, edges, precipitation, openings (gaps between shrubs), mechanical cutting, and fire characteristics. Fire characteristics not only included an annual presenceabsence of fire covariate, but also fire history covariates: time since the previous fire, the maximum fire-free interval, and the number of repeated fires. Statistical models with support included many covariates for each transition probability, often including fire history, interactions and nonlinear relationships. Tall territories resulted from 28 years of fire suppression and habitat fragmentation that reduced the spread of fires across landscapes. Despite 35 years of habitat restoration and prescribed fires, half the territories remained tall suggesting a regime shift to a less desirable habitat condition. Measuring territory quality states and environmental covariates each year combined with multistate modeling provided a useful empirical approach to quantify the effects of repeated fire in combinations with environmental variables on transition probabilities that drive management strategies and ecosystem change.

  8. Corvid re-caching without 'theory of mind': a model.

    Directory of Open Access Journals (Sweden)

    Elske van der Vaart

    Full Text Available Scrub jays are thought to use many tactics to protect their caches. For instance, they predominantly bury food far away from conspecifics, and if they must cache while being watched, they often re-cache their worms later, once they are in private. Two explanations have been offered for such observations, and they are intensely debated. First, the birds may reason about their competitors' mental states, with a 'theory of mind'; alternatively, they may apply behavioral rules learned in daily life. Although this second hypothesis is cognitively simpler, it does seem to require a different, ad-hoc behavioral rule for every caching and re-caching pattern exhibited by the birds. Our new theory avoids this drawback by explaining a large variety of patterns as side-effects of stress and the resulting memory errors. Inspired by experimental data, we assume that re-caching is not motivated by a deliberate effort to safeguard specific caches from theft, but by a general desire to cache more. This desire is brought on by stress, which is determined by the presence and dominance of onlookers, and by unsuccessful recovery attempts. We study this theory in two experiments similar to those done with real birds with a kind of 'virtual bird', whose behavior depends on a set of basic assumptions about corvid cognition, and a well-established model of human memory. Our results show that the 'virtual bird' acts as the real birds did; its re-caching reflects whether it has been watched, how dominant its onlooker was, and how close to that onlooker it has cached. This happens even though it cannot attribute mental states, and it has only a single behavioral rule assumed to be previously learned. Thus, our simulations indicate that corvid re-caching can be explained without sophisticated social cognition. Given our specific predictions, our theory can easily be tested empirically.

  9. Women's health among the Chumash.

    Science.gov (United States)

    Adams, James D; Garcia, Cecilia

    2006-03-01

    Plants were, and still are, widely used for a number of conditions affecting women in California. This article discusses traditional remedies of the Chumash for dysmenorrhea, premenstrual syndrome, feminine hygiene, heavy menstruation, urinary tract infections, parturition, lactation, infant care, menopause, sexually transmitted diseases, fertility, contraception and abortions. Many plants are presented including Artemisia douglasiana, Paeonia californica, Trichostema lanatum, Salvia apiana, Ephedra viridis, Leymus condensatus, Vitis californica, Eschscholzia californica, Rosa californica, Scirpus acutus, Anemopsis californica and Phoradendron macrophyllum. By providing the specific uses of plants for specific diseases and discussing chemistry, efficacy and safety concerns for each plant, we hope that this article gives direction to women seeking to use plants in their health care.

  10. Women's Health Among the Chumash

    Directory of Open Access Journals (Sweden)

    James D. Adams

    2006-01-01

    Full Text Available Plants were, and still are, widely used for a number of conditions affecting women in California. This article discusses traditional remedies of the Chumash for dysmenorrhea, premenstrual syndrome, feminine hygiene, heavy menstruation, urinary tract infections, parturition, lactation, infant care, menopause, sexually transmitted diseases, fertility, contraception and abortions. Many plants are presented including Artemisia douglasiana, Paeonia californica, Trichostema lanatum, Salvia apiana, Ephedra viridis, Leymus condensatus, Vitis californica, Eschscholzia californica, Rosa californica, Scirpus acutus, Anemopsis californica and Phoradendron macrophyllum. By providing the specific uses of plants for specific diseases and discussing chemistry, efficacy and safety concerns for each plant, we hope that this article gives direction to women seeking to use plants in their health care.

  11. Mucosal delivery of ACNPV baculovirus driving expression of the Gal-lectin LC3 fragment confers protection against amoebic liver abscess in hamster

    National Research Council Canada - National Science Library

    Meneses-Ruiz, D M; Laclette, J P; Aguilar-Díaz, H; Hernández-Ruiz, J; Luz-Madrigal, A; Sampieri, A; Vaca, L; Carrero, J C

    2011-01-01

    .... Here, we evaluate the potential of a recombinant Autographa californica baculovirus driving the expression of the LC3 fragment of the Gal-lectin to confer protection against amoebic liver abscess (ALA...

  12. Protein Tyrosine Phosphatase-Induced Hyperactivity Is a Conserved Strategy of a Subset of BaculoViruses to Manipulate Lepidopteran Host Behavior

    NARCIS (Netherlands)

    Houte, van S.; Ros, V.I.D.; Mastenbroek, T.G.; Vendrig, N.J.; Hoover, K.; Spitzen, J.; Oers, van M.M.

    2012-01-01

    Many parasites manipulate host behavior to increase the probability of transmission. To date, direct evidence for parasitic genes underlying such behavioral manipulations is scarce. Here we show that the baculovirus Autographa californica nuclear polyhedrovirus (AcMNPV) induces hyperactive behavior

  13. Cercosporoid leaf pathogens from whorled milkweed and spineless safflower in California

    NARCIS (Netherlands)

    Koike, S.K.; Baameur, A.; Groenewald, J.Z.; Crous, P.W.

    2011-01-01

    Two cercosporoid species are respectively described from Mexican whorled milkweed (Asclepias fascicularis), and spineless safflower (Carthamus tinctorius) from California. Passalora californica represents a new pathogen on Asclepias fascicularis, while Ramularia cynarae is confirmed on Carthamus

  14. Absence of psilocybin in species of fungi previously reported to contain psilocybin and related tryptamine derivatives

    OpenAIRE

    Stijve, T.; Kuyper, Th.W.

    1988-01-01

    Seven taxa of agarics reported in literature to contain psilocybin (viz. Psathyrella candolleana, Gymnopilus spectabilis, G. fulgens, Hygrocybe psittacina var. psittacina and var. californica, Rickenella fibula, R. swartzii) have been analysed for psilocybin and related tryptamines with negative results.

  15. Absence of psilocybin in species of fungi previously reported to contain psilocybin and related tryptamine derivatives

    NARCIS (Netherlands)

    Stijve, T.; Kuyper, Th.W.

    1988-01-01

    Seven taxa of agarics reported in literature to contain psilocybin (viz. Psathyrella candolleana, Gymnopilus spectabilis, G. fulgens, Hygrocybe psittacina var. psittacina and var. californica, Rickenella fibula, R. swartzii) have been analysed for psilocybin and related tryptamines with negative

  16. Dicty_cDB: VSB711 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ns cDNA clone IMAGE:4509608 5', mRNA sequence. 50 1e-08 2 CD477300 |CD477300.1 eca01-12ms1-h08 Eca01 Eschsch...olzia californica cDNA clone eca01-12ms1-h08 5', mRNA sequence. 42 4e-05 2 CD476897 |CD476897.1 eca01-7ms1-c...05 Eca01 Eschscholzia californica cDNA clone eca01-7ms1-c05 5', mRNA sequence. 42 4e-05 2 CD477145 |CD47...T7, mRNA sequence. 36 4e-04 3 CD477559 |CD477559.1 eca01-11ms1-h08 Eca01 Eschscholzia californica cDNA clone

  17. Black Pineleaf Scale (FIDL)

    Science.gov (United States)

    Katharine A. Sheehan; Mario A. Melendez; Shana Westfall

    1998-01-01

    The black pineleaf scale (Nuculaspis californica (Coleman)) belongs to a group of sucking insects called armored scales. Concealed under their protective shells, these scales insert their mouthparts into their hosts, removing sap and, possibly, injecting toxic enzymes secreted in the saliva. Armored scales are important pests of agricultural and ornamental plants;...

  18. Increasing distance from California bay laurel reduces the risk and severity of Phytophthora ramorum canker in coast live oak

    Science.gov (United States)

    Tedmund J. Swiecki; Elizabeth A. Bernhardt

    2008-01-01

    Foliar infections in California bay (Umbellularia californica) are the most important known source of inoculum contributing to Phytophthora ramorum canker in coast live oak (Quercus agrifolia). This research addressed the question whether there is a ?safe? distance between California bay and coast live oak beyond...

  19. Summer survival of Phytophthora ramorum in California bay laurel leaves

    Science.gov (United States)

    Elizabeth J. Fichtner; David M. Rizzo; Shannon C. Lynch; Jennifer Davidson; Gerri Buckles; Jennifer Parker

    2008-01-01

    Sudden oak death manifests as non-lethal foliar lesions on bay laurel (Umbellularia californica), which support sporulation and survival of Phytophthora ramorum in forest ecosystems. Infected bay laurel leaves are more likely to abscise than uninfected leaves, resulting in an accumulation of inoculum at the forest floor. The pathogen survives the dry...

  20. Effects of environmental variables on the survival of Phytophthora ramorum in bay laurel leaves

    Science.gov (United States)

    M.V. DiLeo; R.M. Bostock; D.M. Rizzo

    2008-01-01

    Bay laurel (Umbellularia californica (Hook. & Arn.) Nutt.) is the primary reservoir host of Phytophthora ramorum Werres, De Cock & Man n?t Veld in coastal California woodlands. Non-lethal foliar lesions on bay laurel trees support the majority of pathogen sporulation during the winter et season and appear to provide the...

  1. Phytophthora ramorum does not cause physiologically significant systemic injury to California bay laurel, its primary reservoir host

    Science.gov (United States)

    M. V. DiLeo; R. M. Bostock; D.M. Rizzo

    2009-01-01

    California bay laurel trees (Umbellularia californica) play a crucial role in the reproduction and survival of Phytophthora ramorum in coastal California forests by supporting sporulation during the rainy season and by providing a means for the pathogen to survive the dry, Mediterranean summer. While bay laurel is thus critical to the epidemiology of sudden oak death...

  2. Replication and inclusion body characteristics of two Lymantria dispar nuclear polyhedrosis virus plaque variants

    Science.gov (United States)

    James M. Slavicek; Carita Lanner-Herrera; Nancy Hayes-Plazolles; Mary Ellen Kelly; Martha Fikes

    1991-01-01

    Propagation of Autographa californica nuclear polyhedrosis virus in cell culture results in the generation of a mutant virus, termed few polyhedra. This plaque variant is characterized by a high budded virus titer, the formation of few polyhedral inclusion bodies (PIBs), and the production of PIBs exhibiting a low potency against its natural host....

  3. Phytophthora ramorum isolated from California bay laurel inflorescences and mistletoe: possible implications relating to disease spread

    Science.gov (United States)

    Gary A. Chastagner; Kathy Riley; Norm Dart

    2008-01-01

    Since 2005, we have been studying the spread and development of Phytophthora ramorum at a Christmas tree farm near Los Gatos, California. This research has shown that distance from infected plants, predominantly California bay laurel (Umbellularia californica) (referred to as ?bay? throughout), is an important factor relating to...

  4. Download this PDF file

    African Journals Online (AJOL)

    Alcock J (1991) Mate-locating behaviour of Xylocopa californica arizonensis Cresson (Hymenoptera: Anthophoridae). J. Kansas Entomol Soc. 64(4): 349-356. Batra SWT (1994) Anthophora pilipes villosula Sm. (Hymenoptera: Anthophoridae), a manageable Japanese bee that visits blueberries and apples during cool, rainy ...

  5. Effects of population size on virus evolution: a baculovirus perspective

    NARCIS (Netherlands)

    Zwart, M.P.

    2008-01-01

    This thesis explores the population genetics of the baculovirus infection process and the consequences for virus evolution. Using Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV) and lepidopteran insect larvae as a model system, we attempt to characterize (1) elemental virus-host and

  6. Dissecting insect development : baculovirus-mediated gene silencing in insects

    NARCIS (Netherlands)

    Hajós, J.P.; Vermunt, A.W.M.; Zuidema, D.; Kulcsár, P.; Varjas, L.; Kort, de C.A.D.; Závodszky, P.; Vlak, J.M.

    1999-01-01

    A novel concept applying baculovirus-mediated gene silencing to study insect gene function and regulation is described in this paper. A recombinant baculovirus, Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV), was constructed with the juvenile hormone esterase (JHE) gene from the

  7. Response of gypsy moth larvae to homologous and heterologous nuclear polyhedrosis virus

    Science.gov (United States)

    Kathleen S. Shields; Edward M. Dougherty

    1991-01-01

    The gypsy moth, Lymantria dispar, is not particularly susceptible to baculoviruses other than the nuclear polyhedrosis virus originally isolated from the species (LdMNPV). The multiple enveloped nuclear polyhedrosis virus of Autographa californica (AcMNPV), a very virulent baculovirus that replicates in a large number of...

  8. Host phenology and leaf effects on susceptibility of California bay laurel to Phytophthora ramorum

    Science.gov (United States)

    Steven F. Johnston; Michael F. Cohen; Tamas Torok; Ross K. Meentemeyer; Nathan E. Rank

    2016-01-01

    Spread of the plant pathogen Phytophthora ramorum, causal agent of the forest disease sudden oak death, is driven by a few competent hosts that support spore production from foliar lesions. The relationship between traits of a principal foliar host, California bay laurel (Umbellularia californica), and susceptibility to

  9. The Tail-Elicited Tail Withdrawal Reflex of "Aplysia" Is Mediated Centrally at Tail Sensory-Motor Synapses and Exhibits Sensitization across Multiple Temporal Domains

    Science.gov (United States)

    Philips, Gary T.; Sherff, Carolyn M.; Menges, Steven A.; Carew, Thomas J.

    2011-01-01

    The defensive withdrawal reflexes of "Aplysia californica" have provided powerful behavioral systems for studying the cellular and molecular basis of memory formation. Among these reflexes the (T-TWR) has been especially useful. In vitro studies examining the monosynaptic circuit for the T-TWR, the tail sensory-motor (SN-MN) synapses, have…

  10. Women's Health Among the Chumash

    OpenAIRE

    Adams, James D.; Garcia, Cecilia

    2006-01-01

    Plants were, and still are, widely used for a number of conditions affecting women in California. This article discusses traditional remedies of the Chumash for dysmenorrhea, premenstrual syndrome, feminine hygiene, heavy menstruation, urinary tract infections, parturition, lactation, infant care, menopause, sexually transmitted diseases, fertility, contraception and abortions. Many plants are presented including Artemisia douglasiana, Paeonia californica, Trichostema lanatum, Salvia apiana...

  11. Final Environmental Assessment: Western Range Command Transmit Site Vandenberg Air Force Base, California

    Science.gov (United States)

    2005-01-20

    Artemisia californica), black sage (Salvia me/litera), silver lupine (Lupinus chamissonis), coastal buckwheat (Eriogonum parvifolium), California...buried in leaf litter or burrowing near the surface through loose or sandy soil. The reproductive season begins with mating activities in late...activity relative disturbance occurs after nesting has already been initiated, construction-related noise could adversely impact reproductive success

  12. Final Environmental Assessment: Falcon 9 and Falcon 9 Heavy Launch Vehicle Programs from Space Launch Complex 4 East at Vandenberg Air Force Base, California

    Science.gov (United States)

    2011-03-01

    dominant native species at this site are coyote brush (Baccharis pilularis), California sagebrush ( Artemisia californica), mock heather (Ericameria...Force Base: Population size, reproductive success, and management. Unpublished Report. Point Reyes Bird Observatory. Stinson Beach, California. 29 pp...observed. Startle responses are rare and reproductive success does not seem to be affected by launch activities, even near SLC-2 where Delta II

  13. Dicty_cDB: SHL729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 200704.1 PEG002-C-111796-501 Normalized Pedal-Pleural Ganglia Aplysia californica cDNA clone PEG002-C-111796... 5', mRNA sequence. 44 4.7 1 EB189322 |EB189322.1 PEG001-C-009321-501 Non-Normalized Pedal

  14. Dicty_cDB: VHA409 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |EB223488.1 PEG002-C-104408-501 Normalized Pedal-Pleural Ganglia Aplysia califor...nica cDNA clone PEG002-C-104408 5', mRNA sequence. 44 0.44 2 EB238172 |EB238172.1 PEG003-C-223796-501 Normalized Pedal

  15. Baculovirus VP80 Protein and the F-Actin Cytoskeleton Interact and Connect the Viral Replication Factory with the Nuclear Periphery

    NARCIS (Netherlands)

    Marek, M.; Merten, O.W.; Galibert, L.; Vlak, J.M.; Oers, van M.M.

    2011-01-01

    Recently, we showed that the Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV) VP80 protein is essential for the formation of both virion types, budded virus (BV) and occlusion-derived virus (ODV). Deletion of the vp80 gene did not affect assembly of nucleocapsids. However, these

  16. PARTICLE REMOVAL RATES BY THE MUD SHRIMP UPOGEBIA PUGETTENSIS, ITS BURROW, AND A COMMENSAL CLAM: EFFECTS ON ESTUARINE PHYTOPLANKTON ABUNDANCE

    Science.gov (United States)

    The burrowing shrimp Upogebia pugettensis is an abundant intertidal inhabitant of Pacific Northwest bays and estuaries where it lives commensally with the bivalve Cryptomya californica. Suspension-feeding activities by the shrimp and by its commensal clam, as well as particle se...

  17. Identification and characterization of the ecdysteroid UDPglucosyltransferase gene of the Lymantria dispar multinucleocapsid nuclear polyhedrosis virus

    Science.gov (United States)

    Christopher I. Riegel; Carita Lanner-Herrera; James M. Slavicek

    1994-01-01

    We have located, cloned, sequenced and characterized the ecdysteroid UDP-glucosyltransferase gene (egt) gene from the baculovirus Lymantria dispar multinucleocapsid nuclear polyhedrosis virus,(LdMNPV), which is specific for the gypsy moth (L. dispar). The egt gene from the related baculovirus Autographa californica...

  18. Model of statoconia accumulation in gravireceptors of mollusks

    Science.gov (United States)

    Kondrachuk, A. V.; Wiederhold, M. L.

    2001-01-01

    The kinetics of formation and accumulation of statoconia are different for Aplysia californica and Biomphalaria glabrata. In Aplysia californica, the fast growth of statoconia number occurs after the critical size (approximately 45 micrometers) of statocyst is reached; then the increase of statoconia number is proceeding with the nonmonotonic rate during the life of an animal. In Biomphalaria the growth of statoconia number occurs only in the initial phase. Then long-term evolution of statoconia in the absence of their generation is the result of their growth in the cyst lumen. In the case of Aplysia californica it is not clear whether a temporal change of the statoconia size distribution (SSD) is caused by statoconia growth in the cyst lumen similar to that in Biomphalaria (Model 1) or statoconia growth takes place in supporting cells until their release into the cyst lumen occurs. (Model 2). This problem is of practical importance because the majority of experiments related to the development of molluscan gravireceptors in altered gravity dealt with an initial phase of statoconia evolution in Aplysia californica and Biomphalaria glabrata. The purpose of the present work is the application of mathematical modeling to the analysis of mechanisms of statoconia formation by supporting cells.

  19. Spread and development of Phytophthora ramorum in a California christmas tree farm

    Science.gov (United States)

    Gary A. Chastagner; Kathy Riley; Norm Dart

    2008-01-01

    The risk of conifers being infected by Phytophthora ramorum under natural conditions is poorly understood. In California, infected conifers commonly occur as understory plants beneath or adjacent to heavily infected plants like California bay laurel (Umbellularia californica). During wet periods, P. ramorum is...

  20. Recombinant, catalytically inactive juvenile hormone esterase enhances efficacy of baculovirus insecticides

    NARCIS (Netherlands)

    Meer, van M.M.M.; Bonning, B.C.; Ward, V.K.; Vlak, J.M.; Hammock, B.D.

    2000-01-01

    The insecticidal efficacy of baculoviruses can be enhanced by engineering the viral genome to express proteins that disrupt the physiology of the host insect. Here we describe the development of a genetically engineered Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV) which expresses

  1. Conditions 10 years after sudden oak death suppression treatments in Humboldt County, California

    Science.gov (United States)

    Yana Valachovic; Richard Cobb; Brendan Twieg

    2017-01-01

    In 2006, three isolated sudden oak death- (SOD) infested locations within Humboldt County were selected for silvicultural treatments that targeted the removal and/or reduction of tanoak (Notholithocarpus densiflorus Hook. & Arn.) and California bay laurel (Umbellularia californica Hook. & Arn), the main hosts...

  2. Effects of diversity, topography, and interannual climate variability on pathogen spillover

    Science.gov (United States)

    Whalen W. Dillon; Ross K. Meentemeyer; David M. Rizzo

    2017-01-01

    Our knowledge of sudden oak death (SOD) disease dynamics indicate that without bay laurel (Umbellularia californica) there is seldom oak (Quercus) infection. This requirement of an alternate host species for disease transmission to oak species is an example of pathogen spillover. We developed a path analysis to test...

  3. Survival and chlamydospore production of Phytophthora ramorum in California bay laurel leaves

    Science.gov (United States)

    E. Fichtner; D. Rizzo; S. Lynch; D. Rizzo; G. Buckles; J. Parke

    2009-01-01

    Sudden oak death manifests as non-lethal foliar lesions on bay laurel (Umbellularia californica), which support sporulation and survival of Phytophthora ramorum in forest ecosystems. The pathogen survives the dry summers in a proportion of attached bay leaves, but the propagules responsible for survival are...

  4. Finding of No Significant Impact: SLC-4 to SLC-6 Replacement Waterline Vandenberg Air Force Base, California

    Science.gov (United States)

    2004-07-28

    marianum). stinging nettle ( Urtica dioica ). poison hemlock (Conium maculatum). poison oak and introduced grasses dominate the understory. This site is...Hedge nettle * Toxicodendron diversi lobum Poison oak * * * Urtica dioica Stinging nettle * T’erbena californica California vervain * 1...Action. 2) the existing. environmental conditions. and 3) likely effects of the proposed and alternative actions on the natural and human environments

  5. African Journal of Range and Forage Science - Vol 9, No 2 (1992)

    African Journals Online (AJOL)

    Defoliation effects on resource allocation in Arizona cottontop (Digitaria californica) and Lehmann lovegrass (Eragrostis lehmanniana) · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Cox J.R., Giner-Mendoza M., Dobrenz A.K., Smith M.F., 53-59 ...

  6. This tree is not big enough for the both of us: symptoms of Phytophthora ramorum on California bay laurel are lower when insect herbivores are abundant

    Science.gov (United States)

    Kerry E. Wininger; Nathan Rank

    2017-01-01

    Leaves of California bay laurel (Umbellularia californica) are considered the primary natural source of inoculum for the devastating forest disease sudden oak death (Phytophthora ramorum), and yet this plant and the insects associated with its leaves remain understudied. This is unfortunate due to the role herbivorous...

  7. Open reading frame 94 of Helicoverpa armigera single nucleocapsid nucleopolyhedrovirus encodes a novel conserved occlusion-derived virion protein, ODV-EC43

    NARCIS (Netherlands)

    Fang, M.; Wang, H.; Yuan, L.; Chen Xinwen,; Vlak, J.M.; Hu, Z.

    2003-01-01

    Open reading frame 94 (Ha94) of Helicoverpa armigera single nucleocapsid nucleopolyhedrovirus (HaSNPV) is 1086 bp long and a homologue of Autographa californica multiple NPV ORF109. The gene is conserved among all baculoviruses whose genomes have been completely sequenced so far and is thus

  8. Sleep Supports Inhibitory Operant Conditioning Memory in "Aplysia"

    Science.gov (United States)

    Vorster, Albrecht P. A.; Born, Jan

    2017-01-01

    Sleep supports memory consolidation as shown in mammals and invertebrates such as bees and "Drosophila." Here, we show that sleep's memory function is preserved in "Aplysia californica" with an even simpler nervous system. Animals performed on an inhibitory conditioning task ("learning that a food is inedible") three…

  9. Studies on yeasts and yeast-like microorganisms in the denitrification unit biocenosis

    Directory of Open Access Journals (Sweden)

    Elena Sláviková

    2014-08-01

    Full Text Available It was found that Candida famata, Hansenula californica and Rhodotorula rubra occurred in reactor UASB-type biocenosis in the course of denitrification carried out in the presence of lactic acid as a carbon source. The role of those species in nitrogen removal process was discussed with respect to their physiology.

  10. Phytolith Assemblages in Grasses Native to Central Argentina

    OpenAIRE

    GALLEGO, LUCRECIA; Distel, Roberto A.

    2004-01-01

    • Background and Aims Phytolith reference collections are a prerequisite for accurate interpretation of soil phytolith assemblages aimed at reconstructing past vegetation. In this study a phytolith reference collection has been developed for several grasses native to central Argentina: Poa ligularis, Piptochaetium napostaense, Stipa clarazii, Stipa tenuis, Stipa tenuissima, Stipa eriostachya, Stipa ambigua, Stipa brachychaeta, Pappophorum subbulbosum, Digitaria californica, Bothriochloa edwar...

  11. Effect of environmental conditions and lesion age on sporulation of Phytophthora ramorum on California bay laurel, rhododendron, and camellia

    Science.gov (United States)

    Steve Tjosvold; David Chambers; Sylvia Mori

    2013-01-01

    The objective of our research was to determine the environmental conditions and lesion age favorable for Phytophthora ramorum sporulation under field conditions. For 2 years, new camellia, rhododendron, and California bay laurel (Umbellaria californica (Hook. & Arn.) Nutt.) nursery stock were seasonally inoculated (every 3 months) on foliage....

  12. Antimicrobial Synergic Effect of Allicin and Silver Nanoparticles on ...

    African Journals Online (AJOL)

    for a number of botanical extracts including Salvia officinalis,. Eucalyptus globulus, Coleus forskohlii, Arctostaphylos uva‑ursi, Coptis chinensis, Turnera diffusa, Anemopsis californica, Larrea tridentata and A. sativum.[15] Similarly, the methanolic extract of Coriandrum sativum, Crocus sativus and Nerium oleander as well as ...

  13. The roots of defense: plant resistance and tolerance to belowground herbivory.

    Directory of Open Access Journals (Sweden)

    Sean M Watts

    Full Text Available BACKGROUND: There is conclusive evidence that there are fitness costs of plant defense and that herbivores can drive selection for defense. However, most work has focused on above-ground interactions, even though belowground herbivory may have greater impacts on individual plants than above-ground herbivory. Given the role of belowground plant structures in resource acquisition and storage, research on belowground herbivores has much to contribute to theories on the evolution of plant defense. Pocket gophers (Geomyidae provide an excellent opportunity to study root herbivory. These subterranean rodents spend their entire lives belowground and specialize on consuming belowground plant parts. METHODOLOGY AND PRINCIPAL FINDINGS: We compared the root defenses of native forbs from mainland populations (with a history of gopher herbivory to island populations (free from gophers for up to 500,000 years. Defense includes both resistance against herbivores and tolerance of herbivore damage. We used three approaches to compare these traits in island and mainland populations of two native California forbs: 1 Eschscholzia californica populations were assayed to compare alkaloid deterrents, 2 captive gophers were used to test the palatability of E. californica roots and 3 simulated root herbivory assessed tolerance to root damage in Deinandra fasciculata and E. californica. Mainland forms of E. californica contained 2.5 times greater concentration of alkaloids and were less palatable to gophers than island forms. Mainland forms of D. fasciculata and, to a lesser extent, E. californica were also more tolerant of root damage than island conspecifics. Interestingly, undamaged island individuals of D. fasciculata produced significantly more fruit than either damaged or undamaged mainland individuals. CONCLUSIONS AND SIGNIFICANCE: These results suggest that mainland plants are effective at deterring and tolerating pocket gopher herbivory. Results also suggest

  14. Dicty_cDB: FC-BA14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NCOURT_7808782 NIH_MGC_92 Homo sapiens cDNA clone IMAGE:6069301 5', mRNA sequence. 50 1e-08 2 CD477300 |CD47...7300.1 eca01-12ms1-h08 Eca01 Eschscholzia californica cDNA clone eca01-12ms1-h08 5', mRNA sequence. 42 3e-05 2 CD476897 |CD47...6897.1 eca01-7ms1-c05 Eca01 Eschscholzia californica cDNA clone eca01-7ms1-c05 5', mRNA sequence. 42 3e-05 2 CD47...7145 |CD477145.1 eca01-14ms1-h01 Eca01 Eschscholzia califor...ne 180B22T7, mRNA sequence. 36 3e-04 3 CD477559 |CD477559.1 eca01-11ms1-h08 Eca01

  15. Dicty_cDB: FC-AQ04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GENCOURT_7808782 NIH_MGC_92 Homo sapiens cDNA clone IMAGE:6069301 5', mRNA sequence. 50 1e-08 2 CD477300 |CD47...7300.1 eca01-12ms1-h08 Eca01 Eschscholzia californica cDNA clone eca01-12ms1-h08 5', mRNA sequence. 42 3e-05 2 CD476897 |CD47...6897.1 eca01-7ms1-c05 Eca01 Eschscholzia californica cDNA clone eca01-7ms1-c05 5', mRNA sequence. 42 3e-05 2 CD47...7145 |CD477145.1 eca01-14ms1-h01 Eca01 Eschscholzia calif...lone 180B22T7, mRNA sequence. 36 3e-04 3 CD477559 |CD477559.1 eca01-11ms1-h08 Eca

  16. Dicty_cDB: VSJ410 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clone IMAGE:4509608 5', mRNA sequence. 50 2e-08 2 CD477300 |CD477300.1 eca01-12ms1-h08 Eca01 Eschscholzia c...alifornica cDNA clone eca01-12ms1-h08 5', mRNA sequence. 42 6e-05 2 CD476897 |CD476897.1 eca01-7ms1-c05 Eca0...1 Eschscholzia californica cDNA clone eca01-7ms1-c05 5', mRNA sequence. 42 6e-05 2 CD477145 |CD47...quence. 42 7e-05 2 AY087862 |AY087862.1 Arabidopsis thaliana clone 39018 mRNA, complete sequence. 36 2e-04 3 CD477559 |CD47

  17. Dicty_cDB: VSG216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A sequence. 50 2e-08 2 CD477300 |CD477300.1 eca01-12ms1-h08 Eca01 Eschscholzia californica cDNA clone eca01-...12ms1-h08 5', mRNA sequence. 42 6e-05 2 CD476897 |CD476897.1 eca01-7ms1-c05 Eca01 Eschscholzia californica c...DNA clone eca01-7ms1-c05 5', mRNA sequence. 42 6e-05 2 CD477145 |CD477145.1 eca01...|AY087862.1 Arabidopsis thaliana clone 39018 mRNA, complete sequence. 36 2e-04 3 CD477559 |CD477559.1 eca01-...quence. 50 5e-09 2 BG259081 |BG259081.1 602379133F1 NIH_MGC_92 Homo sapiens cDNA clone IMAGE:4509608 5', mRN

  18. Dicty_cDB: SSK109 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 BG259081 |BG259081.1 602379133F1 NIH_MGC_92 Homo sapiens cDNA clone IMAGE:4509608 5', mRNA sequence. 50 1e-08 2 CD477300 |CD47...NA sequence. 42 3e-05 2 CD476897 |CD476897.1 eca01-7ms1-c05 Eca01 Eschscholzia californica cDNA clone eca01-...7ms1-c05 5', mRNA sequence. 42 3e-05 2 CD477145 |CD477145.1 eca01-14ms1-h01 Eca01...sis thaliana cDNA clone 180B22T7, mRNA sequence. 36 4e-04 3 CD477559 |CD477559.1 ...7300.1 eca01-12ms1-h08 Eca01 Eschscholzia californica cDNA clone eca01-12ms1-h08 5', mR

  19. Effect of morphactin (IT 3456 on pollen germination and pollen tube growth in four species of Angiospermae

    Directory of Open Access Journals (Sweden)

    Barbara Gabara

    2014-01-01

    Full Text Available The action of morphactin in 10, 100 and 1000 ppm on pollen germination and tube growth was studied in four species: Antirrhinum majus, Campanula rapunculoides, Eschscholtzia californica and Narcissus poeticus. Pollen grains showed different sensitivity to particular concentrations of morphactin. Although the concentration of 1000 ppm inhibited completely pollen germination in A. majus and C. rapunculoides, it was not sufficient to suppress this process in E. californica and N. poeticus. Morphactin has a different effect on the percentage of germinated and ruptured pollen, tube length and its rate of growth. This effect was either inhibitory, neutral or stimulatory, depending on the morphactin concentration, the time of culture and species studied. The action of morphactin on the germination process is discussed.

  20. Ecology and Distribution of the Benthic Community on the Monterey Breakwater, Monterey, California.

    Science.gov (United States)

    1981-03-01

    further subdivisions (i.e. classes, families, orders) given IIfor clarity. The invertebrate keys found in Smith and Carltohi (1975) were used in making...insculupta and Bugula californica were the dominant invertebrates . There were fewer quadrats containing rubble on the inner transect than the outer...Numbers given in Appendix C P Present Numbers were impossible to determine 99 APPENDIX C SPECIES LIST ANIMALS PORIFERA DEMOSPONGIAE Halisarca §R. Found

  1. Dicty_cDB: SFG307 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .1 EST536061 P. infestans-challenged leaf Solanum tuberosum cDNA clone PPCBC84 5' sequence, mRNA sequence. 5...EST594838 P. infestans-challenged potato leaf, incompatible reaction Solanum tuberosum cDNA clone BPLI12N15 ...Eca01 Eschscholzia californica cDNA clone eca01-7ms1-f05 5', mRNA sequence. 72 1e-08 1 BQ045720 |BQ045720.1

  2. Monterey Peninsula Water Supply Project. Supplemental Draft Environmental Impact Report/Statement II. Appendices

    Science.gov (United States)

    1993-02-01

    chervil1 Aquilegia formosa var. hypolasia columbine 3 Arabis glabra var. glabra tower mustard Aralia californica elk clover Arenaria douglasii Douglas...and perennial herbs occupying permanently wet habitats in the River as well as pools, springs or seeps. Typical species are: Carex spp. (Sedge), Juncus...species include sedges ( Carex spp.), rushes (Juneus spp.), bulrush, and cat- tail (Typha spp.). At those points where the river bed is closest to the

  3. AcEST: BP920048 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CHLMU Putative uncharacterized protein OS=Chlam... 33 9.5 tr|Q3MJK8|Q3MJK8_9ANNE Cement protein 3B variant 2...tr|Q3MJK8|Q3MJK8_9ANNE Cement protein 3B variant 2 OS=Phragmatopoma californica PE=2 SV=1 Length = 306 Score...06 T S SS+ S +G S+ + P T H + T+ A RST Sbjct: 121 RTIPSPKTSSTSSMQGRLCTTSQQTVPLRGTPLTVSLPCPHLTQTNQATSRST 173 >

  4. The Effect of Acid Deposition on Potentially Sensitive Soil-Plant Systems at Vandenberg AFB, California.

    Science.gov (United States)

    1988-04-30

    Artemisia seedlings grown on the Tangair soil to accumulate more nitrogen and phosphorous in mixed culture. It may be that when soil fertility is low...S9* ~ *~. .* .** S- w~~ ~ ..... ’ , ~- - ~*%%*% 19. cont. Artemisia californica and Pinus muricata. A fourth study partially supported by this grant...the growth of and competition between two common woody plants- Artemisia califomnica and Pinus muricata. A fourth study partially supported by this

  5. Structural insights into substrate traffic and inhibition in acetylcholinesterase

    OpenAIRE

    Colletier, Jacques-Philippe,; Fournier, Didier; Greenblatt, Harry M.; Stojan, Jure; Sussman, Joel L.; Zaccai, Giuseppe; Silman, Israel; Weik, Martin

    2006-01-01

    Acetylcholinesterase (AChE) terminates nerve-impulse transmission at cholinergic synapses by rapid hydrolysis of the neurotransmitter, acetylcholine. Substrate traffic in AChE involves at least two binding sites, the catalytic and peripheral anionic sites, which have been suggested to be allosterically related and involved in substrate inhibition. Here, we present the crystal structures of Torpedo californica AChE complexed with the substrate acetylthiocholine, the product thiocholine and a n...

  6. Floral visitation by the Argentine ant reduces pollinator visitation and seed set in the coast barrel cactus, Ferocactus viridescens.

    Science.gov (United States)

    LeVan, Katherine E; Hung, Keng-Lou James; McCann, Kyle R; Ludka, John T; Holway, David A

    2014-01-01

    Mounting evidence indicates that trade-offs between plant defense and reproduction arise not only from resource allocation but also from interactions among mutualists. Indirect costs of plant defense by ants, for example, can outweigh benefits if ants deter pollinators. Plants can dissuade ants from occupying flowers, but such arrangements may break down when novel ant partners infiltrate mutualisms. Here, we examine how floral visitation by ants affects pollination services when the invasive Argentine ant (Linepithema humile) replaces a native ant species in a food-for-protection mutualism with the coast barrel cactus (Ferocactus viridescens), which, like certain other barrel cacti, produces extrafloral nectar. We compared the effects of floral visitation by the Argentine ant with those of the most prevalent native ant species (Crematogaster californica). Compared to C. californica, the Argentine ant was present in higher numbers in flowers. Cactus bees (Diadasia spp.), the key pollinators in this system, spent less time in flowers when cacti were occupied by the Argentine ant compared to when cacti were occupied by C. californica. Presumably as a consequence of decreased duration of floral visits by Diadasia, cacti occupied by L. humile set fewer seeds per fruit and produced fewer seeds overall compared to cacti occupied by C. californica. These data illustrate the importance of mutualist identity in cases where plants balance multiple mutualisms. Moreover, as habitats become increasingly infiltrated by introduced species, the loss of native mutualists and their replacement by non-native species may alter the shape of trade-offs between plant defense and reproduction.

  7. San Antonio Creek Restoration, Vandenberg Air Force Base, California

    Science.gov (United States)

    2008-06-27

    California brome Bromus carinatus 5 California poppy Eschscholzia californica 1 Toyon Heteromeles arbutifolia 2 Goldfields Lasthenia glabrara 1 Giant...Heart-podded hoary cress Bromus diandrus* Ripgut brome Leymus condensatus Giant wild-rye Bromus hordeaceus* Soft-chess brome Leymus triticoides...salicifolia Mule fat native FACW Brassica nigra Black mustard exotic UPL Brassica rapa Field mustard exotic UPL Bromus diandrus Ripgut brome exotic UPL

  8. Environmental Assessment: San Antonio Creek Restoration at Vandenberg Air Force Base, California

    Science.gov (United States)

    2008-09-08

    California brome Bromus carinatus 5 California poppy Eschscholzia californica 1 Toyon Heteromeles arbutifolia 2 Goldfields Lasthenia glabrara 1...NAME APPLICATION <LB/AC) COYOTE BUSH 3 CALIFORNIA BROME 6 CALIFORNIA POPPY 1 TO YON 2 GOLDFIELDS I GIANT 1,/ILD RYE 3 DOVE LUPINE 3 MIMULUS...Heart-podded hoary cress Bromus diandrus* Ripgut brome Leymus condensatus Giant wild-rye Bromus hordeaceus* Soft-chess brome Leymus triticoides

  9. Installation Restoration Program Records Search for McClellan Air Force Base, California.

    Science.gov (United States)

    1981-07-01

    were also observed at a number of locations on Magpie Creek. In regard to birds, game species such as pheasant, mourning dove, and California quail...of locations on Magpie Creek. In regard to birds, game species such as pheasant, mourning dove, and California quail are common on the site, though... Farewell -to-spring Clarkia purpurea Clarkia Clarkia unguiculata Willow herb Epilobium paniculatum Yellow water weed Jussiaea californica Water primrose

  10. A novel in vitro potency assay of antisera against Thai Naja kaouthia based on nicotinic acetylcholine receptor binding

    OpenAIRE

    Ratanabanangkoon, Kavi; Simsiriwong, Pavinee; Pruksaphon, Kritsada; Tan, Kae Yi; Eursakun, Sukanya; Tan, Choo Hock; Chantrathonkul, Bunkuea; Wongwadhunyoo, Wongsakorn; Youngchim, Sirida; Tan, Nget Hong

    2017-01-01

    Snake envenomation is an important medical problem. One of the hurdles in antivenom development is the in vivo assay of antivenom potency which is expensive, gives variable results and kills many animals. We report a novel in vitro assay involving the specific binding of the postsynaptic neurotoxins (PSNTs) of elapid snakes with purified Torpedo californica nicotinic acetylcholine receptor (nAChR). The potency of an antivenom is determined by its antibody ability to bind and neutralize the PS...

  11. Poblaciones de lombrices de tierra en sitios de acumulación de desechos orgánicos en el Valle Central de Costa Rica.

    Directory of Open Access Journals (Sweden)

    Sandra León

    2016-03-01

    Full Text Available A study was made on the density of earthworms in eight different sites of the Valle Central in Costa Rica, abundant with animal manure, city and coffee bean pulp wastes. Edaphological condition were determined in each site. Four species were found: Pontoscolex corethrurus, Metaphire californica, Amynthas corticis y Polypheretima elongata. P. corethrurus was the most abundant species found. Soils having abundant cattle manure were the most favorable for this species.

  12. An informational summary on elasmobranchs in Elkhorn Slough

    OpenAIRE

    Spratt, Jerome D.

    1994-01-01

    Shark angling derbies have been held in Elkhorn Slough since 1946, and archery derbies since about 1973. Elkhorn Slough is an important pupping and breeding area for leopard sharks, Triakis semifasciata, and bat rays, Myliobatis californica, and a spawning or nursery area for many other species of fish. With the establishment of the Monterey Bay National Marine Sanctuary, these derbies, especially the archery derby, have become somewhat controversial. Leopard sharks pup in late spring t...

  13. Dicty_cDB: VFE119 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 Homo sapiens cDNA clone IMAGE:4509608 5', mRNA sequence. 50 2e-08 2 CD477300 |CD477300.1 eca01-12ms1-h08 E...ca01 Eschscholzia californica cDNA clone eca01-12ms1-h08 5', mRNA sequence. 42 6e-05 2 CD476897 |CD476897.1 ...eca01-7ms1-c05 Eca01 Eschscholzia californica cDNA clone eca01-7ms1-c05 5', mRNA sequence. 42 6e-05 2 CD47...7145 |CD477145.1 eca01-14ms1-h01 Eca01 Eschscholzia californica cDNA clone eca01-14...ms1-h01 5', mRNA sequence. 42 7e-05 2 AY087862 |AY087862.1 Arabidopsis thaliana clone 39018 mRNA, complete sequence. 36 2e-04 3 CD47

  14. Short-term observational spatial memory in Jackdaws (Corvus monedula) and Ravens (Corvus corax).

    Science.gov (United States)

    Scheid, Christelle; Bugnyar, Thomas

    2008-10-01

    Observational spatial memory (OSM) refers to the ability of remembering food caches made by other individuals, enabling observers to find and pilfer the others' caches. Within birds, OSM has only been demonstrated in corvids, with more social species such as Mexican jays (Aphelocoma ultramarine) showing a higher accuracy of finding conspecific' caches than less social species such as Clark's nutcrackers (Nucifraga columbiana). However, socially dynamic corvids such as ravens (Corvus corax) are capable of sophisticated pilfering manoeuvres based on OSM. We here compared the performance of ravens and jackdaws (Corvus monedula) in a short-term OSM task. In contrast to ravens, jackdaws are socially cohesive but hardly cache and compete over food caches. Birds had to recover food pieces after watching a human experimenter hiding them in 2, 4 or 6 out of 10 possible locations. Results showed that for tests with two, four and six caches, ravens performed more accurately than expected by chance whereas jackdaws did not. Moreover, ravens made fewer re-visits to already inspected cache sites than jackdaws. These findings suggest that the development of observational spatial memory skills is linked with the species' reliance on food caches rather than with a social life style per se.

  15. Isolation and Identification of the Indigenous Yeast Population during Spontaneous Fermentation of Isabella (Vitis labrusca L.) Grape Must.

    Science.gov (United States)

    Raymond Eder, María L; Reynoso, Cristina; Lauret, Santiago C; Rosa, Alberto L

    2017-01-01

    Grape must harbors a complex community of yeast species responsible for spontaneous alcoholic fermentation. Although there are detailed studies on the microbiota of Vitis vinifera L. grapes, less is known about the diversity and behavior of yeast communities present on fermenting grape must from other species of Vitis. In this work, we used a culture-dependent method to study the identity and dynamics of the indigenous yeast population present during the spontaneous fermentation of Isabella (Vitis labrusca L.) grape must. Alcoholic fermentation was conducted using standard enological practices, and the associated non-Saccharomyces and S. cerevisiae yeast community was analyzed using selective growth media and 5.8-ITS DNA sequencing. Candida californica, Candida hellenica, Starmerella bacillaris (synonym Candida zemplinina), Hanseniaspora uvarum, and Hanseniaspora vineae were the main non-Saccharomyces species identified on Isabella fermenting must. Issatchenkia hanoiensis, a yeast species rarely found on Vitis vinifera L. grapes, was also recognized on Isabella grape must. Candida azymoides, Candida californica and Pichia cecembensis, identified in this work on Isabella fermenting must, have not previously been found on Vitis vinifera L. grape must. Interestingly, C. azymoides, I. hanoiensis and P. cecembensis have recently been isolated from the surface of Vitis labrusca L. grapes from vineyards in the Azores archipelago, suggesting that specific Vitis-yeast species associations are formed independently of geographic origin. We suggest that C. azymoides, C. californica, and P. cecembensis are yeast species preferentially associated with Vitis labrusca L. grapes. Specific biological interactions between grapevines and yeast species may underlie the assembly of differential Vitis-microbial communities.

  16. The Primary Sequence of Acetylcholinesterase and Selective Antibodies for the Detection of Organophosphate Toxicity

    Science.gov (United States)

    1989-11-30

    Gene Family. Sequence identities come from published sequences (refs. 12-18) and data for bovine AChE are from B.P. Doctor and reflect -85% of the...base, and incubated 2 h under N2 at 50’C with a 2-fold M excess of dithiothreitol over estimated total cysteine residues. To label cysteines, [14C] iodo ...californica acetylcholinesterase 8 by coupling to bovine serum albumin or encapsulation into liposomes containing lipid A as an adjuvant prior to immunization

  17. Dicty_cDB: Contig-U01797-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3345 ) G1146P335FP8.T0 Anolis carolinensis pooled normal... 34 7.3 2 ( GD222269 )... G1045P343FO15.T1 Aplysia californica Pooled Norma... 38 7.3 2 ( FG741400 ) G1145P325FG12.T0 Anolis caroline...nsis pooled norma... 34 7.5 2 ( FG741448 ) G1145P325RG12.T0 Anolis carolinensis pooled norma... 34 7.6 2 ( A...-48h Ilyanassa obso... 44 9.8 1 ( FG682010 ) G1143P327RC15.T0 Anolis carolinensis pooled norma... 44 9.8 1 >

  18. Central loop of non-conventional toxin WTX from Naja kaouthia is important for interaction with nicotinic acetylcholine receptors.

    Science.gov (United States)

    Lyukmanova, Ekaterina N; Shulepko, Mikhail A; Shenkarev, Zakhar O; Kasheverov, Igor E; Chugunov, Anton O; Kulbatskii, Dmitrii S; Myshkin, Mikhail Yu; Utkin, Yuri N; Efremov, Roman G; Tsetlin, Victor I; Arseniev, Alexander S; Kirpichnikov, Mikhail P; Dolgikh, Dmitry A

    2016-09-01

    'Three-finger' toxin WTX from Naja kaouthia interacts with nicotinic and muscarinic acetylcholine receptors (nAChRs and mAChRs). Mutagenesis and competition experiments with (125)I-α-bungarotoxin revealed that Arg31 and Arg32 residues from the WTX loop II are important for binding to Torpedo californica and human α7 nAChRs. Computer modeling suggested that loop II occupies the orthosteric binding site at α7 nAChR. The similar toxin interface was previously described as a major determinant of allosteric interactions with mAChRs. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. Ecdysone receptor homologs from mollusks, leeches and a polychaete worm.

    Science.gov (United States)

    Laguerre, Michel; Veenstra, Jan A

    2010-11-05

    The genomes of the mollusk Lottia gigantea, the leech Helobdella robusta and the polychaete worm Capitella teleta each have a gene encoding an ecdysone receptor homolog. Publicly available genomic and EST sequences also contain evidence for ecdysone receptors in the seahare Aplysia californica, the bobtail squid Euprymna scolopes and the medicinal leech Hirudo medicinalis. Three-dimensional models of the ligand binding domains of these predicted ecdysone receptor homologs suggest that each of them could potentially bind an ecdysone-related steroid. Thus, ecdysone receptors are not limited to arthropods and nematodes. Copyright © 2010 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

  20. Morphological and chemical characteristics of fruits of selected Rosa sp.

    Directory of Open Access Journals (Sweden)

    Agnieszka Najda

    2013-04-01

    Full Text Available The aim of this study was to evaluate the morphological and chemical parameters, antioxidant activity (DPPH of five rose species (Rosa rugosa, R. villosa, R. californica, R. spinosissima, and R. × damascene and grouping them according to the harvest date. On the basis of the study, rose species grown in eastern Poland were grouped according to their harvest time, and three dates of cumulative ripeness of pseudofruits were distinguished. Rosehips of studied species varied referring to their harvest date and morphological properties and were characterized by diverse contents of primary metabolites analyzed. In addition, obtained extracts showed high antioxidant activity, which has a significant impact on their value for processing.

  1. Dicty_cDB: VSB780 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence; clone TBT6B09; 5' end; Similar to ribosomal protein S17 ; Homo sapiens. 34 0.007 3 CD477300 |CD47... mRNA sequence. 42 0.008 2 CD476897 |CD476897.1 eca01-7ms1-c05 Eca01 Eschscholzia californica cDNA clone eca...01-7ms1-c05 5', mRNA sequence. 42 0.008 2 CD477145 |CD477145.1 eca01-14ms1-h01 Ec

  2. Chronic N enrichment and drought alter plant cover and community composition in a Mediterranean-type semi-arid shrubland.

    Science.gov (United States)

    Vourlitis, George L

    2017-05-01

    Anthropogenic nitrogen (N) deposition has caused a decline in native plant species and an increase in exotic plant species in many terrestrial ecosystems; however, vegetation change depends on the rate and/or duration of N input, individual species responses, interactions with other resources, and ecosystem properties such as species richness and canopy cover, soil texture, pH, and/or disturbance regime. Native shrub and exotic forb responses to N enrichment were evaluated over a 13-year field experiment in a mature coastal sage scrub (CSS) shrubland of southern California to test the hypothesis that dry-season N input will cause a decline in native shrubs and an increase in exotic annuals. Nitrogen enrichment caused the dominant native shrubs, Artemisia californica and Salvia mellifera, to respond differently, with A. californica initially increasing with N input but declining thereafter and S. mellifera declining consistently over the 13-year-period. Both species exhibited higher canopy dieback during drought conditions, especially in N plots. Brassica nigra, an exotic annual, invaded N plots significantly more than control plots, but only after 10 years of N addition and a prolonged drought, which increased native shrub canopy dieback. These results indicate a possible synergism between N enrichment and drought on native shrub and exotic forb abundance, which would have important implications for plant diversity in semi-arid shrublands of southwest US that are anticipated to experience an increase in anthropogenic N enrichment and the frequency and duration of drought.

  3. The artisanal elasmobranch fishery of the Pacific coast of Baja California Sur, Mexico, management implications

    Directory of Open Access Journals (Sweden)

    Sergio R. Ramirez-Amaro

    2013-09-01

    Full Text Available Artisanal fisheries in Mexico account for approximately 40% of the total national catch. In 2009, Baja California Sur (BCS had the second largest catch of elasmobranchs on the Mexican Pacific coast. This paper characterizes and describes the artisanal elasmobranch fishery of Pacific coast of BCS from 2000 to 2010. Sixty artisanal camps were documented, of which 45 targeted elasmobranchs, using primarily gillnets and longlines. We identified 52 elasmobranch species. Gillnetting accounted for 73.5% of the fishing effort and most frequently captured Rhinobatos productus, Mustelus henlei and Myliobatis californica. Longline fishing accounted for 26.5% of effort, most frequently capturing Prionace glauca and Isurus oxyrinchus. The prevalence of juveniles of several species (e.g., Cephaloscyllium ventriosum, Galeorhinus galeus, Isurus oxyrinchus, and Myliobatis californica within landings suggests that fishing effort may be opportunistically directed at breeding or nursery areas. Despite the dominance of species with wide distributions, we observed a significant biogeographic pattern in the abundance of some species relative to Bahia Magdalena. Results of the present study will be useful to detect changes in the structure of commercially exploited elasmobranch populations, and to provide useful indications for management purposes.

  4. Science foundation Chapter 5 Appendix 5.1: Case study marsh macroinvertebrates

    Science.gov (United States)

    Brusati, Elizabeth; Woo, Isa

    2015-01-01

    This case study includes representative macroinvertebrates that live in the marsh plain, its associated channels and pannes (ponds), and the marsh-upland transition zone. While less visible than animals such as birds, invertebrates play important roles in physical and biological processes (e.g., burrowing activity and channel bank erosion, and detritivores breaking down organic matter) and are important food resources for higher trophic animals. Common invertebrates in these habitats include plant-hopper (Prokelisia marginata), beach hopper (Traskorchestia traskiana), pygmy blue butterfly (Brephidium exilis), inchworm moth (Perizoma custodiata), western tanarthus beetle (Tanarthus occidentalis), salt marsh mosquitoes (Aedes spp.; Maffei 2000a, Maffei 2000b, Maffei 2000c), crabs (native Hemigrapsus oregonensis and introduced Carcinus maenas), copepods, snails (e.g. native California horn snail Cerithidea californica and introduced Ilyanassa obsoleta, Myosotella myosotis), polychaetes (e.g. Capitella spp., Eteone californica, Neanthes brandti), small clams (Macoma petalum/M. balthica), and corophiid amphipods (Cohen 2011, Race 1982, Robinson et al. 2011). Some common species were described in detail in the San Francisco Bay Goals Project Species and Community Profiles (Goals Project 2000).

  5. Dicty_cDB: VSF388 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9081 |BG259081.1 602379133F1 NIH_MGC_92 Homo sapiens cDNA clone IMAGE:4509608 5', mRNA sequence. 50 2e-08 2 CD477300 |CD47...7300.1 eca01-12ms1-h08 Eca01 Eschscholzia californica cDNA clone eca01-12ms1-h08 5', mRNA sequence. 42 6e-05 2 CD47...6897 |CD476897.1 eca01-7ms1-c05 Eca01 Eschscholzia californica cDNA clone eca01-7ms1-c0...5 5', mRNA sequence. 42 6e-05 2 CD477145 |CD477145.1 eca01-14ms1-h01 Eca01 Eschsc... thaliana clone 39018 mRNA, complete sequence. 36 1e-04 3 CD477559 |CD477559.1 eca01-11ms1-h08 Eca01 Eschsch

  6. Interaction of acetic acid and phenylacetaldehyde as attractants for trapping pest species of moths (Lepidoptera: Noctuidae).

    Science.gov (United States)

    Landolt, Peter J; Tóth, Miklós; Meagher, Robert L; Szarukán, István

    2013-02-01

    Phenylacetaldehyde is a flower volatile and attractant for many nectar-seeking moths. Acetic acid is a microbial fermentation product that is present in insect sweet baits. It is weakly attractive to some moths and other insects, but can be additive or synergistic with other compounds to make more powerful insect lures. Acetic acid and phenylacetaldehyde presented together in traps made a stronger lure than either chemical alone for moths of the alfalfa looper Autographa californica (Speyer) and the armyworm Spodoptera albula (Walker). However, this combination of chemicals reduced captures of the cabbage looper moth Trichoplusia ni (Hübner), the silver Y moth Autographa gamma (L.), MacDunnoughia confusa (Stephens) and the soybean looper moth Chrysodeixis includens (Walker) by comparison with phenylacetaldehyde alone. These results indicate both positive and negative interactions of acetic acid, a sugar fermentation odor cue, and phenylacetaldehyde, a floral scent cue, in eliciting orientation responses of moths. This research provides a new two-component lure for the alfalfa looper A. californica and for the armyworm S. albula for potential use in pest management. Copyright © 2012 Society of Chemical Industry.

  7. Operant conditioning in invertebrates.

    Science.gov (United States)

    Brembs, Björn

    2003-12-01

    Learning to anticipate future events on the basis of past experience with the consequences of one's own behavior (operant conditioning) is a simple form of learning that humans share with most other animals, including invertebrates. Three model organisms have recently made significant contributions towards a mechanistic model of operant conditioning, because of their special technical advantages. Research using the fruit fly Drosophila melanogaster implicated the ignorant gene in operant conditioning in the heat-box, research on the sea slug Aplysia californica contributed a cellular mechanism of behavior selection at a convergence point of operant behavior and reward, and research on the pond snail Lymnaea stagnalis elucidated the role of a behavior-initiating neuron in operant conditioning. These insights demonstrate the usefulness of a variety of invertebrate model systems to complement and stimulate research in vertebrates.

  8. Development of a high specific activity radioligand, /sup 125/I-LSD, and its application to the study of serotonin receptors

    Energy Technology Data Exchange (ETDEWEB)

    Kadan, M.J.

    1987-01-01

    /sup 125/I-Labeled receptor ligands can be synthesized with specific activities exceeding 2000 Ci/mmol, making them nearly 70-fold more sensitive in receptor site assays than (mono) tritiated ligands. We have synthesized and characterized /sup 125/I-lysergic acid diethylamide (/sup 125/I-LSD), the first radioiodinated ligand for serotonin receptor studies. The introduction of /sup 125/I at the 2 position of LSD increased both the affinity and selectivity of this compound for serotonin 5-HT/sub 2/ receptors in rat cortex. The high specific activity of /sup 125/I-LSD and its high ratio of specific to nonspecific binding make this ligand especially useful for autoradiographic studies of serotonin receptor distribution. We have found that /sup 125/I-LSD binds with high affinity to a class of serotonin receptors in the CNS of the marine mollusk Aplysia californica.

  9. Exploring sub-lethal effects of exposure to a nucleopolyhedrovirus in the speckled wood (Pararge aegeria) butterfly.

    Science.gov (United States)

    Hesketh, Helen; Gibbs, Melanie; Breuker, Casper J; Van Dyck, Hans; Turner, Emma; Hails, Rosemary S

    2012-01-01

    This study investigated the sub-lethal effects of larval exposure to baculovirus on host life history and wing morphological traits using a model system, the speckled wood butterfly Pararge aegeria (L.) and the virus Autographa californica nucleopolyhedrovirus. Males and females showed similar responses to the viral infection. Infection significantly reduced larval growth rate, whilst an increase in development time allowed the critical mass for pupation to be attained. There was no direct effect of viral infection on the wing morphological traits examined. There was, however, an indirect effect of resisting infection; larvae that took longer to develop had reduced resource investment in adult flight muscle mass. Crown Copyright © 2011. Published by Elsevier Inc. All rights reserved.

  10. AcEST: BP919227 [AcEST

    Lifescience Database Archive (English)

    Full Text Available m disc... 38 0.30 tr|B4NCJ2|B4NCJ2_DROWI GK25865 OS=Drosophila willistoni GN=GK258... 37 0.40 tr|Q3MJK9|Q3MJK9_9ANNE Cement...acterized protein OS=Dicty... 35 2.0 tr|Q3MJK8|Q3MJK8_9ANNE Cement protein 3B var...LLESSQSTYARYETSN*STTSKHT 470 + SR +SS S+ +R+ +S+ + SKH+ Sbjct: 156 SSSSRDKRRSDHKSSSSSSSRHSSSSSPSKSKHS 189 >tr|Q3MJK9|Q3MJK9_9ANNE Cem...ent protein 3B variant 1 OS=Phragmatopoma californica PE=2 SV=1 Length = 341 Score

  11. AcEST: DK954556 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q3MJK9 Definition tr|Q3MJK9|Q3MJK9_9ANNE Cement protein 3B variant 1 OS=Phragmatopoma californica Align len...ing significant alignments: (bits) Value tr|Q3MJK9|Q3MJK9_9ANNE Cement protein 3B variant 1 OS=Phragmatop...... 46 0.002 tr|Q3MJK8|Q3MJK8_9ANNE Cement protein 3B variant 2 OS=Phragmatop... 44 ...0.012 tr|Q3MJK7|Q3MJK7_9ANNE Cement protein 3B variant 3 OS=Phragmatop... 43 0.016 tr|Q6CF27|Q6CF27_YARLI YA...uncharacterized protein OS=Oryza... 34 9.4 tr|Q3MJL2|Q3MJL2_9ANNE Cement protein 3A variant 1 OS=Phragmatop.

  12. A baculovirus-conjugated mimotope vaccine targeting Mycobacterium tuberculosis lipoarabinomannan.

    Science.gov (United States)

    Shin, Hyun-Jin; Franco, Luis H; Nair, Vidhya R; Collins, Angela C; Shiloh, Michael U

    2017-01-01

    Mycobacterium tuberculosis, the causative agent of tuberculosis, is a major cause of morbidity and mortality worldwide. However, an effective vaccine for M. tuberculosis is lacking. We panned a phage display library using monoclonal antibodies against M. tuberculosis liporabinomannan (LAM), an important component of the M. tuberculosis cell wall, and identified two peptide sequences, HSFKWLDSPRLR or SGVYKVAYDWQH, with high antibody affinity after multiple rounds of panning. Only the HSFKWLDSPRLR peptide induced an anti-LAM response when conjugated to either keyhole limpet hemocyanin (KLH) or to the baculovirus Autographa californica multicapsid nucleopolyherovirus (AcMNPV) when introduced into mice by injection or via intranasal inoculation, respectively. Vaccination with AcMNPV conjugated HSFKWLDSPRLR peptide delayed mortality in a mouse model of tuberculosis. Thus, we report a proof of principle M. tuberculosis vaccination strategy combining an anti-LAM mimotope with a baculovirus delivery system.

  13. Abundant synthesis of functional human T-cell leukemia virus type I p40x protein in eucaryotic cells by using a baculovirus expression vector.

    Science.gov (United States)

    Jeang, K T; Giam, C Z; Nerenberg, M; Khoury, G

    1987-01-01

    The human T-cell leukemia virus type I (HTLV-I) p40x protein is a 40-kilodalton polypeptide encoded in the 3'-terminal region of the virus. This protein is responsible for positive transcriptional trans-activation of promoter elements located within the HTLV-I long terminal repeat. We introduced the protein-coding region of HTLV-I p40x into the genome of the baculovirus Autographa californica nuclear polyhedrosis virus. After infection of the insect Spodoptera frugiperda (SF9) cell line, this recombinant strain of baculovirus produced approximately 200 mg of intact p40x protein per 2.5 X 10(8) cells. The protein was biologically active in trans-activation of an HTLV-I long terminal repeat-human beta-globin construct. Biochemical analyses of the protein suggest that the p40x polypeptide underwent posttranslational modification in these eucaryotic SF9 cells. Images PMID:3027397

  14. Establishment and characterization of a cell line developed from the neonate larvae of Papilio demoleus Linnaeus (Lepidoptera: Papilionidae).

    Science.gov (United States)

    Ding, Wei-Feng; Feng, Ying; Zhang, Xin; Li, Xian; Wang, Cheng-Ye

    2013-02-01

    A new cell line named RIRI-PaDe, developed from the neonate larvae of Papilio demoleus Linnaeus, was established in modified Grace's medium supplemented with 20% fetal bovine serum. The cell line was incubated at 28°C and consisted of attached round and short spindle-like cells. The population doubling time was 55 h. The chromosome numbers varied widely from 24 to 136 with a mode of 59 at the 71st passage. Comparison of mitochondrial cytochrome c oxidase subunit I gene of the cell line and neonate larvae confirmed that the cell line was of P. demoleus origin. This cell line was susceptible to the Autographa californica multicapsid nucleopolyhedrovirus and Apocheima cinerarius nucleopolyhedrovirus.

  15. An Expedient Synthesis, Acetylcholinesterase Inhibitory Activity, and Molecular Modeling Study of Highly Functionalized Hexahydro-1,6-naphthyridines

    Directory of Open Access Journals (Sweden)

    Abdulrahman I. Almansour

    2015-01-01

    Full Text Available A series of hexahydro-1,6-naphthyridines were synthesized in good yields by the reaction of 3,5-bis[(E-arylmethylidene]tetrahydro-4(1H-pyridinones with cyanoacetamide in the presence of sodium ethoxide under simple mixing at ambient temperature for 6–10 minutes and were assayed for their acetylcholinesterase (AChE inhibitory activity using colorimetric Ellman’s method. Compound 4e with methoxy substituent at ortho-position of the phenyl rings displayed the maximum inhibitory activity with IC50 value of 2.12 μM. Molecular modeling simulation of 4e was performed using three-dimensional structure of Torpedo californica AChE (TcAChE enzyme to disclose binding interaction and orientation of this molecule into the active site gorge of the receptor.

  16. An expedient synthesis, acetylcholinesterase inhibitory activity, and molecular modeling study of highly functionalized hexahydro-1,6-naphthyridines.

    Science.gov (United States)

    Almansour, Abdulrahman I; Kumar, Raju Suresh; Arumugam, Natarajan; Basiri, Alireza; Kia, Yalda; Ali, Mohamed Ashraf

    2015-01-01

    A series of hexahydro-1,6-naphthyridines were synthesized in good yields by the reaction of 3,5-bis[(E)-arylmethylidene]tetrahydro-4(1H)-pyridinones with cyanoacetamide in the presence of sodium ethoxide under simple mixing at ambient temperature for 6-10 minutes and were assayed for their acetylcholinesterase (AChE) inhibitory activity using colorimetric Ellman's method. Compound 4e with methoxy substituent at ortho-position of the phenyl rings displayed the maximum inhibitory activity with IC50 value of 2.12 μM. Molecular modeling simulation of 4e was performed using three-dimensional structure of Torpedo californica AChE (TcAChE) enzyme to disclose binding interaction and orientation of this molecule into the active site gorge of the receptor.

  17. Dicty_cDB: VFG881 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BG259081.1 602379133F1 NIH_MGC_92 Homo sapiens cDNA clone IMAGE:4509608 5', mRNA sequence. 50 5e-08 2 CD477300 |CD47...7300.1 eca01-12ms1-h08 Eca01 Eschscholzia californica cDNA clone eca01-12ms1-h08 5', mRNA sequence. 42 1e-04 2 CD476897 |CD4... mRNA sequence. 42 1e-04 2 CD477145 |CD477145.1 eca01-14ms1-h01 Eca01 Eschscholzi...iana clone 39018 mRNA, complete sequence. 36 3e-04 3 CD477559 |CD477559.1 eca01-11ms1-h08 Eca01 Eschscholzia

  18. Dicty_cDB: VSC806 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Lib2 Cryptosporidium parvum cDNA 5' similar to 40S ribosomal protein S17A, mRNA sequence. 46 1e-05 3 CD477300 |CD47...7300.1 eca01-12ms1-h08 Eca01 Eschscholzia californica cDNA clone eca01-12ms1-h08 5', mRNA sequence. 42 1e-05 2 CD476897 |CD47... clone eca01-7ms1-c05 5', mRNA sequence. 42 1e-05 2 CD477145 |CD477145.1 eca01-14ms1-h01 Eca01 Eschscholzia ...PRL2 Arabidopsis thaliana cDNA clone 180B22T7, mRNA sequence. 36 1e-04 3 CD477559 |CD477559.1 eca01-11ms1-h0

  19. Dicty_cDB: VSD873 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Cryptosporidium parvum cDNA 5' similar to 40S ribosomal protein S17A, mRNA sequence. 46 1e-05 3 CD477300 |CD47...7300.1 eca01-12ms1-h08 Eca01 Eschscholzia californica cDNA clone eca01-12ms1-h08 5', mRNA sequence. 42 1e-05 2 CD476897 |CD47...e eca01-7ms1-c05 5', mRNA sequence. 42 1e-05 2 CD477145 |CD477145.1 eca01-14ms1-h01 Eca01 Eschscholzia calif...Arabidopsis thaliana cDNA clone 180B22T7, mRNA sequence. 36 1e-04 3 CD477559 |CD477559.1 eca01-11ms1-h08 Eca

  20. Dicty_cDB: VSG239 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available OWAsporoLib2 Cryptosporidium parvum cDNA 5' similar to 40S ribosomal protein S17A, mRNA sequence. 44 0.003 2 CD477300 |CD47...7300.1 eca01-12ms1-h08 Eca01 Eschscholzia californica cDNA clone eca01-12ms1-h08 5', mRNA sequence. 42 0.011 2 CD47...6897 |CD476897.1 eca01-7ms1-c05 Eca01 Eschscholzia californ...haliana cDNA clone 180B22T7, mRNA sequence. 36 0.013 3 CD477145 |CD477145.1 eca01-14ms1-h01 Eca01 Eschscholz

  1. Phytolith assemblages in grasses native to central Argentina.

    Science.gov (United States)

    Gallego, Lucrecia; Distel, Roberto A

    2004-12-01

    Phytolith reference collections are a prerequisite for accurate interpretation of soil phytolith assemblages aimed at reconstructing past vegetation. In this study a phytolith reference collection has been developed for several grasses native to central Argentina: Poa ligularis, Piptochaetium napostaense, Stipa clarazii, Stipa tenuis, Stipa tenuissima, Stipa eriostachya, Stipa ambigua, Stipa brachychaeta, Pappophorum subbulbosum, Digitaria californica, Bothriochloa edwardsiana and Aristida subulata. For each species, phytoliths present in the leaf blades were classified into 47 morphotypes, and their relative frequency determined by observing 300-400 phytoliths per sample (n = 5). Data were analyzed by complete linkage cluster analysis, using the Morisita Index as measure of association. The results showed differentiation among phytolith assemblages at species level or at plant functional type level. Cluster analysis separated C3 from C4 species and palatable from non-palatable species. This study highlights the possibility of reconstructing past vegetation in central Argentina grasslands through the analysis of soil phytolith assemblages.

  2. Genome of Thysanoplusia orichalcea multiple nucleopolyhedrovirus lacks the superoxide dismutase gene.

    Science.gov (United States)

    Wang, Yun-Sheng; Huang, Guo-Hua; Cheng, Xin-Hua; Wang, Xing; Garretson, Tyler A; Dai, Liang-Ying; Zhang, Chuan-Xi; Cheng, Xiao-Wen

    2012-11-01

    Thysanoplusia orichalcea multiple nucleopolyhedrovirus (ThorMNPV) has high virulence to Trichoplusia ni and Pseudoplusia includens larvae, with a potential for biological control of insect pests. The genome of ThorMNPV was sequenced and found to be 132,978 bp, with a G+C content of 37.9%. There are 145 predicted open reading frames (ORFs), encoding proteins of 50 or more amino acid residues with minimal overlap. Of the 145 ORFs, 141 appeared to be homologous to those of Autographa californica MNPV (AcMNPV). In comparison to AcMNPV, 9 ORFs of AcMNPV were absent in ThorMNPV, including the superoxide dismutase (sod) gene.

  3. Effects of five southern California macroalgal diets on consumption, growth, and gonad weight, in the purple sea urchin Strongylocentrotus purpuratus.

    Science.gov (United States)

    Foster, Matthew C; Byrnes, Jarrett E K; Reed, Daniel C

    2015-01-01

    Consumer growth and reproductive capacity are direct functions of diet. Strongylocentrotid sea urchins, the dominant herbivores in California kelp forests, strongly prefer giant kelp (Macrocystis pyrifera), but are highly catholic in their ability to consume other species. The biomass of Macrocystis fluctuates greatly in space and time, and the extent to which urchins can use alternate species of algae or a mixed diet of multiple algal species to maintain fitness when giant kelp is unavailable is unknown. We experimentally examined the effects of single and mixed species diets on consumption, growth and gonad weight in the purple sea urchin Strongylocentrotus purpuratus. Urchins were fed single species diets consisting of one of four common species of macroalgae (the kelps Macrocystis pyrifera and Pterygophora californica, and the red algae Chondracanthus corymbiferus and Rhodymenia californica (hereafter referred to by genus)) or a mixed diet containing all four species ad libitum over a 13-week period in a controlled laboratory setting. Urchins fed Chondracanthus, Macrocystis and a mixed diet showed the highest growth (in terms of test diameter, wet weight and jaw length) and gonad weight, while urchins fed Pterygophora and Rhodymenia showed the lowest. Urchins consumed their preferred food, Macrocystis, at the highest rate when offered a mixture, but consumed Chondracanthus or Macrocystis at similar rates when the two algae were offered alone. The differences in urchin feeding behavior and growth observed between these diet types suggest the relative availability of the algae tested here could affect urchin populations and their interactions with the algal assemblage. The fact that the performance of urchins fed Chondracanthus was similar or higher than those fed the preferred Macrocystis suggests that the availability of the former could could sustain growth and reproduction of purple sea urchins during times of low Macrocystis abundance as is common following

  4. Influence of land-cover change on the spread of an invasive forest pathogen.

    Science.gov (United States)

    Meentemeyer, Ross K; Rank, Nathan E; Anacker, Brian L; Rizzo, David M; Cushman, J Hall

    2008-01-01

    Human-caused changes in land use and land cover have dramatically altered ecosystems worldwide and may facilitate the spread of infectious diseases. To address this issue, we examined the influence of land-cover changes between 1942 and 2000 on the establishment of an invasive pathogen, Phytophthora ramorum, which causes the forest disease known as Sudden Oak Death. We assessed effects of land-cover change, forest structure, and understory microclimate on measures of inoculum load and disease prevalence in 102 15 x 15 m plots within a 275-km2 region in northern California. Within a 150 m radius area around each plot, we mapped types of land cover (oak woodland, chaparral, grassland, vineyard, and development) in 1942 and 2000 using detailed aerial photos. During this 58-year period, oak woodlands significantly increased in area by 25%, while grassland and chaparral decreased by 34% and 51%, respectively. Analysis of covariance revealed that vegetation type in 1942 and woodland expansion were significant predictors of pathogen inoculum load in bay laurel (Umbellularia californica), the primary inoculum-producing host for P. ramorum in mixed evergreen forests. Path analysis showed that woodland expansion resulted in larger forests with higher densities of the primary host trees (U. californica, Quercus agrifolia, Q. kelloggii) and cooler understory temperatures. Together, the positive effects of woodland size and negative effects of understory temperature explained significant variation in inoculum load and disease prevalence in bay laurel; host stem density had additional positive effects on inoculum load. We conclude that enlargement of woodlands and closure of canopy gaps, likely due largely to years of fire suppression, facilitated establishment of P. ramorum by increasing the area occupied by inoculum-production foliar hosts and enhancing forest microclimate conditions. Epidemiological studies that incorporate land-use change are rare but may increase

  5. Eps homology domain endosomal transport proteins differentially localize to the neuromuscular junction

    Directory of Open Access Journals (Sweden)

    Mate Suzanne E

    2012-09-01

    Full Text Available Abstract Background Recycling of endosomes is important for trafficking and maintenance of proteins at the neuromuscular junction (NMJ. We have previously shown high expression of the endocytic recycling regulator Eps15 homology domain-containing (EHD1 proteinin the Torpedo californica electric organ, a model tissue for investigating a cholinergic synapse. In this study, we investigated the localization of EHD1 and its paralogs EHD2, EHD3, and EHD4 in mouse skeletal muscle, and assessed the morphological changes in EHD1−/− NMJs. Methods Localization of the candidate NMJ protein EHD1 was assessed by confocal microscopy analysis of whole-mount mouse skeletal muscle fibers after direct gene transfer and immunolabeling. The potential function of EHD1 was assessed by specific force measurement and α-bungarotoxin-based endplate morphology mapping in EHD1−/− mouse skeletal muscle. Results Endogenous EHD1 localized to primary synaptic clefts of murine NMJ, and this localization was confirmed by expression of recombinant green fluorescent protein labeled-EHD1 in murine skeletal muscle in vivo. EHD1−/− mouse skeletal muscle had normal histology and NMJ morphology, and normal specific force generation during muscle contraction. The EHD 1–4 proteins showed differential localization in skeletal muscle: EHD2 to muscle vasculature, EHD3 to perisynaptic regions, and EHD4 to perinuclear regions and to primary synaptic clefts, but at lower levels than EHD1. Additionally, specific antibodies raised against mammalian EHD1-4 recognized proteins of the expected mass in the T. californica electric organ. Finally, we found that EHD4 expression was more abundant in EHD1−/− mouse skeletal muscle than in wild-type skeletal muscle. Conclusion EHD1 and EHD4 localize to the primary synaptic clefts of the NMJ. Lack of obvious defects in NMJ structure and muscle function in EHD1−/− muscle may be due to functional compensation by other EHD paralogs.

  6. Ulva (Chlorophyta, Ulvales) Biodiversity in the North Adriatic Sea (Mediterranean, Italy): Cryptic Species and New Introductions.

    Science.gov (United States)

    Wolf, Marion A; Sciuto, Katia; Andreoli, Carlo; Moro, Isabella

    2012-12-01

    Ulva Linnaeus (Ulvophyceae, Ulvales) is a genus of green algae widespread in different aquatic environments. Members of this genus show a very simple morphology and a certain degree of phenotypic plasticity, heavily influenced by environmental conditions, making difficult the delineation of species by morphological features alone. Most studies dealing with Ulva biodiversity in Mediterranean waters have been based only on morphological characters and a modern taxonomic revision of this genus in the Mediterranean is not available. We report here the results of an investigation on the diversity of Ulva in the North Adriatic Sea based on molecular analyses. Collections from three areas, two of which subject to intense shipping traffic, were examined, as well as historical collections of Ulva stored in the Herbarium Patavinum of the University of Padova, Italy. Molecular analyses based on partial sequences of the rbcL and tufA genes revealed the presence of six different species, often with overlapping morphologies: U. californica Wille, U. flexuosa Wulfen, U. rigida C. Agardh, U. compressa Linnaeus, U. pertusa Kjellman, and one probable new taxon. U. californica is a new record for the Mediterranean and U. pertusa is a new record for the Adriatic. Partial sequences obtained from historical collections show that most of the old specimens are referable to U. rigida. No specimens referable to the two alien species were found among the old herbarium specimens. The results indicate that the number of introduced seaweed species and their impact on Mediterranean communities have been underestimated, due to the difficulties in species identification of morphologically simple taxa as Ulva. © 2012 Phycological Society of America.

  7. Transcriptome analysis of the central nervous system of the mollusc Lymnaea stagnalis

    Directory of Open Access Journals (Sweden)

    Coorssen JR

    2009-09-01

    Full Text Available Abstract Background The freshwater snail Lymnaea stagnalis (L. stagnalis has served as a successful model for studies in the field of Neuroscience. However, a serious drawback in the molecular analysis of the nervous system of L. stagnalis has been the lack of large-scale genomic or neuronal transcriptome information, thereby limiting the use of this unique model. Results In this study, we report 7,712 distinct EST sequences (median length: 847 nucleotides of a normalized L. stagnalis central nervous system (CNS cDNA library, resulting in the largest collection of L. stagnalis neuronal transcriptome data currently available. Approximately 42% of the cDNAs can be translated into more than 100 consecutive amino acids, indicating the high quality of the library. The annotated sequences contribute 12% of the predicted transcriptome size of 20,000. Surprisingly, approximately 37% of the L. stagnalis sequences only have a tBLASTx hit in the EST library of another snail species Aplysia californica (A. californica even using a low stringency e-value cutoff at 0.01. Using the same cutoff, approximately 67% of the cDNAs have a BLAST hit in the NCBI non-redundant protein and nucleotide sequence databases (nr and nt, suggesting that one third of the sequences may be unique to L. stagnalis. Finally, using the same cutoff (0.01, more than half of the cDNA sequences (54% do not have a hit in nematode, fruitfly or human genome data, suggesting that the L. stagnalis transcriptome is significantly different from these species as well. The cDNA sequences are enriched in the following gene ontology functional categories: protein binding, hydrolase, transferase, and catalytic enzymes. Conclusion This study provides novel molecular insights into the transcriptome of an important molluscan model organism. Our findings will contribute to functional analyses in neurobiology, and comparative evolutionary biology. The L. stagnalis CNS EST database is available at http://www.Lymnaea.org/.

  8. Functional validation of Ca2+-binding residues from the crystal structure of the BK ion channel.

    Science.gov (United States)

    Kshatri, Aravind S; Gonzalez-Hernandez, Alberto J; Giraldez, Teresa

    2018-04-01

    BK channels are dually regulated by voltage and Ca 2+ , providing a cellular mechanism to couple electrical and chemical signalling. Intracellular Ca 2+ concentration is sensed by a large cytoplasmic region in the channel known as "gating ring", which is formed by four tandems of regulator of conductance for K + (RCK1 and RCK2) domains. The recent crystal structure of the full-length BK channel from Aplysia californica has provided new information about the residues involved in Ca 2+ coordination at the high-affinity binding sites located in the RCK1 and RCK2 domains, as well as their cooperativity. Some of these residues have not been previously studied in the human BK channel. In this work we have investigated, through site directed mutagenesis and electrophysiology, the effects of these residues on channel activation by voltage and Ca 2+ . Our results demonstrate that the side chains of two non-conserved residues proposed to coordinate Ca 2+ in the A. californica structure (G523 and E591) have no apparent functional role in the human BK Ca 2+ sensing mechanism. Consistent with the crystal structure, our data indicate that in the human channel the conserved residue R514 participates in Ca 2+ coordination in the RCK1 binding site. Additionally, this study provides functional evidence indicating that R514 also interacts with residues E902 and Y904 connected to the Ca 2+ binding site in RCK2. Interestingly, it has been proposed that this interaction may constitute a structural correlate underlying the cooperative interactions between the two high-affinity Ca 2+ binding sites regulating the Ca 2+ dependent gating of the BK channel. This article is part of a Special Issue entitled: Beyond the Structure-Function Horizon of Membrane Proteins edited by Ute Hellmich, Rupak Doshi and Benjamin McIlwain. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Adult pollen diet essential for egg maturation by a solitary Osmia bee.

    Science.gov (United States)

    Cane, James H

    2016-12-01

    Reproduction is a nutritionally costly activity for many insects, as their eggs are rich in lipids and proteins. That cost seems especially acute for non-social bees, which for their size, lay enormous eggs. All adult female bees visit flowers, most of them to collect pollen and nectar, or sometimes oils, to feed their progeny. For adult bees, the need for pollen feeding has only been detailed for the honey bee, Apis mellifera. To experimentally test for the reproductive value of adult pollen feeding by a non-social bee, Osmia californica (Hymenoptera: Apiformes: Megachilidae), young female bees plus males were released into large glasshouse cages provided with either a male-fertile sunflower cultivar or a pollen-less one. Females regularly visited and drank nectar from flowers of both cultivars. Abundant orange pollen was seen regularly in guts of females confined with the male-fertile sunflowers, indicative of active pollen ingestion. All females' terminal oocytes (next egg to be laid) were small at emergence. Oocytes of females confined with the pollen-less sunflowers remained small, despite frequent nectaring and exposure to other floral stimuli. In contrast, the basal oocytes of female O. californica with access to pollen had swelled to full size within ten days following emergence, enabling them to lay eggs in provided nest tubes. Adult females of this solitary bee required dietary pollen to reproduce; nitrogen stores acquired as larvae were inadequate. Early and regular pollen feeding in part paces the onset and maximum tempo of solitary bees' lifetime reproductive output. Published by Elsevier Ltd.

  10. Transcriptome analysis of the central nervous system of the mollusc Lymnaea stagnalis.

    Science.gov (United States)

    Feng, Z-P; Zhang, Z; van Kesteren, R E; Straub, V A; van Nierop, P; Jin, K; Nejatbakhsh, N; Goldberg, J I; Spencer, G E; Yeoman, M S; Wildering, W; Coorssen, J R; Croll, R P; Buck, L T; Syed, N I; Smit, A B

    2009-09-23

    The freshwater snail Lymnaea stagnalis (L. stagnalis) has served as a successful model for studies in the field of Neuroscience. However, a serious drawback in the molecular analysis of the nervous system of L. stagnalis has been the lack of large-scale genomic or neuronal transcriptome information, thereby limiting the use of this unique model. In this study, we report 7,712 distinct EST sequences (median length: 847 nucleotides) of a normalized L. stagnalis central nervous system (CNS) cDNA library, resulting in the largest collection of L. stagnalis neuronal transcriptome data currently available. Approximately 42% of the cDNAs can be translated into more than 100 consecutive amino acids, indicating the high quality of the library. The annotated sequences contribute 12% of the predicted transcriptome size of 20,000. Surprisingly, approximately 37% of the L. stagnalis sequences only have a tBLASTx hit in the EST library of another snail species Aplysia californica (A. californica) even using a low stringency e-value cutoff at 0.01. Using the same cutoff, approximately 67% of the cDNAs have a BLAST hit in the NCBI non-redundant protein and nucleotide sequence databases (nr and nt), suggesting that one third of the sequences may be unique to L. stagnalis. Finally, using the same cutoff (0.01), more than half of the cDNA sequences (54%) do not have a hit in nematode, fruitfly or human genome data, suggesting that the L. stagnalis transcriptome is significantly different from these species as well. The cDNA sequences are enriched in the following gene ontology functional categories: protein binding, hydrolase, transferase, and catalytic enzymes. This study provides novel molecular insights into the transcriptome of an important molluscan model organism. Our findings will contribute to functional analyses in neurobiology, and comparative evolutionary biology. The L. stagnalis CNS EST database is available at http://www.Lymnaea.org/.

  11. A synthetic workflow for coordinated direct observation and genetic tagging applied to a complex host-parasite interaction.

    Science.gov (United States)

    Nguyen, A T; Kuwata, C; Kuris, A M

    2015-05-01

    An important aspect influencing host specificity is a parasite's compatibility, or ability, to infect a potential host. Here, we examine the compatibility between different trematode genotypes of the same species and several host species. To execute this study, we developed a synthetic workflow which combines the use of a fluorescent dye and standard molecular techniques to study host-parasite interactions and host specificity. The utility of the fluorescent dye, BIODIPY FL C₁₂, was evaluated to label and track larval trematodes during experimental infections using the Cerithidea californica-trematode host-parasite system. Our results showed that low dye concentrations (200 nM) did not significantly affect survival or infectivity of Acanthoparyphium spinulosum and proved to be useful for labeling cercariae. Parasites were genotyped based on sequences from cytochrome oxidase subunit 1 (COI) and the nuclear internal transcribed spacer 1 (ITS1) prior to labeling and experimental infections. Samples with low COI PCR product yield were reamplified using the M13 tails to obtain enough material for sequencing. Three parasite genotypes were recovered and results from experimental infections demonstrated varying levels of host specificity. Of the three host species used (C. californica, Polydora nuchalis, Tagelus californianus), genotype B was unable to infect P. nuchalis. Genotype A individuals were less likely to infect P. nuchalis than the other host species. Additionally, genotype C was unable to infect any host offered in this study. These findings reflect possible suboptimal pairings between parasite genotype and host species. Furthermore, the present study provides procedures that are useful for exploring parasite ecology at the molecular level.

  12. Phylogeny of the pollinating yucca moths, with revision of Mexican species (Tegeticula and Parategeticula; Lepidoptera, Prodoxidae)

    Energy Technology Data Exchange (ETDEWEB)

    Pellmyr, Olof; Balcazar-Lara, Manuel; Segraves, Kari A.; Althoff, David M.; Littlefield, Rik J.

    2008-02-01

    ABSTRACT The yucca moths (Tegeticula and Parategeticula; Lepidoptera, Prodoxidae) are well-known for their obligate relationship as exclusive pollinators of yuccas. Revisionary work in recent years has revealed far higher species diversity than historically recognized, increasing the number of described species from four to 21. Based on field surveys in Mexico and examination of collections, we describe five additional species: T. californica Pellmyr sp. nov., T. tehuacana Pellmyr & Balcázar-Lara sp. nov., T. tambasi Pellmyr & Balcázar-Lara sp. nov., T. baja Pellmyr & Balcázar-Lara sp. nov., and P. californica Pellmyr & Balcázar-Lara sp. nov. Tegeticula treculeanella Pellmyr is identified as a junior synonym of T. mexicana Bastida. A diagnostic key to the adults of all species of the T. yuccasella complex is provided. A phylogeny based on a 2104-bp segment of mitochondrial DNA (mtDNA) in the cytochrome oxidase I and II region supported monophyly of the two pollinator genera, and strongly supported monophyly of the 17 recognized species of the T. yuccasella complex. Most relationships are well-supported, but some relationships within a recent and rapidly diversified group of 11 taxa are less robust, and in one case conflicts with a whole-genome data set (AFLP). The current mtDNA-based analyses, together with previously published AFLP data, provide a robust phylogenetic foundation for future studies of life history evolution and host interactions in one of the classical models of coevolution and obligate mutualism. ADDITIONAL KEY WORDS: mutualism, pollination, molecular phylogenetics, mitochondrial DNA

  13. Effects of five southern California macroalgal diets on consumption, growth, and gonad weight, in the purple sea urchin Strongylocentrotus purpuratus

    Directory of Open Access Journals (Sweden)

    Matthew C. Foster

    2015-01-01

    Full Text Available Consumer growth and reproductive capacity are direct functions of diet. Strongylocentrotid sea urchins, the dominant herbivores in California kelp forests, strongly prefer giant kelp (Macrocystis pyrifera, but are highly catholic in their ability to consume other species. The biomass of Macrocystis fluctuates greatly in space and time, and the extent to which urchins can use alternate species of algae or a mixed diet of multiple algal species to maintain fitness when giant kelp is unavailable is unknown. We experimentally examined the effects of single and mixed species diets on consumption, growth and gonad weight in the purple sea urchin Strongylocentrotus purpuratus. Urchins were fed single species diets consisting of one of four common species of macroalgae (the kelps Macrocystis pyrifera and Pterygophora californica, and the red algae Chondracanthus corymbiferus and Rhodymenia californica (hereafter referred to by genus or a mixed diet containing all four species ad libitum over a 13-week period in a controlled laboratory setting. Urchins fed Chondracanthus, Macrocystis and a mixed diet showed the highest growth (in terms of test diameter, wet weight and jaw length and gonad weight, while urchins fed Pterygophora and Rhodymenia showed the lowest. Urchins consumed their preferred food, Macrocystis, at the highest rate when offered a mixture, but consumed Chondracanthus or Macrocystis at similar rates when the two algae were offered alone. The differences in urchin feeding behavior and growth observed between these diet types suggest the relative availability of the algae tested here could affect urchin populations and their interactions with the algal assemblage. The fact that the performance of urchins fed Chondracanthus was similar or higher than those fed the preferred Macrocystis suggests that the availability of the former could could sustain growth and reproduction of purple sea urchins during times of low Macrocystis abundance as is

  14. Host density increases parasite recruitment but decreases host risk in a snail-trematode system

    Science.gov (United States)

    Buck, Julia C; Hechinger, R.F.; Wood, A.C.; Stewart, T.E.; Kuris, A.M.; Lafferty, Kevin D.

    2017-01-01

    Most species aggregate in local patches. High host density in patches increases contact rate between hosts and parasites, increasing parasite transmission success. At the same time, for environmentally-transmitted parasites, high host density can decrease infection risk to individual hosts, because infective stages are divided among all hosts in a patch, leading to safety in numbers. We tested these predictions using the California horn snail, Cerithideopsis californica (=Cerithidea californica), which is the first intermediate host for at least 19 digenean trematode species in California estuaries. Snails become infected by ingesting trematode eggs or through penetration by free-swimming miracidia that hatch from trematode eggs deposited with final-host (bird or mammal) feces. This complex life cycle decouples infective-stage production from transmission, raising the possibility of an inverse relationship between host density and infection risk. In a field survey, higher snail density was associated with increased trematode (infected snail) density, but decreased trematode prevalence, consistent with either safety in numbers, parasitic castration, or both. To determine the extent to which safety in numbers drove the negative snail density-trematode prevalence association, we manipulated uninfected snail density in 83 cages at eight sites within Carpinteria Salt Marsh (CA, USA). At each site, we quantified snail density and used data on final-host (bird and raccoon) distributions to control for between-site variation in infective-stage supply. After three months, overall trematode infections per cage increased with snail-biomass density. For egg-transmitted trematodes, per-snail infection risk decreased with snail-biomass density in the cage and surrounding area, whereas per-snail infection risk did not decrease for miracidium-transmitted trematodes. Furthermore, both trematode recruitment and infection risk increased with infective-stage input, but this was

  15. Host density increases parasite recruitment but decreases host risk in a snail-trematode system.

    Science.gov (United States)

    Buck, J C; Hechinger, R F; Wood, A C; Stewart, T E; Kuris, A M; Lafferty, K D

    2017-08-01

    Most species aggregate in local patches. High host density in patches increases contact rate between hosts and parasites, increasing parasite transmission success. At the same time, for environmentally transmitted parasites, high host density can decrease infection risk to individual hosts, because infective stages are divided among all hosts in a patch, leading to safety in numbers. We tested these predictions using the California horn snail, Cerithideopsis californica (=Cerithidea californica), which is the first intermediate host for at least 19 digenean trematode species in California estuaries. Snails become infected by ingesting trematode eggs or through penetration by free-swimming miracidia that hatch from trematode eggs deposited with final-host (bird or mammal) feces. This complex life cycle decouples infective-stage production from transmission, raising the possibility of an inverse relationship between host density and infection risk at local scales. In a field survey, higher snail density was associated with increased trematode (infected snail) density, but decreased trematode prevalence, consistent with either safety in numbers, parasitic castration, or both. To determine the extent to which safety in numbers drove the negative snail-density-trematode-prevalence association, we manipulated uninfected snail density in 83 cages at eight sites within Carpinteria Salt Marsh (California, USA). At each site, we quantified snail density and used data on final-host (bird and raccoon) distributions to control for between-site variation in infective-stage supply. After three months, overall trematode infections per cage increased with snail biomass density. For egg-transmitted trematodes, per-snail infection risk decreased with snail biomass density in the cage and surrounding area, whereas per-snail infection risk did not decrease for miracidium-transmitted trematodes. Furthermore, both trematode recruitment and infection risk increased with infective

  16. Populações de minhocas em sistemas agroflorestais com café convencional e orgânico Earthworms populations in agroforestry systems with conventional and organic coffee

    Directory of Open Access Journals (Sweden)

    Adriana Maria de Aquino

    2008-08-01

    Full Text Available Objetivou-se, neste estudo, determinar se as populações das minhocas são alteradas em função do manejo do café (Coffea arabica em Turrialba, CostaRica. Os seguintes sistemas de cultivo do café foram estudados: a pleno sol (PS e sombreado com eritrina, Erythrina poeppigiana (E; terminalia, Terminalia amazonia (T e cashá, Chloroleucon eurycyclum (Ab. A hipótese foi de que o manejo orgânico do café e o fornecimento da serapilheira de melhor qualidade favoreceria a diversidade, a densidade e a biomassa das minhocas. As populações das minhocas foram alteradas, em função do manejo com insumos sintéticos ou orgânicos , sendo a densidade menor no café a pleno sol. Entre as espécies utilizadas no sombreamento, a eritrina parece limitar a abundância das minhocas. Contudo, favorece a diversidade das mesmas, tendo sido registradas duas espécies de minhocas com papéis ecológicos diferenciados, Pontoscolex corethrurus, endogeica e Metaphire californica, anécica; ao contrário dos demais tratamentos, onde somente foi encontrada a primeira espécie, considerada cosmopolita com distribuição pantropical.The aim of this study was to determine whether the populations of the earthworms are altered by coffee systems in Turrialba, Costa Rica. The following coffee management systems were studied: the sun and shading with Erythrina poeppigiana; terminalia, Terminalia amazonia or cashá, Chloroleucon eurycyclum. The hypothesis was that the organic management of the coffee and the litter input of better quality would favor the diversity, the density and the biomass of the earthworms. The populations of earthworms were differentiated with the synthetic or organic input. However, the density was lower in the coffee under the sun anyone the used species in the agroforestry, the eritrina seems to limit the abundance of the earthworms, but it favors the diversity of the same ones, being registered two species of earthworms with differentiated

  17. The Insect Chemoreceptor Superfamily Is Ancient in Animals.

    Science.gov (United States)

    Robertson, Hugh M

    2015-11-01

    The insect chemoreceptor superfamily consists of 2 gene families, the highly diverse gustatory receptors (GRs) found in all arthropods with sequenced genomes and the odorant receptors that evolved from a GR lineage and have been found only in insects to date. Here, I describe relatives of the insect chemoreceptor superfamily, specifically the basal GR family, in diverse other animals, showing that the superfamily dates back at least to early animal evolution. GR-Like (GRL) genes are present in the genomes of the placozoan Trichoplax adhaerens, an anemone Nematostella vectensis, a coral Acropora digitifera, a polychaete Capitella teleta, a leech Helobdella robusta, the nematode Caenorhabditis elegans (and many other nematodes), 3 molluscs (a limpet Lottia gigantea, an oyster Crassostrea gigas, and the sea hare Aplysia californica), the sea urchin Strongylocentrotus purpuratus, and the sea acorn Saccoglossus kowalevskii. While some of these animals contain multiple divergent GRL lineages, GRLs have been lost entirely from other animal lineages such as vertebrates. GRLs are absent from the ctenophore Mnemiopsis leidyi, the demosponge Amphimedon queenslandica, and 2 available chaonoflagellate genomes, so it remains unclear whether this superfamily originated before or during animal evolution. © The Author 2015. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  18. Holy flux: Spatial and temporal variation in massive pulses of emerging insect biomass from western U.S. rivers

    Science.gov (United States)

    Walters, David; Wesner, Jeff S.; Zuellig, Robert E.; Kowalski, Dan A.; Kondratieff, Matt C.

    2018-01-01

    The river stonefly, Pteronarcys californica (aka salmonfly), is an iconic insect in rivers of western North America due to its large size and its support of economically important species like wild trout (Nehring et al. 2011). Their emergence generates a large economic subsidy to local communities, as anglers from around the world travel to western rivers to fish the salmonfly “hatch” (e.g., Willoughby 2013). Salmonflies, which have a 4-yr lifespan in the central Rocky Mountains (Nehring et al. 2011), emerge en masse during 1 week in late spring (Sheldon 1999), and more than 20 terrestrial species, including humans, are known to eat adult salmonflies (Muttkowski 1925, Sutton 1985, Rockwell et al. 2009). How they influence populations of insectivores or the broader river-riparian ecosystem is unknown; this itself is an issue because salmonflies are disappearing from some rivers (Nehring et al. 2011).

  19. Suppression of AcMNPV replication by adf and thymosin protein up-regulation in a new testis cell line, Ha-shl-t.

    Science.gov (United States)

    Zhang, Xiaoqian; Chen, Ming; Ma, Xinlei; Zhao, Xiaofan; Wang, Jinxing; Shao, Honglian; Song, Qisheng; Stanley, David

    2013-03-01

    Host cytoskeletons facilitate the entry, replication, and egress of viruses because cytoskeletons are essential for viral survival. One mechanism of resisting viral infections involves regulating cytoskeletal polymerization/depolymerization. However, the molecular mechanisms of regulating these changes in cytoskeleton to suppress viral replication remain unclear. We established a cell line (named Ha-shl-t) from the pupal testis of Helicoverpa armigera (Lepidoptera: Noctuidae). The new testis cell line suppresses Autographa californica multiple nucleocapsid nucleopolyhedrovirus (AcMNPV) replication via disassembly of cytoskeleton. Up-regulation of thymosin (actin disassembling factor) and adf (actin depolymerizing factor) reduces F-actin. Silencing thymosin or adf or treating cells with the F-actin stabilizer phalloidin led to increased AcMNPV replication, while treating cells with an F-actin assembly inhibitor cytochalasin B decreased viral replication. We infer that Ha-shl-t cells utilize F-actin depolymerization to suppress AcMNPV replication by up-regulating thymosin and adf. We propose Ha-shl-t as a model system for investigating cytoskeletal regulation in antiviral action and testicular biology generally. © 2013 Wiley Periodicals, Inc.

  20. Ultra Deep Sequencing of a Baculovirus Population Reveals Widespread Genomic Variations

    Directory of Open Access Journals (Sweden)

    Aurélien Chateigner

    2015-07-01

    Full Text Available Viruses rely on widespread genetic variation and large population size for adaptation. Large DNA virus populations are thought to harbor little variation though natural populations may be polymorphic. To measure the genetic variation present in a dsDNA virus population, we deep sequenced a natural strain of the baculovirus Autographa californica multiple nucleopolyhedrovirus. With 124,221X average genome coverage of our 133,926 bp long consensus, we could detect low frequency mutations (0.025%. K-means clustering was used to classify the mutations in four categories according to their frequency in the population. We found 60 high frequency non-synonymous mutations under balancing selection distributed in all functional classes. These mutants could alter viral adaptation dynamics, either through competitive or synergistic processes. Lastly, we developed a technique for the delimitation of large deletions in next generation sequencing data. We found that large deletions occur along the entire viral genome, with hotspots located in homologous repeat regions (hrs. Present in 25.4% of the genomes, these deletion mutants presumably require functional complementation to complete their infection cycle. They might thus have a large impact on the fitness of the baculovirus population. Altogether, we found a wide breadth of genomic variation in the baculovirus population, suggesting it has high adaptive potential.

  1. Collecting peptide release from the brain using porous polymer monolith-based solid phase extraction capillaries

    Science.gov (United States)

    Iannacone, Jamie M.; Ren, Shifang; Hatcher, Nathan G.; Sweedler, Jonathan V.

    2010-01-01

    Porous polymer monolithic (PPM) columns are employed to collect and concentrate neuronal release from invertebrate and vertebrate model systems, prior to their characterization with mass spectrometry. The monoliths are fabricated in fused silica capillaries from lauryl methacrylate (LMA) and ethylene glycol dimethacrylate (EDMA). The binding capacities for fluorescein and for fluorescently labeled peptides are on the order of nanomoles per millimeter length of monolith material for a 200 μm inner diameter capillary. To evaluate this strategy for collecting peptides from physiological solutions, angiotensin I and insulin in artificial seawater are loaded onto, and then released from the monoliths after a desalination rinse, resulting in femtomole limits of detection via matrix-assisted laser desorption/ionization time-of-flight mass spectrometry. Positioned in the extracellular media near Aplysia californica bag cell neurons, upon electrical stimulation, these LMA-EDMA monoliths are also used to collect and concentrate peptide release, with egg laying hormone and acidic peptide detected. In addition, the collection of several known peptides secreted from chemically stimulated mouse brain slices demonstrates their ability to collect releasates from a variety of neuronal tissues. When compared to collection approaches using individual beads placed on brain slices, the PPM capillaries offer greater binding capacity. Moreover, they maintain higher spatial resolution as compared to the larger-volume, solid phase extraction collection strategies. PMID:19485405

  2. Mucosal delivery of ACNPV baculovirus driving expression of the Gal-lectin LC3 fragment confers protection against amoebic liver abscess in hamster.

    Science.gov (United States)

    Meneses-Ruiz, D M; Laclette, J P; Aguilar-Díaz, H; Hernández-Ruiz, J; Luz-Madrigal, A; Sampieri, A; Vaca, L; Carrero, J C

    2011-01-01

    Mucosal vaccination against amoebiasis using the Gal-lectin of E. histolytica has been proposed as one of the leading strategies for controlling this human disease. However, most mucosal adjuvants used are toxic and the identification of safe delivery systems is necessary. Here, we evaluate the potential of a recombinant Autographa californica baculovirus driving the expression of the LC3 fragment of the Gal-lectin to confer protection against amoebic liver abscess (ALA) in hamsters following oral or nasal immunization. Hamsters immunized by oral route showed complete absence (57.9%) or partial development (21%) of ALA, resulting in some protection in 78.9% of animals when compared with the wild type baculovirus and sham control groups. In contrast, nasal immunization conferred only 21% of protection efficacy. Levels of ALA protection showed lineal correlation with the development of an anti-amoebic cellular immune response evaluated in spleens, but not with the induction of seric IgG anti-amoeba antibodies. These results suggest that baculovirus driving the expression of E. histolytica vaccine candidate antigens is useful for inducing protective cellular and humoral immune responses following oral immunization, and therefore it could be used as a system for mucosal delivery of an anti-amoebic vaccine.

  3. Xenon NMR: Chemical Shifts of a General Anesthetic in Common Solvents, Proteins, and Membranes

    Science.gov (United States)

    Miller, Keith W.; Reo, Nicholas V.; Schoot Uiterkamp, Antonius J. M.; Stengle, Diane P.; Stengle, Thomas R.; Williamson, Kenneth L.

    1981-08-01

    The rare gas xenon contains two NMR-sensitive isotopes in high natural abundance. The nuclide 129Xe has a spin of {textstyle1/2}; 131Xe is quadrupolar with a spin of {textstyle3/2}. The complementary NMR characteristics of these nuclei provide a unique opportunity for probing their environment. The method is widely applicable because xenon interacts with a useful range of condensed phases including pure liquids, protein solutions, and suspensions of lipid and biological membranes. Although xenon is chemically inert, it does interact with living systems; it is an effective general anesthetic. We have found that the range of chemical shifts of 129Xe dissolved in common solvents is ca. 200 ppm, which is 30 times larger than that found for 13C in methane dissolved in various solvents. Resonances were also observed for 131Xe in some systems; they were broader and exhibited much greater relaxation rates than did 129Xe. The use of 129Xe NMR as a probe of biological systems was investigated. Spectra were obtained from solutions of myoglobin, from suspensions of various lipid bilayers, and from suspensions of the membranes of erythrocytes and of the acetylcholine receptor-rich membranes of Torpedo californica. These systems exhibited a smaller range of chemical shifts. In most cases there was evidence of a fast exchange of xenon between the aqueous and organic environments, but the exchange was slow in suspensions of dimyristoyl lecithin vesicles.

  4. Alkaloid metabolite profiles by GC/MS and acetylcholinesterase inhibitory activities with binding-mode predictions of five Amaryllidaceae plants.

    Science.gov (United States)

    Cortes, Natalie; Alvarez, Rafael; Osorio, Edison H; Alzate, Fernando; Berkov, Strahil; Osorio, Edison

    2015-01-01

    Acetylcholinesterase (AChE) enzymatic inhibition is an important target for the management of Alzheimer disease (AD) and AChE inhibitors are the mainstay drugs for its treatment. In order to discover new sources of potent AChE inhibitors, a combined strategy is presented based on AChE-inhibitory activity and chemical profiles by GC/MS, together with in silico studies. The combined strategy was applied on alkaloid extracts of five Amaryllidaceae species that grow in Colombia. Fifty-seven alkaloids were detected using GC/MS, and 21 of them were identified by comparing their mass-spectral fragmentation patterns with standard reference spectra in commercial and private library databases. The alkaloid extracts of Zephyranthes carinata exhibited a high level of inhibitory activity (IC50 = 5.97 ± 0.24 μg/mL). Molecular modeling, which was performed using the structures of some of the alkaloids present in this extract and the three-dimensional crystal structures of AChE derived from Torpedo californica, disclosed their binding configuration in the active site of this AChE. The results suggested that the alkaloids 3-epimacronine and lycoramine might be of interest for AChE inhibition. Although the galanthamine group is known for its potential utility in treating AD, the tazettine-type alkaloids should be evaluated to find more selective compounds of potential benefit for AD. Copyright © 2014 Elsevier B.V. All rights reserved.

  5. Intraguild predation by shore crabs affects mortality, behavior, growth, and densities of California horn snails

    Science.gov (United States)

    Lorda, J.; Hechinger, R.F.; Cooper, S. D.; Kuris, A. M.; Lafferty, Kevin D.

    2016-01-01

    The California horn snail, Cerithideopsis californica, and the shore crabs, Pachygrapsus crassipesand Hemigrapsus oregonensis, compete for epibenthic microalgae, but the crabs also eat snails. Such intraguild predation is common in nature, despite models predicting instability. Using a series of manipulations and field surveys, we examined intraguild predation from several angles, including the effects of stage-dependent predation along with direct consumptive and nonconsumptive predator effects on intraguild prey. In the laboratory, we found that crabs fed on macroalgae, snail eggs, and snails, and the size of consumed snails increased with predator crab size. In field experiments, snails grew less in the presence of crabs partially because snails behaved differently and were buried in the sediment (nonconsumptive effects). Consistent with these results, crab and snail abundances were negatively correlated in three field surveys conducted at three different spatial scales in estuaries of California, Baja California, and Baja California Sur: (1) among 61 sites spanning multiple habitat types in three estuaries, (2) among the habitats of 13 estuaries, and (3) among 34 tidal creek sites in one estuary. These results indicate that shore crabs are intraguild predators on California horn snails that affect snail populations via predation and by influencing snail behavior and performance.

  6. Fish Synucleins: An Update

    Directory of Open Access Journals (Sweden)

    Mattia Toni

    2015-10-01

    Full Text Available Synucleins (syns are a family of proteins involved in several human neurodegenerative diseases and tumors. Since the first syn discovery in the brain of the electric ray Torpedo californica, members of the same family have been identified in all vertebrates and comparative studies have indicated that syn proteins are evolutionary conserved. No counterparts of syns were found in invertebrates suggesting that they are vertebrate-specific proteins. Molecular studies showed that the number of syn members varies among vertebrates. Three genes encode for α-, β- and γ-syn in mammals and birds. However, a variable number of syn genes and encoded proteins is expressed or predicted in fish depending on the species. Among biologically verified sequences, four syn genes were identified in fugu, encoding for α, β and two γ (γ1 and γ2 isoforms, whereas only three genes are expressed in zebrafish, which lacks α-syn gene. The list of “non verified” sequences is much longer and is often found in sequence databases. In this review we provide an overview of published papers and known syn sequences in agnathans and fish that are likely to impact future studies in this field. Indeed, fish models may play a key role in elucidating some of the molecular mechanisms involved in physiological and pathological functions of syn proteins.

  7. Fluorescent agonists for the Torpedo nicotinic acetylcholine receptor.

    Science.gov (United States)

    Krieger, Florian; Mourot, Alexandre; Araoz, Romulo; Kotzyba-Hibert, Florence; Molgó, Jordi; Bamberg, Ernst; Goeldner, Maurice

    2008-05-05

    We have synthesized a series of fluorescent acylcholine derivatives carrying different linkers that vary in length and structure and connect the acylcholine unit to the environment-sensitive fluorophores 7-(diethylamino)coumarin-3-carbonyl (DEAC) or N-(7-nitrobenz-2-oxa-1,3-diazol-yl) (NBD). The pharmacological properties of the fluorescent analogues were investigated on heterologously expressed nicotinic acetylcholine receptor (nAChR) from Torpedo californica and on oocytes transplanted with nAChR-rich Torpedo marmorata membranes. Agonist action strongly depends on the length and the structure of the linker. One particular analogue, DEAC-Gly-C6-choline, showed partial agonist behavior with about half of the maximum response of acetylcholine, which is at least 20 times higher than those observed with previously described fluorescent dansyl- and NBD-acylcholine analogues. Binding of DEAC-Gly-C6-choline to Torpedo nAChR induces a strong enhancement of fluorescence intensity. Association and displacement kinetic experiments revealed dissociation constants of 0.5 nM for the alphadelta-binding site and 15.0 nM for the alphagamma-binding site. Both the pharmacological and the spectroscopic properties of this agonist show great promise for characterizing the allosteric mechanism behind the function of the Torpedo nAChR, as well as for drug-screening studies.

  8. Grapevine red blotch-associated virus is Present in Free-Living Vitis spp. Proximal to Cultivated Grapevines.

    Science.gov (United States)

    Perry, Keith L; McLane, Heather; Hyder, Muhammad Z; Dangl, Gerald S; Thompson, Jeremy R; Fuchs, Marc F

    2016-06-01

    Red blotch is an emerging disease of grapevine associated with grapevine red blotch-associated virus (GRBaV). The virus spreads with infected planting stocks but no vector of epidemiological significance has been conclusively identified. A vineyard block of red-blotch-affected Vitis vinifera 'Cabernet franc' clone 214 was observed in California, with a clustering of infected, symptomatic vines focused along one edge of the field proximal to a riparian habitat with free-living Vitis spp. No genetic heterogeneity was observed in a 587-nucleotide region of the GRBaV genome in a population of 44 Cabernet franc clone 214 isolates. By contrast, genetic differences were observed in isolates from other cultivars and clones growing in adjacent blocks. GRBaV was confirmed infecting four free-living vines, two of which were shown to be V. californica × V. vinifera hybrids. The genomes of three free-living GRBaV vine isolates and seven from V. vinifera cultivars were compared; free-living vine isolates were shown to be more similar to each other and a 'Merlot' isolate than to the other cultivated vine isolates. The finding that GRBaV is present in free-living Vitis spp. indicates the virus can be spread by natural (nonhuman-mediated) means, and we hypothesize that in-field spread of GRBaV is occurring.

  9. The key host for an invasive forest pathogen also facilitates the pathogen's survival of wildfire in California forests.

    Science.gov (United States)

    Beh, Maia M; Metz, Margaret R; Frangioso, Kerri M; Rizzo, David M

    2012-12-01

    The first wildfires in sudden oak death-impacted forests occurred in 2008 in the Big Sur region of California, creating the rare opportunity to study the interaction between an invasive forest pathogen and a historically recurring disturbance. To determine whether and how the sudden oak death pathogen, Phytophthora ramorum, survived the wildfires, we completed intensive vegetation-based surveys in forest plots that were known to be infested before the wildfires. We then used 24 plot-based variables as predictors of P. ramorum recovery following the wildfires. The likelihood of recovering P. ramorum from burned plots was lower than in unburned plots both 1 and 2 yr following the fires. Post-fire recovery of P. ramorum in burned plots was positively correlated with the number of pre-fire symptomatic California bay laurel (Umbellularia californica), the key sporulating host for this pathogen, and negatively correlated with post-fire bay laurel mortality levels. Patchy burn patterns that left green, P. ramorum-infected bay laurel amidst the charred landscape may have allowed these trees to serve as inoculum reservoirs that could lead to the infection of newly sprouting vegetation, further highlighting the importance of bay laurel in the sudden oak death disease cycle. © 2012 The Authors. New Phytologist © 2012 New Phytologist Trust.

  10. Biosynthesis of medium chain length alkanes for bio-aviation fuel by metabolic engineered Escherichia coli.

    Science.gov (United States)

    Wang, Meng; Nie, Kaili; Cao, Hao; Xu, Haijun; Fang, Yunming; Tan, Tianwei; Baeyens, Jan; Liu, Luo

    2017-09-01

    The aim of this work was to study the synthesis of medium-chain length alkanes (MCLA), as bio-aviation product. To control the chain length of alkanes and increase the production of MCLA, Escherichia coli cells were engineered by incorporating (i) a chain length specific thioesterase from Umbellularia californica (UC), (ii) a plant origin acyl carrier protein (ACP) gene and (iii) the whole fatty acid synthesis system (FASs) from Jatropha curcas (JC). The genetic combination was designed to control the product spectrum towards optimum MCLA. Decanoic, lauric and myristic acid were produced at concentrations of 0.011, 0.093 and 1.657mg/g, respectively. The concentration of final products nonane, undecane and tridecane were 0.00062mg/g, 0.0052mg/g, and 0.249mg/g respectively. Thioesterase from UC controlled the fatty acid chain length in a range of 10-14 carbons and the ACP gene with whole FASs from JC significantly increased the production of MCLA. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. The human homolog of insect-derived growth factor, CECR1, is a candidate gene for features of cat eye syndrome.

    Science.gov (United States)

    Riazi, M A; Brinkman-Mills, P; Nguyen, T; Pan, H; Phan, S; Ying, F; Roe, B A; Tochigi, J; Shimizu, Y; Minoshima, S; Shimizu, N; Buchwald, M; McDermid, H E

    2000-03-15

    Cat eye syndrome (CES) is a developmental disorder with multiple organ involvement, associated with the duplication of a 2-Mb region of 22q11.2. Using exon trapping and genomic sequence analysis, we have isolated and characterized a gene, CECR1, that maps to this critical region. The protein encoded by CECR1 is similar to previously identified novel growth factors: IDGF from Sarcophaga peregrina (flesh fly) and MDGF from Aplysia californica (sea hare). The CECR1 gene is alternatively spliced and expressed in numerous tissues, with most abundant expression in human adult heart, lung, lymphoblasts, and placenta as well as fetal lung, liver, and kidney. In situ hybridization of a human embryo shows specific expression in the outflow tract and atrium of the developing heart, the VII/VIII cranial nerve ganglion, and the notochord. The location of this gene in the CES critical region and its embryonic expression suggest that the overexpression of CECR1 may be responsible for at least some features of CES, particularly the heart defects. Copyright 2000 Academic Press.

  12. Long-term habituation of the gill-withdrawal reflex in Aplysia requires gene transcription, calcineurin and L-type voltage-gated calcium channels

    Directory of Open Access Journals (Sweden)

    Joseph eEsdin

    2010-11-01

    Full Text Available Although habituation is possibly the simplest form of learning, we still do not fully understand the neurobiological basis of habituation in any organism. To advance the goal of a comprehensive understanding of habituation, we have studied long-term habituation (LTH of the gill-withdrawal reflex (GWR in the marine snail Aplysia californica. Previously, we showed that habituation of the GWR in a reduced preparation lasts for up to 12 hr, and depends on protein synthesis, as well as activation of protein phosphatases 1 and 2A and postsynaptic glutamate receptors. Here, we have used the reduced preparation to further analyze the mechanisms of LTH in Aplysia. We found that LTH of the GWR depends on RNA synthesis because it was blocked by both the irreversible transcriptional inhibitor actinomycin-D and the reversible transcriptional inhibitor, 5,6-dichlorobenzimidazole riboside (DRB. In addition, LTH requires activation of protein phosphatase 2B (calcineurin, because it was disrupted by ascomycin. Finally, LTH was blocked by nitrendipine, which indicates that activation of L-type voltage-gated Ca2+ channels is required for this form of learning. Together with our previous results, the present results indicate that exclusively presynaptic mechanisms, although possibly sufficient for short-term habituation, are insufficient for LTH. Rather, LTH must involve postsynaptic, as well as presynaptic, mechanisms.

  13. Antiviral, Immunomodulatory, and Free Radical Scavenging Activities of a Protein-Enriched Fraction from the Larvae of the Housefly, Musca domestica

    Science.gov (United States)

    Ai, Hui; Wang, Furong; Zhang, Na; Zhang, Lingyao; Lei, Chaoliang

    2013-01-01

    In our previous study, protein-enriched fraction (PEF) that was isolated from the larvae of the housefly, Musca domestica L. (Diptera: Muscidae), showed excellent hepatoprotective activity as well as the potential for clinical application in therapy for liver diseases. In this study, antiviral, immunomodulatory, and free radical scavenging activities of PEF were evaluated. The antiviral results demonstrated that PEF inhibited the infection of avian influenza virus H9N2 and had a virucidal effect against the multicapsid nucleopolyhedrovirus of the alfalfa looper, Autographa californica Speyer (Lepidoptera: Noctuidae) in vitro. The mortality of silkworm larve in a PEF treatment group decreased significantly compared with a negative control. PEF showed excellent scavenging activity for 1,1-diphenyl-2-picrylhydrazyl and superoxide anion radicals, which were similar to those of ascorbic acid. The imunomodulatory results suggested that PEF could effectively improve immune function in experimental mice. Our results indicated that PEF could possibly be used for the prophylaxis and treatment of diseases caused by avian influenza virus infection. In addition, PEF with virucidal activity against insect viruses might provide useful for the development of antimicrobial breeding technology for economically important insects. As a natural product from insects, PEF could be a potential source for the discovery of potent antioxidant and immunomodulatory agents. PMID:24735244

  14. Topographic Studies of Torpedo Acetylcholine Receptor Subunits as a Transmembrane Complex

    Science.gov (United States)

    Strader, Catherine D.; Raftery, Michael A.

    1980-10-01

    The exposure of the four subunits of the acetylcholine receptor from Torpedo californica on both the extracellular and cytoplasmic faces of the postsynaptic membranes of the electroplaque cells has been investigated. Sealed membrane vesicles containing no protein components other than the receptor were isolated and were shown to have 95% of their synaptic surfaces facing the medium. The susceptibility of the four receptor subunits in these preparations to hydrolysis by trypsin both from the external and from the internal medium was used to investigate the exposure of the subunits on the synaptic and cytoplasmic surfaces of the membrane. It was shown by sodium dodecyl sulfate gel electrophoresis of the tryptic products that all four subunits are exposed on the extracellular surface to a similar degree. All four subunits are also exposed on the internal surface of the membrane, but the apparent degree of exposure varies with the subunit size, the larger subunits being more exposed. The results are discussed in terms of a possible topographic model of the receptor as a transmembrane protein complex.

  15. YEAST β-MANNANASE ACTIVITY

    Directory of Open Access Journals (Sweden)

    N. V. Borzova

    2017-02-01

    Full Text Available The aim of the research was to determine the mannan-degrading activity of yeasts cultures isolated from various sources and select strains with high β-mannanase activity. As a result of screening of 245 yeast strains, which are the representatives of 7 genera and 14 species, the active producers of extracellular β-mannanase were identified. To increase β-mannanase activity, the cultures were grown under submerged conditions using guar gum galactomannan as a carbon source and an inducer. β-Mannanase activity was determined by dinitrosalicylic method. The most active biosynthetic species were Cryptococcus albidus, C. gastricus, C. magnus, C. terreus, C. laurentii, Saccharomyces cerevisiae, Williopsis californica, Metschnikowia pulcherrima, Pichia anomala and P. guilliermondii. The activity in culture supernatant was ranged from 0.2 to 75 U/ml. α-Galactosidase activity was found in two strains (Debaryomyces polymorphus UCM Y-152 and Debaryomyces hansenii var. fabryi UCM Y-2400. None of the tested cultures demonstrated both β-mannanase and α-galactosidase activity, that is, they are unable to attack both the main and side chains of galactomannan.

  16. Characterization of a new insect cell line that is derived from the neonate larvae of Papilio xuthus (Lepidoptera: Papilionidae) and its susceptibility to AcNPV.

    Science.gov (United States)

    Zhang, Xin; Feng, Ying; Ding, Wei-Feng; Chen, Xiao-Ming; Wang, Cheng-Ye; Ma, Tao

    2012-06-01

    The cell line RIRI-PX1 was established from neonate larval tissues of Papilio xuthus by performing primary cultures in the modified Grace medium that was supplemented with 20% fetal bovine serum (FBS). The cell line primarily consisted of spindle-shaped and spherical cells which attached themselves to the flask. The population-doubling times (PDTs) at the 50th and 60th passage were 42.5 h and 42.1 h respectively. The average chromosome numbers of RIRI-PX1 cell line from passage 5 to passage 50 ranged from 103 to 199. It was confirmed that RIRI-PX1 cell line was derived from P. xuthus by comparing the mitochondrial cytochrome c oxidase subunit I gene (COI) of RIRI-PX1 cells and P. xuthus eggs. This cell line was susceptible to the Autographa californica nucleopolyhedrovirus (AcNPV) and produced high yield of polyhedral occlusion bodies (43.9OBs/cell) after 10 days of infection by AcNPV. The virus titer of AcNPV infected RIRI-PX1 cells was 3.25×10⁷ TCID₅₀/ml. We concluded that the RIRI-PX1 cell line is established from the neonate larvae tissues successfully and the cells of the cell line are sensitive to AcNPV. Copyright © 2012 Elsevier Ltd. All rights reserved.

  17. Water use patterns of four co-occurring chaparral shrubs.

    Science.gov (United States)

    Davis, S D; Mooney, H A

    1986-09-01

    Mixed stands of chaparral in California usually contain several species of shrubs growing close to each other so that aerial branches and subterranean roots overlap. There is some evidence that roots are stratified relative to depth. It may be that root stratification promotes sharing of soil moisture resources. We examined this possibility by comparing seasonal water use patterns in a mixed stand of chaparral dominated by four species of shrubs: Quercus durata, Heteromeles arbutifolia, Adenostoma fasciculatum, and Rhamnus californica. We used a neutron probe and soil phychrometers to follow seasonal depletion and recharging of soil moisture and compared these patterns to seasonal patterns of predawn water potentials, diurnal leaf conductances, and diurnal leaf water potentials. Our results indicated that 1) Quercus was deeply rooted, having high water potentials and high leaf conductances throughout the summer drought period, 2) Heteromeles/Adenostoma were intermediate in rooting depth, water potentials, and leaf conductances, and 3) Rhamnus was shallow rooted, having the lowest water potentials and leaf conductances. During the peak of the drought, predawn water potentials for Quercus corresponded to soil water potentials at or below a depth of 2 m, predawn water potentials of Heteromeles/ Adenostoma corresponded to a depth of 0.75 m, and predawn water potentials of Rhamnus corresponded to a depth of 0.5 m. This study supports the concept that co-occurring shrubs of chaparral in California utilize a different base of soil moisture resources.

  18. Ryanodine-, IP3- and NAADP-dependent calcium stores control acetylcholine release.

    Science.gov (United States)

    Chameau, P; Van de Vrede, Y; Fossier, P; Baux, G

    2001-11-01

    Injections of inositol trisphosphate (IP3) or nicotinamide adenine dinucleotide phosphate (NAADP) into the presynaptic neurone of an identified cholinergic synapse in the buccal ganglion of Aplysia californica increased the amplitude of the inhibitory postsynaptic current evoked by a presynaptic action potential. This suggests that Ca2+ release from various Ca2+ stores can modulate acetylcholine (ACh) release. Specific blockade of the calcium-induced calcium release (CICR) mechanism with ryanodine, or of IP3-induced calcium release with heparin, abolished the effects of IP3, but not the effects of NAADP, suggesting the presence of an intracellular Ca2+ pool independent of those containing ryanodine receptors (RyR) or IP3 receptors. To reinforce electrophysiological observations, intracellular [Ca2+]i changes were measured using the fluorescent dye rhod-2. Injections of cyclic ADP-ribose (an activator of RyR), IP3 or NAADP into the presynaptic neurone induced transient increases in the free intracellular Ca2+ concentration. RyR- and IP3-induced increases were prevented by application of respective selective antagonists but not NAADP-induced increases. Our results show that RyR-dependent, IP3-dependent, and NAADP-dependent Ca2+ stores are present in the same presynaptic terminal but are differently involved in the regulation of the presynaptic Ca2+ concentration that triggers transmitter release.

  19. Presynaptic membrane potential affects transmitter release in an identified neuron in Aplysia by modulating the Ca2+ and K+ currents

    Science.gov (United States)

    Shapiro, Eli; Castellucci, Vincent F.; Kandel, Eric R.

    1980-01-01

    We have examined the relationships between the modulation of transmitter release and of specific ionic currents by membrane potential in the cholinergic interneuron L10 of the abdominal ganglion of Aplysia californica. The presynaptic cell body was voltage-clamped under various pharmacological conditions and transmitter release from the terminals was assayed simultaneously by recording the synaptic potentials in the postsynaptic cell. When cell L10 was voltage-clamped from a holding potential of -60 mV in the presence of tetrodotoxin, graded transmitter release was evoked by depolarizing command pulses in the membrane voltage range (-35 mV to + 10 mV) in which the Ca2+ current was also increasing. Depolarizing the holding potential of L10 results in increased transmitter output. Two ionic mechanisms contribute to this form of plasticity. First, depolarization inactivates some K+ channels so that depolarizing command pulses recruit a smaller K+ current. In unclamped cells the decreased K+ conductance causes spike-broadening and increased influx of Ca2+ during each spike. Second, small depolarizations around resting potential (-55 mV to -35 mV) activate a steady-state Ca2+ current that also contributes to the modulation of transmitter release, because, even with most presynaptic K+ currents blocked pharmacologically, depolarizing the holding potential still increases transmitter release. In contrast to the steady-state Ca2+ current, the transient inward Ca2+ current evoked by depolarizing clamp steps is relatively unchanged from various holding potentials. PMID:6244571

  20. Drug binding to the acetylcholine receptor: Nitroxide analogs of phencyclidine and a local anesthetic

    Energy Technology Data Exchange (ETDEWEB)

    Palma, A.L.

    1988-01-01

    The interaction of noncompetitive inhibitors (NCIs) with Torpedo californica native nicotinic acetylcholine receptor (nAChR) membranes was examined primarily by the technique of electron paramagnetic resonance (EPR) spectroscopy. The goal of this work being to define some of the physical characteristics for the site(s) of association between an NCI and the nAChR membrane. A nitroxide labeled analog of a quaternary amine local anesthetic, 2-(N,N-dimethyl-N-4-(2,2,6,6-tetramethylpiperidinoxyl)amino)-ethyl 4-hexyloxybenzoate iodide (C6SLMeI), displays a strongly immobilized EPR component when added to nAChR membranes in the presence of carbamylcholine (carb). To further this work, a nitroxide labeled analog of phencyclidine (PCP), a potent NCI, was synthesized. 4-phenyl-4-(1-piperidinyl)-2,2,6,6-tetramethylpiperidinoxyl (PPT) exhibited one-third the potency of PCP in inhibiting nAChR mediated ion flux, and from competition binding studies with ({sup 3}H)PCP displayed a K{sub D} of 0.21 {mu}M towards a carb desensitized nAChR and a K{sub 0.5} of 18 {mu}M for a resting {alpha}-bungarotoxin treated nAChR.

  1. Relative densities of natural enemy and pest insects within California hedgerows.

    Science.gov (United States)

    Gareau, Tara L Pisani; Letourneau, Deborah K; Shennan, Carol

    2013-08-01

    Research on hedgerow design for supporting communities of natural enemies for biological control lags behind farmer innovation in California, where assemblages of perennial plant species have been used on crop field margins in the last decade. We compared natural enemy to pest ratios between fields with hedgerows and fields with weedy margins by sampling beneficial insects and key pests of vegetables on sticky cards. We used biweekly vacuum samples to measure the distribution of key insect taxa among native perennial plant species with respect to the timing and intensity of bloom. Sticky cards indicated a trend that field margins with hedgerows support a higher ratio of natural enemies to pests compared with weedy borders. Hedgerow plant species hosted different relative densities of a generally overlapping insect community, and the timing and intensity of bloom only explained a small proportion of the variation in insect abundance at plant species and among hedgerows, with the exception of Orius spp. on Achillea millefolium L. and Baccharis pilularis De Candolle. Indicator Species Analysis showed an affinity of parasitic wasps, especially in the super-family Chalcidoidea, for B. pilularis whether or not it was in flower. A. millefolium was attractive to predatory and herbivorous homopterans; Heteromeles arbutifolia (Lindley) Roemer and B. pilularis to Diabrotica undecimpunctata undecimpunctata Mannerheim; and Rhamnus californica Eschsch to Hemerobiidae. Perennial hedgerows can be designed through species selection to support particular beneficial insect taxa, but plant resources beyond floral availability may be critical in providing structural refuges, alternative prey, and other attractive qualities that are often overlooked.

  2. Lysophosphatidic Acid Acyltransferase from Coconut Endosperm Mediates the Insertion of Laurate at the sn-2 Position of Triacylglycerols in Lauric Rapeseed Oil and Can Increase Total Laurate Levels

    Science.gov (United States)

    Knutzon, Deborah S.; Hayes, Thomas R.; Wyrick, Annette; Xiong, Hui; Maelor Davies, H.; Voelker, Toni A.

    1999-01-01

    Expression of a California bay laurel (Umbellularia californica) 12:0-acyl-carrier protein thioesterase, bay thioesterase (BTE), in developing seeds of oilseed rape (Brassica napus) led to the production of oils containing up to 50% laurate. In these BTE oils, laurate is found almost exclusively at the sn-1 and sn-3 positions of the triacylglycerols (T.A. Voelker, T.R. Hayes, A.C. Cranmer, H.M. Davies [1996] Plant J 9: 229–241). Coexpression of a coconut (Cocos nucifera) 12:0-coenzyme A-preferring lysophosphatitic acid acyltransferase (D.S. Knutzon, K.D. Lardizabal, J.S. Nelsen, J.L. Bleibaum, H.M. Davies, J.G. Metz [1995] Plant Physiol 109: 999–1006) in BTE oilseed rape seeds facilitates efficient laurate deposition at the sn-2 position, resulting in the acccumulation of trilaurin. The introduction of the coconut protein into BTE oilseed rape lines with laurate above 50 mol % further increases total laurate levels. PMID:10398708

  3. Baculovirus ETL promoter acts as a shuttle promoter between insect cells and mammalian cells.

    Science.gov (United States)

    Liu, Yu-kou; Chu, Chih-chieh; Wu, Tzong-yuan

    2006-03-01

    To identify a shuttle promoter that can mediate gene expression in both insect cells and mammalian cells to facilitate the development of a baculovirus vector-based mammalian cell gene delivery vehicle. Recombinant baculoviruses carrying the beta-galactosidase reporter gene under the control of an early to late (ETL) promoter of the Autographa californica multiple nuclear polyhedrosis virus (AcMNPV) or a cytomegalovirus immediate early promoter (CMV promoter) were constructed. COS1, HeLa, CHO-K1, hFob1.19, and MCF-7 mammalian cells were tested for the expression of b-galactosidase. ETL promoter activity was higher in bone-derived hFob1.19 than in COS1, HeLa, CHO-K1, or MCF-7 mammalian cells. The transient plasmid transfection assay indicated that ETL promoter activity in mammalian cells was dependent on baculovirus gene expression. ETL promoter activity in mammalian cells is baculovirus gene expression-dependent, and the shuttle promoter will facilitate the application of baculovirus expression vectors in mammalian cell expression systems and for gene therapy.

  4. Latent memory facilitates relearning through molecular signaling mechanisms that are distinct from original learning.

    Science.gov (United States)

    Menges, Steven A; Riepe, Joshua R; Philips, Gary T

    2015-09-01

    A highly conserved feature of memory is that it can exist in a latent, non-expressed state which is revealed during subsequent learning by its ability to significantly facilitate (savings) or inhibit (latent inhibition) subsequent memory formation. Despite the ubiquitous nature of latent memory, the mechanistic nature of the latent memory trace and its ability to influence subsequent learning remains unclear. The model organism Aplysia californica provides the unique opportunity to make strong links between behavior and underlying cellular and molecular mechanisms. Using Aplysia, we have studied the mechanisms of savings due to latent memory for a prior, forgotten experience. We previously reported savings in the induction of three distinct temporal domains of memory: short-term (10min), intermediate-term (2h) and long-term (24h). Here we report that savings memory formation utilizes molecular signaling pathways that are distinct from original learning: whereas the induction of both original intermediate- and long-term memory in naïve animals requires mitogen activated protein kinase (MAPK) activation and ongoing protein synthesis, 2h savings memory is not disrupted by inhibitors of MAPK or protein synthesis, and 24h savings memory is not dependent on MAPK activation. Collectively, these findings reveal that during forgetting, latent memory for the original experience can facilitate relearning through molecular signaling mechanisms that are distinct from original learning. Copyright © 2015 Elsevier Inc. All rights reserved.

  5. Quantitative DLA-based compressed sensing for T1-weighted acquisitions

    Science.gov (United States)

    Svehla, Pavel; Nguyen, Khieu-Van; Li, Jing-Rebecca; Ciobanu, Luisa

    2017-08-01

    High resolution Manganese Enhanced Magnetic Resonance Imaging (MEMRI), which uses manganese as a T1 contrast agent, has great potential for functional imaging of live neuronal tissue at single neuron scale. However, reaching high resolutions often requires long acquisition times which can lead to reduced image quality due to sample deterioration and hardware instability. Compressed Sensing (CS) techniques offer the opportunity to significantly reduce the imaging time. The purpose of this work is to test the feasibility of CS acquisitions based on Diffusion Limited Aggregation (DLA) sampling patterns for high resolution quantitative T1-weighted imaging. Fully encoded and DLA-CS T1-weighted images of Aplysia californica neural tissue were acquired on a 17.2T MRI system. The MR signal corresponding to single, identified neurons was quantified for both versions of the T1 weighted images. For a 50% undersampling, DLA-CS can accurately quantify signal intensities in T1-weighted acquisitions leading to only 1.37% differences when compared to the fully encoded data, with minimal impact on image spatial resolution. In addition, we compared the conventional polynomial undersampling scheme with the DLA and showed that, for the data at hand, the latter performs better. Depending on the image signal to noise ratio, higher undersampling ratios can be used to further reduce the acquisition time in MEMRI based functional studies of living tissues.

  6. Atomic interactions of neonicotinoid agonists with AChBP: Molecular recognition of the distinctive electronegative pharmacophore

    Energy Technology Data Exchange (ETDEWEB)

    Talley, Todd T.; Harel, Michal; Hibbs, Ryan E.; Radi, Zoran; Tomizawa, Motohiro; Casida, John E.; Taylor, Palmer (UCB); (UCSD)

    2008-07-28

    Acetylcholine-binding proteins (AChBPs) from mollusks are suitable structural and functional surrogates of the nicotinic acetylcholine receptors when combined with transmembrane spans of the nicotinic receptor. These proteins assemble as a pentamer with identical ACh binding sites at the subunit interfaces and show ligand specificities resembling those of the nicotinic receptor for agonists and antagonists. A subset of ligands, termed the neonicotinoids, exhibit specificity for insect nicotinic receptors and selective toxicity as insecticides. AChBPs are of neither mammalian nor insect origin and exhibit a distinctive pattern of selectivity for the neonicotinoid ligands. We define here the binding orientation and determinants of differential molecular recognition for the neonicotinoids and classical nicotinoids by estimates of kinetic and equilibrium binding parameters and crystallographic analysis. Neonicotinoid complex formation is rapid and accompanied by quenching of the AChBP tryptophan fluorescence. Comparisons of the neonicotinoids imidacloprid and thiacloprid in the binding site from Aplysia californica AChBP at 2.48 and 1.94 {angstrom} in resolution reveal a single conformation of the bound ligands with four of the five sites occupied in the pentameric crystal structure. The neonicotinoid electronegative pharmacophore is nestled in an inverted direction compared with the nicotinoid cationic functionality at the subunit interfacial binding pocket. Characteristic of several agonists, loop C largely envelops the ligand, positioning aromatic side chains to interact optimally with conjugated and hydrophobic regions of the neonicotinoid. This template defines the association of interacting amino acids and their energetic contributions to the distinctive interactions of neonicotinoids.

  7. Maternal effects, flight versus fecundity trade-offs, and offspring immune defence in the Speckled Wood butterfly, Pararge aegeria

    Directory of Open Access Journals (Sweden)

    Hails Rosemary S

    2010-11-01

    Full Text Available Abstract Background Maternal condition can generate resource-related maternal effects through differential egg provisioning, and can greatly affect offspring performance. In the present study, the speckled wood butterfly Pararge aegeria (L. was used to investigate whether (after controlling for egg size maternal age, and increased flight during the oviposition period, resulted in changes in egg provisioning and whether this contributed to variation in offspring performance, i early in development (egg stage and early post-hatching development, and ii later in larval development after being exposed to the model viral pathogen system; the baculovirus Autographa californica multinucleocapsid nucleopolyhedrovirus (AcMNPV. Results Age-related changes in maternal egg provisioning were observed to influence egg stage development only. Flight-induced changes in maternal egg provisioning had direct consequences for offspring growth and survival across each life stage from egg to adulthood; offspring from forced flight mothers had lower larval masses and longer development times. Offspring with lower larval masses also had reduced survival after exposure to the viral pathogen. Conclusion The present study demonstrates that a change in maternal provisioning as a result of increased flight during the oviposition period has the potential to exert non-genetic cross-generational fitness effects in P. aegeria. This could have important consequences for population dynamics, particularly in fragmented anthropogenic landscapes.

  8. Molecular modeling of sulfoxaflor and neonicotinoid binding in insect nicotinic acetylcholine receptors: impact of the Myzus β1 R81T mutation.

    Science.gov (United States)

    Wang, Nick X; Watson, Gerald B; Loso, Michael R; Sparks, Thomas C

    2016-08-01

    Sulfoxaflor (Isoclast™ active), a new sulfoximine-class insecticide, targets sap-feeding insect pests, including those resistant to neonicotinoids. Sulfoxaflor acts on the insect nicotinic acetylcholine receptor (nAChR) in a distinct manner relative to neonicotinoids. Unlike any of the neonicotinoids, sulfoxaflor has four stereoisomers. A homology model of Myzus persicae (green peach aphid) based on the ACh binding protein from Aplysia californica, overlaid with M. persicae nAChR sequence (α2 and β1 subunits) was used to investigate the interactions of the sulfoxaflor stereoisomers with WT and R81T versions of the nAChR. Whole-molecule van der Waals interactions are highly correlated with the binding affinity for the neonicotinoids and correctly predict the rank order of binding affinity for neonicotinoids and sulfoxaflor. The R81T mutation in M. persicae nAChR is predicted to have much less effect on binding of sulfoxaflor's stereoisomers than that of the neonicotinoids. All four stereoisomers predictably contribute to the activity of sulfoxaflor. The WT and R81T nAChR homology models suggest that changes in a whole-molecule electrostatic energy component can potentially explain the effects of this target-site mutation on the pattern of reduced efficacy for the modeled neonicotinoids, and provide a basis for the reduced effect of this mutation on sulfoxaflor. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  9. Selective control of small versus large diameter axons using infrared laser light (Conference Presentation)

    Science.gov (United States)

    Lothet, Emilie H.; Shaw, Kendrick M.; Horn, Charles C.; Lu, Hui; Wang, Yves T.; Jansen, E. Duco; Chiel, Hillel J.; Jenkins, Michael W.

    2016-03-01

    Sensory information is conveyed to the central nervous system via small diameter unmyelinated fibers. In general, smaller diameter axons have slower conduction velocities. Selective control of such fibers could create new clinical treatments for chronic pain, nausea in response to chemo-therapeutic agents, or hypertension. Electrical stimulation can control axonal activity, but induced axonal current is proportional to cross-sectional area, so that large diameter fibers are affected first. Physiologically, however, synaptic inputs generally affect small diameter fibers before large diameter fibers (the size principle). A more physiological modality that first affected small diameter fibers could have fewer side effects (e.g., not recruiting motor axons). A novel mathematical analysis of the cable equation demonstrates that the minimum length along the axon for inducing block scales with the square root of axon diameter. This implies that the minimum length along an axon for inhibition will scale as the square root of axon diameter, so that lower radiant exposures of infrared light will selectively affect small diameter, slower conducting fibers before those of large diameter. This prediction was tested in identified neurons from the marine mollusk Aplysia californica. Radiant exposure to block a neuron with a slower conduction velocity (B43) was consistently lower than that needed to block a faster conduction velocity neuron (B3). Furthermore, in the vagus nerve of the musk shrew, lower radiant exposure blocked slow conducting fibers before blocking faster conducting fibers. Infrared light can selectively control smaller diameter fibers, suggesting many novel clinical treatments.

  10. Aerosol infectivity of a Baculovirus to Trichoplusia ni larvae: An alternative larval inoculation strategy for recombinant protein production.

    Science.gov (United States)

    Jinn, Tzyy-Rong; Kao, Suey-Sheng; Tseng, Yin-Chin; Chen, Ying-Ju; Wu, Tzong-Yuan

    2009-01-01

    The baculovirus-insect expression system is a popular tool for recombinant protein production. The standard method for infecting insect larvae with recombinant baculovirus for protein production involves either feeding occlusion bodies or injecting budded virus into the cuticle. In this study, we showed that the recombinant Autographa californica multiple nucleopolyhedrovirus (AcMNPV) at titers >10(8) pfu/mL efficiently infected Trichoplusia ni (T. ni) larvae through aerosol inoculation of budded virus at a pressure of 5.5 x 10(4) Pa. The dipping T. ni larvae in virus-containing solution efficiently infected them. These results indicate that surface contamination, either by aerosol or dipping, lead to infection via spiracles. The aerosol infection route for AcMNPV was restricted to T. ni and Plutella xylostella larvae, whereas Spodoptera litura and Helicoverpa armigera larvae were resistant to this inoculation process. The yields of the reporter proteins DsRed and EGFP from T. ni larvae following aerosol infection were nearly identical to those following oral feeding or injection. This alternative baculovirus infection strategy facilitates recombinant protein and virus production by insect larvae. (c) 2009 American Institute of Chemical Engineers Biotechnol.

  11. Enhancing insecticidal efficacy of baculovirus by early expressing an insect neurotoxin, LqhIT2, in infected Trichoplusia ni larvae.

    Science.gov (United States)

    Jinn, Tzyy-Rong; Tu, Wu-Chun; Lu, Cha-I; Tzen, Jason T C

    2006-10-01

    LqhIT(2), an insect specific neurotoxin from the venom of Leiurus quinquestriatus hebraeus, has been demonstrated to improve insecticidal efficacy of Autographa californica nuclear polyhedrosis virus (AcMNPV). A polyhedrin-positive recombinant AcMNPVvAcP(hsp70)EGFP/P(pag90)IT(2) was engineered for larvae to express the enhanced green fluorescence protein (EGFP) and LqhIT(2) under the control of P(hsp70) and P(pag90) promoters, respectively. This would allow a visual observation of the viral infection and an improvement of the insecticidal efficacy. The insecticidal activity of this recombinant baculovirus, a wild type AcMNPV and four other recombinant baculoviruses, was evaluated and compared in terms of mortality, body weight, median lethal time (LT(50)), and median lethal concentration (LC(50)). Insecticidal efficacy was unaltered when treated with vAcP(hsp70)EGFP, moderately improved when infected by vAcP(10)IT(2) (a P(10)-promoted LqhIT ( 2 ) gene), and significantly elevated when treated with vAcP(pag90)IT(2) or vAcP(hsp70)EGFP/P(pag90)IT(2). No apparent difference was observed in insecticidal efficacy when additional EGFP was expressed as a visible marker. These results suggest that recombinant AcMNPV vAcP(hsp70)EGFP/P(pag90)IT(2) may be used as an effective insecticide against Trichoplusia ni and other lepidopterous insect pests.

  12. Pyridoxal phosphate as a probe of the cytoplasmic domains of transmembrane proteins: Application to the nicotinic acetylcholine receptor

    Energy Technology Data Exchange (ETDEWEB)

    Perez-Ramirez, B.; Martinez-Carrion, M. (Univ. of Missouri, Kansas City (USA))

    1989-06-13

    A novel procedure has been developed to specifically label the cytoplasmic domains of transmembrane proteins with the aldehyde pyridoxal 5-phosphate (PLP). Torpedo californica acetylcholine receptor (AcChR) vesicles were loaded with ({sup 3}H)pyridoxine 5-phosphate (({sup 3}H)PNP) and pyridoxine-5-phosphate oxidase, followed by intravesicular enzymatic oxidation of ({sup 3}H)PNP at 37{degree}C in the presence of externally added cytochrome c as a scavenger of possible leaking PLP product. The four receptor subunits were labeled whether the reaction was carried out on the internal surface or separately designed to mark the external one. On the other hand, the relative pyridoxylation of the subunits differed in both cases, reflecting differences in accessible lysyl residues in each side of the membrane. Even though there are no large differences in the total lysine content among the subunits and there are two copies of the {alpha}-subunit, internal surface labeling by PLP was greatest for the highest molecular weight ({delta}) subunit, reinforcing the concept that the four receptor subunits are transmembranous and may protrude into the cytoplasmic face in a fashion that is proportional to their subunit molecular weight. Yet, the labeling data do not fit well to any of the models proposed for AcChR subunit folding. The method described can be used for selective labeling of the cytoplasmic domains of transmembrane proteins in sealed membrane vesicles.

  13. The biological soil crusts of the San Nicolas Island: Enigmatic algae from a geographically isolated ecosystem

    Science.gov (United States)

    Flechtner, V.R.; Johansen, J.R.; Belnap, J.

    2008-01-01

    Composite soil samples from 7 sites on San Nicolas Island were evaluated quantitatively and qualitatively for the presence of cyanobacteria and eukaryotic microalgae. Combined data demonstrated a rich algal flora with 19 cyanobacterial and 19 eukaryotic microalgal genera being identified, for a total of 56 species. Nine new species were identified and described among the cyanobacteria and the eukaryotic microalgae that were isolated: Leibleinia edaphica, Aphanothece maritima, Chroococcidiopsis edaphica, Cyanosarcina atroveneta, Hassallia californica, Hassallia pseudoramosissima, Microchaete terrestre, Palmellopsis californiens, and Pseudotetracystis compactis. Distinct distributional patterns of algal taxa existed among sites on the island and among soil algal floras of western North America. Some algal taxa appeared to be widely distributed across many desert regions, including Microcoleus vaginatus, Nostoc punctiforme, Nostoc paludosum, and Tolypothrix distorta, Chlorella vulgaris, Diplosphaera cf. chodatii, Myrmecia astigmatica, Myrmecia biatorellae, Hantzschia amphioxys, and Luticola mutica. Some taxa share a distinctly southern distribution with soil algae from southern Arizona, southern California, and Baja California (e.g., Scenedesmus deserticola and Eustigmatos magnus). The data presented herein support the view that the cyanobacterial and microalgal floras of soil crusts possess significant biodiversity, much of it previously undescribed.

  14. A Role for the Anti-Viral Host Defense Mechanism in the Phylogenetic Divergence in Baculovirus Evolution.

    Directory of Open Access Journals (Sweden)

    Toshihiro Nagamine

    Full Text Available Although phylogenic analysis often suggests co-evolutionary relationships between viruses and host organisms, few examples have been reported at the microevolutionary level. Here, we show a possible example in which a species-specific anti-viral response may drive phylogenic divergence in insect virus evolution. Two baculoviruses, Autographa californica multiple nucleopolyhedrovirus (AcMNPV and Bombyx mori nucleopolyhedrovirus (BmNPV, have a high degree of DNA sequence similarity, but exhibit non-overlapping host specificity. In our study of their host-range determination, we found that BmNPV replication in B. mori cells was prevented by AcMNPV-P143 (AcP143, but not BmNPV-P143 (BmP143 or a hybrid P143 protein from a host-range expanded phenotype. This suggests that AcMNPV resistance in B. mori cells depends on AcP143 recognition and that BmNPV uses BmP143 to escapes this recognition. Based on these data, we propose an insect-baculovirus co-evolution scenario in which an ancestor of silkworms exploited an AcMNPV-resistant mechanism; AcMNPV counteracted this resistance via P143 mutations, resulting in the birth of BmNPV.

  15. Habitat Evaluation Procedures (HEP) Report; Forrest Conservation Area, Technical Report 2003-2004.

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Brent

    2005-01-01

    The Habitat Evaluation Procedure (HEP) study was performed to determine baseline habitat units on the 4,232-acre Forrest Conservation Area managed by the Confederated Tribes of Warm Springs Reservation of Oregon (Tribe) in Grant County, Oregon. The habitat evaluation is required as part of the Memorandum of Agreement between the Confederated Tribes of the Warm Springs and Bonneville Power Administration. Representatives from the Washington Department of Fish and Wildlife and the Tribes conducted the field surveys for the HEP. The survey collected data for habitat variables contained in habitat suitability index (HIS) models for wildlife species; the key species were black-capped chickadee (Poecile atricapilla), mallard (Anas platyrhynchos), mink (Mustela vison), western meadowlark (Sturnella neglecta), mule deer (Odocoileus hemionus), California Quail (Callipepla californica), and yellow warbler (Dendroica petechia). Cover types surveyed were grassland, meadow grassland, conifer forest, riparian tree shrub, shrub steppe, juniper forest, and juniper steppe. Other cover types mapped, but not used in the models were open water, roads, gravel pits, corrals, and residential.

  16. Electron microscopy of complexes of isolated acetylcholine receptor, biotinyl-toxin, and avidin

    Energy Technology Data Exchange (ETDEWEB)

    Holtzman, E. (Columbia Univ., New York); Wise, D.; Wall, J.; Karlin, A.

    1982-01-01

    The principal curarimimetic toxin of Naja naja siamensis derivatized with biothinyl groups binds specifically both to acetylcholine receptor, isolated from Torpedo californica electric tissue, and to avidin. Isolated complexes of receptor monomer or dimer, biotinyl-toxin, and avidin were negatively stained and examined in the scanning transmission electron microscope. We measured the angle made by the radius to each avidin bound at the periphery of a monomeric unit in dimer to the axis connecting the centers of the monomers, starting at the crosslink between the monomers. We infer from the distribution of these angles that one toxin binding site is located in the range of 45/sup 0/ to 85/sup 0/ and another at about 100/sup 0/ further from the crosslink between the monomers. Because it is known that there are two toxin binding sites per monomer, associated with the two ..cap alpha.. chains, the bound avidins presumably point to portions of the ..cap alpha.. chains, indicating their positions relative to that portion of the delta chain located at the crosslink between monomers in dimer.

  17. Residues Responsible for the Selectivity of α-Conotoxins for Ac-AChBP or nAChRs

    Directory of Open Access Journals (Sweden)

    Bo Lin

    2016-10-01

    Full Text Available Nicotinic acetylcholine receptors (nAChRs are targets for developing new drugs to treat severe pain, nicotine addiction, Alzheimer disease, epilepsy, etc. α-Conotoxins are biologically and chemically diverse. With 12–19 residues and two disulfides, they can be specifically selected for different nAChRs. Acetylcholine-binding proteins from Aplysia californica (Ac-AChBP are homologous to the ligand-binding domains of nAChRs and pharmacologically similar. X-ray structures of the α-conotoxin in complex with Ac-AChBP in addition to computer modeling have helped to determine the binding site of the important residues of α-conotoxin and its affinity for nAChR subtypes. Here, we present the various α-conotoxin residues that are selective for Ac-AChBP or nAChRs by comparing the structures of α-conotoxins in complex with Ac-AChBP and by modeling α-conotoxins in complex with nAChRs. The knowledge of these binding sites will assist in the discovery and design of more potent and selective α-conotoxins as drug leads.

  18. A novel baculovirus-derived promoter with high activity in the baculovirus expression system

    Directory of Open Access Journals (Sweden)

    María Martínez-Solís

    2016-06-01

    Full Text Available The baculovirus expression vector system (BEVS has been widely used to produce a large number of recombinant proteins, and is becoming one of the most powerful, robust, and cost-effective systems for the production of eukaryotic proteins. Nevertheless, as in any other protein expression system, it is important to improve the production capabilities of this vector. The orf46 viral gene was identified among the most highly abundant sequences in the transcriptome of Spodoptera exigua larvae infected with its native baculovirus, the S. exigua multiple nucleopolyhedrovirus (SeMNPV. Different sequences upstream of the orf46 gene were cloned, and their promoter activities were tested by the expression of the GFP reporter gene using the Autographa californica nucleopolyhedrovirus (AcMNPV vector system in different insect cell lines (Sf21, Se301, and Hi5 and in larvae from S. exigua and Trichoplusia ni. The strongest promoter activity was defined by a 120 nt sequence upstream of the ATG start codon for the orf46 gene. On average, GFP expression under this new promoter was more than two fold higher than the expression obtained with the standard polyhedrin (polh promoter. Additionally, the orf46 promoter was also tested in combination with the polh promoter, revealing an additive effect over the polh promoter activity. In conclusion, this new characterized promoter represents an excellent alternative to the most commonly used baculovirus promoters for the efficient expression of recombinant proteins using the BEVS.

  19. Chronic Sleep Deprivation Differentially Affects Short and Long-term Operant Memory in Aplysia

    Science.gov (United States)

    Krishnan, Harini C.; Noakes, Eric J.; Lyons, Lisa C.

    2016-01-01

    The induction, formation and maintenance of memory represent dynamic processes modulated by multiple factors including the circadian clock and sleep. Chronic sleep restriction has become common in modern society due to occupational and social demands. Given the impact of cognitive impairments associated with sleep deprivation, there is a vital need for a simple animal model in which to study the interactions between chronic sleep deprivation and memory. We used the marine mollusk Aplysia californica, with its simple nervous system, nocturnal sleep pattern and well-characterized learning paradigms, to assess the effects of two chronic sleep restriction paradigms on short-term (STM) and long-term (LTM) associative memory. The effects of sleep deprivation on memory were evaluated using the operant learning paradigm, learning that food is inedible, in which the animal associates a specific netted seaweed with failed swallowing attempts. We found that two nights of 6 h sleep deprivation occurring during the first or last half of the night inhibited both STM and LTM. Moreover, the impairment in STM persisted for more than 24 hours. A milder, prolonged sleep deprivation paradigm consisting of 3 consecutive nights of 4 h sleep deprivation also blocked STM, but had no effect on LTM. These experiments highlight differences in the sensitivity of STM and LTM to chronic sleep deprivation. Moreover, these results establish Aplysia as a valid model for studying the interactions between chronic sleep deprivation and associative memory paving the way for future studies delineating the mechanisms through which sleep restriction affects memory formation. PMID:27555235

  20. How baculovirus polyhedra fit square pegs into round holes to robustly package viruses.

    Science.gov (United States)

    Ji, Xiaoyun; Sutton, Geoff; Evans, Gwyndaf; Axford, Danny; Owen, Robin; Stuart, David I

    2010-01-20

    Natural protein crystals (polyhedra) armour certain viruses, allowing them to survive for years under hostile conditions. We have determined the structure of polyhedra of the baculovirus Autographa californica multiple nucleopolyhedrovirus (AcMNPV), revealing a highly symmetrical covalently cross-braced robust lattice, the subunits of which possess a flexible adaptor enabling this supra-molecular assembly to specifically entrap massive baculoviruses. Inter-subunit chemical switches modulate the controlled release of virus particles in the unusual high pH environment of the target insect's gut. Surprisingly, the polyhedrin subunits are more similar to picornavirus coat proteins than to the polyhedrin of cytoplasmic polyhedrosis virus (CPV). It is, therefore, remarkable that both AcMNPV and CPV polyhedra possess identical crystal lattices and crystal symmetry. This crystalline arrangement must be particularly well suited to the functional requirements of the polyhedra and has been either preserved or re-selected during evolution. The use of flexible adaptors to generate a powerful system for packaging irregular particles is characteristic of the AcMNPV polyhedrin and may provide a vehicle to sequester a wide range of objects such as biological nano-particles.

  1. Baculovirus VP80 protein and the F-actin cytoskeleton interact and connect the viral replication factory with the nuclear periphery.

    Science.gov (United States)

    Marek, Martin; Merten, Otto-Wilhelm; Galibert, Lionel; Vlak, Just M; van Oers, Monique M

    2011-06-01

    Recently, we showed that the Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV) VP80 protein is essential for the formation of both virion types, budded virus (BV) and occlusion-derived virus (ODV). Deletion of the vp80 gene did not affect assembly of nucleocapsids. However, these nucleocapsids were not able to migrate from the virogenic stroma to the nuclear periphery. In the current paper, we constructed a baculovirus recombinant with enhanced-green fluorescent protein (EGFP)-tagged VP80, allowing visualization of the VP80 distribution pattern during infection. In baculovirus-infected cells, the EGFP-VP80 protein is entirely localized in nuclei, adjacent to the virus-triggered F-actin scaffold that forms a highly organized three-dimensional network connecting the virogenic stroma physically with the nuclear envelope. Interaction between VP80 and host actin was confirmed by coimmunoprecipitation. We further showed that VP80 is associated with the nucleocapsid fraction of both BVs and ODVs, typically at one end of the nucleocapsids. In addition, the presence of sequence motifs with homology to invertebrate paramyosin proteins strongly supports a role for VP80 in the polar transport of nucleocapsids to the periphery of the nucleus on their way to the plasma membrane to form BVs and for assembly in the nuclear periphery to form ODVs for embedding in viral occlusion bodies.

  2. Virus separation using membranes.

    Science.gov (United States)

    Grein, Tanja A; Michalsky, Ronald; Czermak, Peter

    2014-01-01

    Industrial manufacturing of cell culture-derived viruses or virus-like particles for gene therapy or vaccine production are complex multistep processes. In addition to the bioreactor, such processes require a multitude of downstream unit operations for product separation, concentration, or purification. Similarly, before a biopharmaceutical product can enter the market, removal or inactivation of potential viral contamination has to be demonstrated. Given the complexity of biological solutions and the high standards on composition and purity of biopharmaceuticals, downstream processing is the bottleneck in many biotechnological production trains. Membrane-based filtration can be an economically attractive and efficient technology for virus separation. Viral clearance, for instance, of up to seven orders of magnitude has been reported for state of the art polymeric membranes under best conditions.This chapter summarizes the fundamentals of virus ultrafiltration, diafiltration, or purification with adsorptive membranes. In lieu of an impractical universally applicable protocol for virus filtration, application of these principles is demonstrated with two examples. The chapter provides detailed methods for production, concentration, purification, and removal of a rod-shaped baculovirus (Autographa californica M nucleopolyhedrovirus, about 40 × 300 nm in size, a potential vector for gene therapy, and an industrially important protein expression system) or a spherical parvovirus (minute virus of mice, 22-26 nm in size, a model virus for virus clearance validation studies).

  3. Clathrin-independent entry of baculovirus triggers uptake of E. coli in non-phagocytic human cells.

    Directory of Open Access Journals (Sweden)

    Johanna P Laakkonen

    Full Text Available The prototype baculovirus, Autographa californica multiple nucleopolyhedrovirus, an insect pathogen, holds great potential as a gene therapy vector. To develop transductional targeting and gene delivery by baculovirus, we focused on characterizing the nature and regulation of its uptake in human cancer cells. Baculovirus entered the cells along fluid-phase markers from the raft areas into smooth-surfaced vesicles devoid of clathrin. Notably, regulators associated with macropinocytosis, namely EIPA, Pak1, Rab34, and Rac1, had no significant effect on viral transduction, and the virus did not induce fluid-phase uptake. The internalization and nuclear uptake was, however, affected by mutants of RhoA, and of Arf6, a regulator of clathrin-independent entry. Furthermore, the entry of baculovirus induced ruffle formation and triggered the uptake of fluorescent E. coli bioparticles. To conclude, baculovirus enters human cells via a clathrin-independent pathway, which is able to trigger bacterial uptake. This study increases our understanding of virus entry strategies and gives new insight into baculovirus-mediated gene delivery in human cells.

  4. Metabolite profiling of the carnivorous pitcher plants Darlingtonia and Sarracenia.

    Directory of Open Access Journals (Sweden)

    Hannu Hotti

    Full Text Available Sarraceniaceae is a New World carnivorous plant family comprising three genera: Darlingtonia, Heliamphora, and Sarracenia. The plants occur in nutrient-poor environments and have developed insectivorous capability in order to supplement their nutrient uptake. Sarracenia flava contains the alkaloid coniine, otherwise only found in Conium maculatum, in which its biosynthesis has been studied, and several Aloe species. Its ecological role and biosynthetic origin in S. flava is speculative. The aim of the current research was to investigate the occurrence of coniine in Sarracenia and Darlingtonia and to identify common constituents of both genera, unique compounds for individual variants and floral scent chemicals. In this comprehensive metabolic profiling study, we looked for compound patterns that are associated with the taxonomy of Sarracenia species. In total, 57 different Sarracenia and D. californica accessions were used for metabolite content screening by gas chromatography-mass spectrometry. The resulting high-dimensional data were studied using a data mining approach. The two genera are characterized by a large number of metabolites and huge chemical diversity between different species. By applying feature selection for clustering and by integrating new biochemical data with existing phylogenetic data, we were able to demonstrate that the chemical composition of the species can be explained by their known classification. Although transcriptome analysis did not reveal a candidate gene for coniine biosynthesis, the use of a sensitive selected ion monitoring method enabled the detection of coniine in eight Sarracenia species, showing that it is more widespread in this genus than previously believed.

  5. Comparing Wild American Grapes with Vitis vinifera: A Metabolomics Study of Grape Composition.

    Science.gov (United States)

    Narduzzi, Luca; Stanstrup, Jan; Mattivi, Fulvio

    2015-08-05

    We analyzed via untargeted UHPLC-ESI-Q-TOF-MS the metabolome of the berry tissues (skin, pulp, seeds) of some American Vitis species (Vitis cinerea, Vitis californica, Vitis arizonica), together with four interspecific hybrids, and seven Vitis vinifera cultivars, aiming to find differences in the metabolomes of the American Vitis sp. versus Vitis vinifera. Apart from the known differences, that is, more complex content of anthocyanins and stilbenoids in the American grapes, we observed higher procyanidin accumulation (tens to hundreds of times) in the vinifera skin and seeds in comparison to American berries, and we confirmed this result via phloroglucinolysis. In the American grapes considered, we did not detect the accumulation of pleasing aroma precursors (terpenoids, glycosides), whereas they are common in vinifera grapes. We also found accumulation of hydrolyzable tannins and their precursors in the skin of the wild American grapes, which has never been reported earlier in any of the species under investigation. Such information is needed to improve the design of new breeding programs, lowering the risk of retaining undesirable characteristics in the chemical phenotype of the offspring.

  6. Identity and phylogenetic placement of Spirogyra species (Zygnematophyceae, Charophyta) from California streams and elsewhere(1).

    Science.gov (United States)

    Stancheva, Rosalina; Hall, John D; McCourt, Richard M; Sheath, Robert G

    2013-06-01

    Diversity of the filamentous green algae in the genus Spirogyra (Zygnematophyceae) was investigated from more than 1,200 stream samples from California. We identified 12 species of Spirogyra not previously known for California (CA), including two species new to science, Spirogyra californica sp. nov. and Spirogyra juliana sp. nov. Environmental preferences of the Californian species are discussed in the light of their restricted distribution to stream habitats with contrasting nutrient levels. We also investigated the systematic relationships of Spirogyra species from several continents using the chloroplast-encoded genes ribulose-1,5-bisphosphate carboxylase/hydrogenase large subunit (rbcL) and the beta subunit of the ATP synthase (atpB). Californian species were positioned in most major clades of Spirogyra. The phylogeny of Spirogyra and its taxonomic implications are discussed, such as the benefits of combining structural and molecular data for more accurate and consistent species identification. Considerable infraspecific genetic variation of globally distributed Spirogyra species was observed across continental scales. This finding suggests that structurally similar species from distant regions may be genetically dissimilar and that Spirogyra may contain a large number of cryptic species. Correlating the morphological and genetic variation within the genus will be a major challenge for future researchers. © 2013 Phycological Society of America.

  7. Comparative gas exchange and growth responses of C3 and C4 beach species grown at different salinities.

    Science.gov (United States)

    De Jong, T M

    1978-01-01

    Comparative laboratory gas exchange and relative growth rate experiments were conducted on three native California coastal strand species at four salinity treatment levels. Relative mesophyll conductance sensitivities to salinity of Atriplex leucophylla (Moq.) D. Dietr. (C4) and Atriplex californica Moq. in D.C. (C3) were nearly identical. Mesophyll conductances of both species were stimulated by moderate levels of salinity. Mesophyll conductances of Abronia maritima Nutt. ex Wats. (C3) were highest in the absence of salinity and depressed by increasing levels of salinity. Increasing levels of salinity generally decreased net photosynthesis and leaf conductances but increased water use efficiencies. The C4 species, Atriplex leucophylla, had higher mesophyll conductances and water use efficiencies at all salinity levels than the C3 species. The effects of salinity on relative growth and net assimilation rates of greenhouse grown plants were not directly correlated with the effects on net photosynthesis measured in the laboratory. Growth of Abronia maritima was greatly stimulated by low levels of salinity whereas photosynthesis was substantially inhibited. The possible significance of C4 photosynthesis in relation to salinity is discussed.

  8. Purification and characterization of a viral chitinase active against plant pathogens and herbivores from transgenic tobacco.

    Science.gov (United States)

    Di Maro, Antimo; Terracciano, Irma; Sticco, Lucia; Fiandra, Luisa; Ruocco, Michelina; Corrado, Giandomenico; Parente, Augusto; Rao, Rosa

    2010-05-03

    The Autographa californica nucleopolyhedrovirus chitinase A (AcMNPV ChiA) is a chitinolytic enzyme with fungicidal and insecticidal properties. Its expression in transgenic plants enhances resistance against pests and fungal pathogens. We exploited tobacco for the production of a biologically active recombinant AcMNPV ChiA (rChiA), as such species is an alternative to traditional biological systems for large-scale enzyme production. The protein was purified from leaves using ammonium sulfate precipitation followed by anion exchange and gel-filtration chromatography. Transgenic plants produced an estimated 14 mg kg(-1) fresh leaf weight, which represents 0.2% of total soluble proteins. The yield of the purification was about 14% (2 mg kg(-1) fresh leaf weight). The comparison between the biochemical and kinetic properties of the rChiA with those of a commercial Serratia marcescens chitinase A indicated that the rChiA was thermostable and more resistant at basic pH, two positive features for agricultural and industrial applications. Finally, we showed that the purified rChiA enhanced the permeability of the peritrophic membrane of larvae of two Lepidoptera (Bombyx mori and Heliothis virescens) and inhibited spore germination and growth of the phytopatogenic fungus Alternaria alternata. The data indicated that tobacco represents a suitable platform for the production of rChiA, an enzyme with interesting features for future applications as "eco-friendly" control agent in agriculture. Published by Elsevier B.V.

  9. Vegetation history along the eastern, desert escarpment of the Sierra San Pedro Mártir, Baja California, Mexico

    Science.gov (United States)

    Holmgren, Camille A.; Betancourt, Julio L.; Rylander, Kate A.

    2011-05-01

    Plant macrofossils from 38 packrat middens spanning the last ~ 33,000 cal yr BP record vegetation between ~ 650 and 900 m elevation along the eastern escarpment of the Sierra San Pedro Mártir, northern Baja California. The middens span most of the Holocene, with a gap between ~ 4600 and 1800 cal yr BP, but coverage in the Pleistocene is uneven with a larger hiatus between 23,100 and 14,400 cal yr BP. The midden flora is relatively stable from the Pleistocene to Holocene. Exceptions include Pinus californiarum, Juniperus californica and other chaparral elements that were most abundant > 23,100 cal yr BP and declined after 14,400 cal yr BP. Despite being near the chaparral/woodland-desertscrub ecotone during glacial times, the midden assemblages reflect none of the climatic reversals evident in the glacial or marine record, and this is corroborated by a nearby semi-continuous pollen stratigraphy from lake sediments. Regular appearance of C 4 grasses and summer-flowering annuals since 13,600 cal yr BP indicates occurrence of summer rainfall equivalent to modern (JAS average of ~ 80-90 mm). This casts doubt on the claim, based on temperature proxies from marine sediments in the Guaymas Basin, that monsoonal development in the northern Gulf and Arizona was delayed until after 6200 cal yr BP.

  10. Ultra-low-power and robust digital-signal-processing hardware for implantable neural interface microsystems.

    Science.gov (United States)

    Narasimhan, S; Chiel, H J; Bhunia, S

    2011-04-01

    Implantable microsystems for monitoring or manipulating brain activity typically require on-chip real-time processing of multichannel neural data using ultra low-power, miniaturized electronics. In this paper, we propose an integrated-circuit/architecture-level hardware design framework for neural signal processing that exploits the nature of the signal-processing algorithm. First, we consider different power reduction techniques and compare the energy efficiency between the ultra-low frequency subthreshold and conventional superthreshold design. We show that the superthreshold design operating at a much higher frequency can achieve comparable energy dissipation by taking advantage of extensive power gating. It also provides significantly higher robustness of operation and yield under large process variations. Next, we propose an architecture level preferential design approach for further energy reduction by isolating the critical computation blocks (with respect to the quality of the output signal) and assigning them higher delay margins compared to the noncritical ones. Possible delay failures under parameter variations are confined to the noncritical components, allowing graceful degradation in quality under voltage scaling. Simulation results using prerecorded neural data from the sea-slug (Aplysia californica) show that the application of the proposed design approach can lead to significant improvement in total energy, without compromising the output signal quality under process variations, compared to conventional design approaches.

  11. Acute Sleep Deprivation Blocks Short- and Long-Term Operant Memory in Aplysia.

    Science.gov (United States)

    Krishnan, Harini C; Gandour, Catherine E; Ramos, Joshua L; Wrinkle, Mariah C; Sanchez-Pacheco, Joseph J; Lyons, Lisa C

    2016-12-01

    Insufficient sleep in individuals appears increasingly common due to the demands of modern work schedules and technology use. Consequently, there is a growing need to understand the interactions between sleep deprivation and memory. The current study determined the effects of acute sleep deprivation on short and long-term associative memory using the marine mollusk Aplysia californica, a relatively simple model system well known for studies of learning and memory. Aplysia were sleep deprived for 9 hours using context changes and tactile stimulation either prior to or after training for the operant learning paradigm, learning that food is inedible (LFI). The effects of sleep deprivation on short-term (STM) and long-term memory (LTM) were assessed. Acute sleep deprivation prior to LFI training impaired the induction of STM and LTM with persistent effects lasting at least 24 h. Sleep deprivation immediately after training blocked the consolidation of LTM. However, sleep deprivation following the period of molecular consolidation did not affect memory recall. Memory impairments were independent of handling-induced stress, as daytime handled control animals demonstrated no memory deficits. Additional training immediately after sleep deprivation failed to rescue the induction of memory, but additional training alleviated the persistent impairment in memory induction when training occurred 24 h following sleep deprivation. Acute sleep deprivation inhibited the induction and consolidation, but not the recall of memory. These behavioral studies establish Aplysia as an effective model system for studying the interactions between sleep and memory formation.

  12. California Rare Endemics and Climate Change

    Science.gov (United States)

    Espinoza, M.

    2010-12-01

    California is known for its wide variety of endemic flora, from its annuals such as the Eschscholzia californica (California poppy) to the perennials like the Arctostaphylos pallida (Alameda manzanita), which happens to be a rare species. Each species plays an important role in the biodiversity of California, yet there are species that are threatened, not only by human interaction and urbanization, but by climate change. Species that we seldom see are now on the verge of becoming eradicated; rare endemics similar to Arctostaphylos pallida are now facing a new challenge that may severely impair their survival. The climate has changed significantly over the twentieth century and it has affected the distribution of rare endemics in California, both geographically as well as within their climatic and edaphic niches. Lilaeopsis masonii is just one rare endemic, however it serves as a representative of the other 23 species that were studied. Using Maxent, a climate-modeling program, it was viable to construct two climate envelopes of the masonii species: the early century envelope (1930-1959) and the later century envelope (1990-2009). When these two climate envelopes were compared, it became clear that the later century climate envelope had contracted radically, reshaping the climate niche of all rare endemics in California due to an increase in temperature. It is possible to conclude that the future of rare endemics hangs in the balance, where one degree higher in temperature is enough to topple the scale.

  13. “Self” and “Non-Self” in the Control of Phytoalexin Biosynthesis: Plant Phospholipases A2 with Alkaloid-Specific Molecular Fingerprints

    Science.gov (United States)

    Heinze, Michael; Brandt, Wolfgang; Marillonnet, Sylvestre; Roos, Werner

    2015-01-01

    The overproduction of specialized metabolites requires plants to manage the inherent burdens, including the risk of self-intoxication. We present a control mechanism that stops the expression of phytoalexin biosynthetic enzymes by blocking the antecedent signal transduction cascade. Cultured cells of Eschscholzia californica (Papaveraceae) and Catharanthus roseus (Apocynaceae) overproduce benzophenanthridine alkaloids and monoterpenoid indole alkaloids, respectively, in response to microbial elicitors. In both plants, an elicitor-responsive phospholipase A2 (PLA2) at the plasma membrane generates signal molecules that initiate the induction of biosynthetic enzymes. The final alkaloids produced in the respective plant inhibit the respective PLA, a negative feedback that prevents continuous overexpression. The selective inhibition by alkaloids from the class produced in the “self” plant could be transferred to leaves of Nicotiana benthamiana via recombinant expression of PLA2. The 3D homology model of each PLA2 displays a binding pocket that specifically accommodates alkaloids of the class produced by the same plant, but not of the other class; for example, C. roseus PLA2 only accommodates C. roseus alkaloids. The interaction energies of docked alkaloids correlate with their selective inhibition of PLA2 activity. The existence in two evolutionary distant plants of phospholipases A2 that discriminate “self-made” from “foreign” alkaloids reveals molecular fingerprints left in signal enzymes during the evolution of species-specific, cytotoxic phytoalexins. PMID:25670767

  14. New measures of insecticidal efficacy and safety obtained with the 39K promoter of a recombinant baculovirus.

    Science.gov (United States)

    Regev, Avital; Rivkin, Hadassah; Gurevitz, Michael; Chejanovsky, Nor

    2006-12-22

    Baculoviruses are orally infectious to insects and considered to be natural insecticides. To enhance their speed-of-kill these viruses were engineered to express arthropod neurotoxins under the control of various strong promoters. Although this strategy proved to be efficient, it raised recently concerns about safety. We analyzed the speed-of-kill and safety of Autographa californica multiple nucleopolyhedrovirus expressing the insecticidal scorpion neurotoxin AaIT and found that the mortality of Helicoverpa armigera larvae was enhanced significantly when the expression was controlled by the baculovirus delayed-early promoter 39K rather than the very late promoter p10. This improvement was also reflected in better protection of cotton leaves on which these insects were fed. Using lacZ as a sensitive reporter we also found that expression driven by the 39K promoter was detected in insect but not in mammalian cells. These results imply that by selection of an appropriate viral promoter, engineered baculoviruses may comply with the high standard biosafety requirements from a genetically modified organism (GMO). Our results provide further support for the potential use of engineered baculoviruses in insect pest control in a safely manner.

  15. A feather precipitation hydrogen isoscape for New Zealand

    Science.gov (United States)

    Rogers, K. M.; Wassenaar, L. I.; Soto, D. X.; Bartle, J. A.

    2012-04-01

    Forensic isotopic assays of feathers from historical Maori cloaks are a potential tool to link historical artefacts back to their native locales (Iwi) in New Zealand. In order to test this approach, we sampled feathers from extant museum archived birds of known origin for their feather hydrogen isotopes (δyHf) to assign their regional origin and location over time. We obtained feathers from two non-migratory bird species widely distributed around New Zealand, tui (Prosthemadera novaeseelandiae) and quail (Callipepla californica). Feathers were sampled from archived birds collected between 1880-2002 held in 3 New Zealand museum collections. We determined regression coefficients of δ2H on location, latitude, δ2Hprecipitation, and age. The data showed that ground dwelling quail had higher regression coefficients with respect to latitude (r2=0.46) than the nectar feeding tui (r2=0.39). On the whole, both resident birds showed promise as regional geographical indicators of their habitat (r2=0.58). Year of collection had no meaningful effect on isotopic composition. We conclude that isotopic assays may therefore be used to aid in regional assignments relevant to the interpretation of historical artefacts.

  16. Molecular Dynamics of Mouse Acetylcholinesterase Complexed with Huperzine A

    Energy Technology Data Exchange (ETDEWEB)

    Tara, Sylvia; Helms, Volkhard H.; Straatsma, TP; Mccammon, J Andrew A.

    1999-03-16

    Two molecular dynamics simulations were performed for a modeled complex of mouse acetylcholinesterase liganded with huperzine A (HupA). Analysis of these simulations shows that HupA shifts in the active site toward Tyr 337 and Phe 338, and that several residues in the active site area reach out to make hydrogen bonds with the inhibitor. Rapid fluctuations of the gorge width are observed, ranging from widths that allow substrate access to the active site, to pinched structures that do not allow access of molecules as small as water. Additional openings or channels to the active site are found. One opening is formed in the side wall of the active site gorge by residues Val 73, Asp 74, Thr 83, Glu 84, and Asn 87. Another opening is formed at the base of the gorge by residues Trp 86, Val 132, Glu 202, Gly 448, and Ile 451. Both of these openings have been observed separately in the Torpedo californica form of the enzyme. These channels could allow transport of waters and ions to and from the bulk solution.

  17. Loss of Genetic Diversity and Increased Subdivision in an Endemic Alpine Stonefly Threatened by Climate Change.

    Directory of Open Access Journals (Sweden)

    Steve Jordan

    Full Text Available Much remains unknown about the genetic status and population connectivity of high-elevation and high-latitude freshwater invertebrates, which often persist near snow and ice masses that are disappearing due to climate change. Here we report on the conservation genetics of the meltwater stonefly Lednia tumana (Ricker of Montana, USA, a cold-water obligate species. We sequenced 1530 bp of mtDNA from 116 L. tumana individuals representing "historic" (>10 yr old and 2010 populations. The dominant haplotype was common in both time periods, while the second-most-common haplotype was found only in historic samples, having been lost in the interim. The 2010 populations also showed reduced gene and nucleotide diversity and increased genetic isolation. We found lower genetic diversity in L. tumana compared to two other North American stonefly species, Amphinemura linda (Ricker and Pteronarcys californica Newport. Our results imply small effective sizes, increased fragmentation, limited gene flow, and loss of genetic variation among contemporary L. tumana populations, which can lead to reduced adaptive capacity and increased extinction risk. This study reinforces concerns that ongoing glacier loss threatens the persistence of L. tumana, and provides baseline data and analysis of how future environmental change could impact populations of similar organisms.

  18. Bombyx mori nucleopolyhedrovirus encodes a DNA-binding protein capable of destabilizing duplex DNA.

    Science.gov (United States)

    Mikhailov, V S; Mikhailova, A L; Iwanaga, M; Gomi, S; Maeda, S

    1998-04-01

    A DNA-binding protein (designated DBP) with an apparent molecular mass of 38 kDa was purified to homogeneity from BmN cells (derived from Bombyx mori) infected with the B. mori nucleopolyhedrovirus (BmNPV). Six peptides obtained after digestion of the isolated protein with Achromobacter protease I were partially or completely sequenced. The determined amino acid sequences indicated that DBP was encoded by an open reading frame (ORF16) located at nucleotides (nt) 16189 to 17139 in the BmNPV genome (GenBank accession no. L33180). This ORF (designated dbp) is a homolog of Autographa californica multicapsid NPV ORF25, whose product has not been identified. BmNPV DBP is predicted to contain 317 amino acids (calculated molecular mass of 36.7 kDa) and to have an isoelectric point of 7.8. DBP showed a tendency to multimerization in the course of purification and was found to bind preferentially to single-stranded DNA. When bound to oligonucleotides, DBP protected them from hydrolysis by phage T4 DNA polymerase-associated 3'-->5' exonuclease. The sizes of the protected fragments indicated that a binding site size for DBP is about 30 nt per protein monomer. DBP, but not BmNPV LEF-3, was capable of unwinding partial DNA duplexes in an in vitro system. This helix-destabilizing ability is consistent with the prediction that DBP functions as a single-stranded DNA binding protein in virus replication.

  19. Yeast Biodiversity in Vineyard Environments Is Increased by Human Intervention.

    Directory of Open Access Journals (Sweden)

    João Drumonde-Neves

    Full Text Available One hundred and five grape samples were collected during two consecutive years from 33 locations on seven oceanic islands of the Azores Archipelago. Grape samples were obtained from vineyards that were either abandoned or under regular cultivation involving common viticultural interventions, to evaluate the impact of regular human intervention on grape yeast biota diversity in vineyards. A total of 3150 yeast isolates were obtained and 23 yeast species were identified. The predominant species were Hanseniaspora uvarum, Pichia terricola, Starmerella bacillaris and Issatchenkia hanoiensis. The species Barnettozyma californica, Candida azymoides and Pichia cecembensis were reported in grapes or wine-associated environments for the first time. A higher biodiversity was found in active vineyards where regular human intervention takes place (Shannon index: 1.89 and 1.53 in the first and second years, respectively when compared to the abandoned ones (Shannon index: 0.76 and 0.31. This finding goes against the assumptions that human intervention can destroy biodiversity and lead to homogeneity in the environment. Biodiversity indices were considerably lower in the year with the heaviest rainfall. This study is the first to report on the grape yeast communities from several abandoned vineyards that have undergone no human intervention.

  20. A picture is worth a thousand data points: an imagery dataset of paired shrub-open microsites within the Carrizo Plain National Monument.

    Science.gov (United States)

    Noble, Taylor J; Lortie, Christopher J; Westphal, Michael; Butterfield, H Scott

    2016-09-27

    Carrizo Plain National Monument (San Joaquin Desert, California, USA) is home to many threatened and endangered species including the blunt-nosed leopard lizard (Gambelia sila). Vegetation is dominated by annual grasses, and shrubs such as Mormon tea (Ephedra californica), which is of relevance to our target species, the federally listed blunt-nosed leopard lizard, and likely also provides key ecosystem services. We used relatively nonintrusive camera traps, or trail cameras, to capture interactions between animals and these shrubs using a paired shrub-open deployment. Cameras were placed within the shrub understory and in open microhabitats at ground level to estimate animal activity and determine species presence. Twenty cameras were deployed from April 1st, 2015 to July 5th, 2015 at paired shrub-open microsites at three locations. Over 425,000 pictures were taken during this time, of which 0.4 % detected mammals, birds, insects, and reptiles including the blunt-nosed leopard lizard. Trigger rate was very high on the medium sensitivity camera setting in this desert ecosystem, and rates did not differ between microsites. Camera traps are an effective, less invasive survey method for collecting data on the presence or absence of desert animals in shrub and open microhabitats. A more extensive array of cameras within an arid region would thus be an effective tool to estimate the presence of desert animals and potentially detect habitat use patterns.

  1. Coltsfoot as a potential cause of deep vein thrombosis and pulmonary embolism in a patient also consuming kava and blue vervain.

    Science.gov (United States)

    Freshour, Jessica E; Odle, Brian; Rikhye, Somi; Stewart, David W

    2012-09-01

    To report a case of deep vein thrombosis (DVT) with symptomatic pulmonary embolism (PE) possibly associated with the use of coltsfoot, kava, or blue vervain. A 27-year-old white male presented with leg pain and swelling, tachycardia, and pleuritic chest pain. He had no significant medical history. A medication history revealed extensive herbal medication use including: coltsfoot, passionflower, red poppy flower petals, wild lettuce, blue lily flowers, wild dagga flowers, Diviners Three Burning Blend® (comprised of salvia divinorum, blue lily, and wild dagga), kava-kava, St. John's Wort, blue vervain, and Dreamer's Blend® (comprised of Calea zacatechichi, vervain, Entada rheedii, wild lettuce, and Eschscholzia californica). Lower extremity Doppler ultrasound and computed topography (CT) of the chest revealed DVT and PE. A hypercoagulable work-up was negative. The patient was treated with enoxaparin and warfarin and was discharged home. While no distinct agent can be identified as a sole cause of this venous thromboembolic event, coltsfoot could potentially affect coagulation through its effect on vascular endothelial cells as they regulate nitric oxide. Nitric oxide is a known mediator of platelet activity and coagulation, particularly in the pulmonary vasculature. Kava and vervain have estrogenic properties. Of the medications consumed by this self-proclaimed "herbalist," coltsfoot is a potential cause of venous thromboembolic disease (VTE).

  2. Earthworms from Matsu, Taiwan with descriptions of new species of the genera Amynthas (Oligochaeta: Megascolecidae) and Drawida (Oligochaeta: Moniligastridae).

    Science.gov (United States)

    Shen, Huei-Ping; Chang, Chih-Han; Chih, Wen-Jay

    2015-06-18

    In 2012, we conducted earthworm surveys in Matsu Islands, and described five new species of the genera Amynthas and Metaphire and reported two new records, Desmogaster sinensis Gates, 1930 and Ocnerodrilus occidentalis Eisen, 1878. This paper describes three new species, one of them with two new subspecies, Amynthas nanganensis nanganensis sp. nov. et ssp. nov. and Amynthas nanganensis beiganensis ssp. nov., Drawida beiganica sp. nov. and Drawida dongyinica sp. nov., provides a new record of Drawida koreana Kobayashi, 1938 from the remaining specimens collected in the surveys, reports DNA barcodes (the 5' end sequences of the mitochondrial cytochrome c oxidase subunit 1 gene) from type specimens and further reference specimens of the new species, and lists a total of 27 earthworm species and subspecies found from Matsu Islands. Pheretimoid earthworms made up 66.7% of the total number of the species, with Metaphire matsuensis Shen, 2014 and Metaphire californica (Kinberg, 1867) the most dominant. Our findings indicate that the earthworm fauna of Matsu Islands is more closely related to that of warm temperate China than to Taiwan or tropical southern China.

  3. Sequences and phylogeny analysis of rbcL gene in marine chlorophyta

    Science.gov (United States)

    Shen, Songdong; Li, Yanyan; Wu, Xunjian; Ding, Lanping

    2010-06-01

    The rbcL gene of Ulva pertusa, Enteromorpha prolifera and Monostroma grevillei was amplified, sequenced and analyzed. By comparing the rbcL sequences with seven other Ulvales species retrieved from GenBank, the sequence divergences and the phyletic evolution were analyzed and the phylogenetic tree was constructed. From the phylogenetic tree, it can be found that U. pertusa, E. prolifera and U. californica group in one branch, while E. compressa, U. rigida and U. fenestrata cluster in another clade. Obviously, unlike the Enteomorpha species, the Ulva species do not gather in one branch. Therefore Ulva and Enteomorpha might be affiliates of one genus. E. compressa and E. intestinalis gathered together, which coincided with the morphological characters. However, the thallus of U. pertusa is thick and with many holes, which is different from E. prolifera in morphology. They cluster together in the phylogenetic tree with a genetic distance of 0.005. The results indicate that Ulva and Enteromorpha are not distinguished strictly.

  4. Three novel species of coccoid green algae within the Watanabea clade (Trebouxiophyceae, Chlorophyta).

    Science.gov (United States)

    Song, Huiyin; Hu, Yuxin; Zhu, Huan; Wang, Qinghua; Liu, Guoxiang; Hu, Zhengyu

    2016-12-01

    Coccoid green algae are extremely diverse despite their simple coccoid phenotype, a phenotype that may be the result of convergent evolution. In this study, we used a polyphasic approach combining molecular phylogenetic analyses, morphology and ultrastructure to investigate isolated coccoid strains from China, and our results reveal three new lineages of Trebouxiophyceae: the novel genus and species Mysteriochloris nanningensis gen. et sp. nov., and the two novel species Phyllosiphon coccidium sp. nov. and Desertella yichangensis sp. nov. (Trebouxiophyceae, Chlorophyta). We provide a detailed characterization of the novel microalgae which they are autosporic coccoid unicells and have parietal chloroplasts. In phylogenies based on 18S rDNA sequences and the chloroplast ribulose-bisphosphate carboxylase gene (rbcL), these three algae are nested within the Watanabea clade and are different from any known algae. M. nanningensis FACHB-1787 is not really close to any known algae within the Watanabea clade. Phyllosiphoncoccidium FACHB-2212 is within the Phyllosiphon lineages. D. yichangensis FACHB-1793 is closely related to Desertella californica and described as a representative of a novel species of the genus Desertella.

  5. Identification of a conserved non-protein-coding genomic element that plays an essential role in Alphabaculovirus pathogenesis.

    Directory of Open Access Journals (Sweden)

    Irina Kikhno

    Full Text Available Highly homologous sequences 154-157 bp in length grouped under the name of "conserved non-protein-coding element" (CNE were revealed in all of the sequenced genomes of baculoviruses belonging to the genus Alphabaculovirus. A CNE alignment led to the detection of a set of highly conserved nucleotide clusters that occupy strictly conserved positions in the CNE sequence. The significant length of the CNE and conservation of both its length and cluster architecture were identified as a combination of characteristics that make this CNE different from known viral non-coding functional sequences. The essential role of the CNE in the Alphabaculovirus life cycle was demonstrated through the use of a CNE-knockout Autographa californica multiple nucleopolyhedrovirus (AcMNPV bacmid. It was shown that the essential function of the CNE was not mediated by the presumed expression activities of the protein- and non-protein-coding genes that overlap the AcMNPV CNE. On the basis of the presented data, the AcMNPV CNE was categorized as a complex-structured, polyfunctional genomic element involved in an essential DNA transaction that is associated with an undefined function of the baculovirus genome.

  6. The UGA-CiE1 cell line from Chrysodeixis includens exhibits characteristics of granulocytes and is permissive to infection by two viruses.

    Science.gov (United States)

    Johnson, Jena A; Bitra, Kavita; Zhang, Shu; Wang, Lihua; Lynn, Dwight E; Strand, Michael R

    2010-05-01

    The soybean looper, Chrysodeixis (Pseudoplusia) includens (Lepidoptera: Noctuidae) is an economically important insect pest and a highly permissive host for the parasitoid Microplitis demolitor and its associated polydnavirus M. demolitor bracovirus (MdBV). Here we established a cell line from C. includens embryos designated UGA-CiE1 cells. CiE1 cells morphologically resemble granulocytes, which are a subpopulation of C. includens hemocytes. Antibody and RT-PCR analyses indicated that CiE1 cells express several molecular and functional markers that identify granulocytes. We further determined that CiE1 cells are permissive to infection by MdBV, exhibiting alterations very similar to MdBV-infected granulocytes, and Autographa californica multiple nucleopolyhedrosis virus (AcMNPV). Combined with the ability to transfect CiE1 cells with high efficiency and knock down expression of viral genes by RNA interference, we conclude this cell line has several attributes of value for studying immune interactions with polydnaviruses and potentially other pathogens. Copyright 2010 Elsevier Ltd. All rights reserved.

  7. Vegetation history along the eastern, desert escarpment of the Sierra San Pedro Mártir, Baja California, Mexico

    Science.gov (United States)

    Holmgren, Camille A.; Betancourt, Julio L.; Rylander, Kate A.

    2011-01-01

    Plant macrofossils from 38 packrat middens spanning the last ~ 33,000 cal yr BP record vegetation between ~ 650 and 900 m elevation along the eastern escarpment of the Sierra San Pedro Mártir, northern Baja California. The middens span most of the Holocene, with a gap between ~ 4600 and 1800 cal yr BP, but coverage in the Pleistocene is uneven with a larger hiatus between 23,100 and 14,400 cal yr BP. The midden flora is relatively stable from the Pleistocene to Holocene. Exceptions include Pinus californiarum, Juniperus californica and other chaparral elements that were most abundant > 23,100 cal yr BP and declined after 14,400 cal yr BP. Despite being near the chaparral/woodland-desertscrub ecotone during glacial times, the midden assemblages reflect none of the climatic reversals evident in the glacial or marine record, and this is corroborated by a nearby semi-continuous pollen stratigraphy from lake sediments. Regular appearance of C4 grasses and summer-flowering annuals since 13,600 cal yr BP indicates occurrence of summer rainfall equivalent to modern (JAS average of ~ 80–90 mm). This casts doubt on the claim, based on temperature proxies from marine sediments in the Guaymas Basin, that monsoonal development in the northern Gulf and Arizona was delayed until after 6200 cal yr BP.

  8. ANATOMIA CANTITATIVĂ A EPIDERMEI LAMINEI FRUNZEI LA VIŢA DE VIE (VITIS L.

    Directory of Open Access Journals (Sweden)

    Valentin CODREANU

    2016-05-01

    Full Text Available Pentru a evidenţia caracterele adaptive ale rezistenţei la secetă a viţei de vie, sunt calculate valorile biometrice a 11 caractere anatomice ale epidermei laminei frunzei la 15 specii ale genului Vitis L. şi la 15 soiuri de viţă de vie locale ale speciei Vitis vinifera L.Tipul morfologic actinocit al aparatelor (complexelor stomatice este caracteristic pentru epiderma abaxială a laminei frunzei la viţa de vie (Vitis L..Speciile genului Vitis L. – Vitis californica, V. sylvestris – şi soiurile viţei de vie locale – Coarna neagră, Copciac, Plavae – s-au dovedit a fi mai adaptate la condiţiile concrete de viaţă, deoarece ele nu şi-au schimbat semnificativ den­sitatea stomatelor în anul 2008, an ce a urmat după anul secetos 2007.Mai adaptabile la noile condiţii de viaţă sunt speciile V. monticola, V. rupestris, V.solonis şi soiurile de viţă de vie locale Feteasca neagră şi Rara neagră, la care densitatea stomatelor s-au schimbat destul de mult în anul 2008.Este elaborată metoda de determinare a ariei medii a stomatelor şi a celulelor bazale ale epidermei abaxiale a laminei frunzei la viţa de vie (Vitis L..  THE QUANTITATIVE ANATOMY OF LEAF BLADE EPIDERMIS OF GRAPEVINE (VITIS L.In order to revial adaptable characters of drought resistance of grapevine, are calculated the biometric values of 11 anatomic characters of leaf blade epidermis at 15 species of genus Vitis L. and 15 local cultivars of species Vitis vinifera L.The stomatal density per 1 mm2 of foliar area is specific and sortspecific and varies from 101,14 stomata/mm2, at local sort Rara neagră to 225,50 stomata/mm2, at Vitis silvestris.The stomatal complex of leaf blade abaxial epidermis of studied species and cultivars of grapevine is of actinocytic type and it is characteristic for the genus Vitis L.The species of genus Vitis L. – V. californica, V. sylvestris – and local cultivars – Coarna neagră, Copciac and Plavae – are more adaptable

  9. Shark fisheries in the Southeast Pacific: A 61-year analysis from Peru.

    Science.gov (United States)

    Gonzalez-Pestana, Adriana; Kouri J, Carlos; Velez-Zuazo, Ximena

    2014-01-01

    Peruvian waters exhibit high conservation value for sharks. This contrasts with a lag in initiatives for their management and a lack of studies about their biology, ecology and fishery. We investigated the dynamics of Peruvian shark fishery and its legal framework identifying information gaps for recommending actions to improve management. Further, we investigated the importance of the Peruvian shark fishery from a regional perspective. From 1950 to 2010, 372,015 tons of sharks were landed in Peru. From 1950 to 1969, we detected a significant increase in landings; but from 2000 to 2011 there was a significant decrease in landings, estimated at 3.5% per year. Six species represented 94% of landings: blue shark ( Prionace glauca), shortfin mako ( Isurus oxyrinchus), smooth hammerhead ( Sphyrna zygaena), common thresher ( Alopias vulpinus), smooth-hound ( Mustelus whitneyi) and angel shark ( Squatina californica). Of these, the angel shark exhibits a strong and significant decrease in landings: 18.9% per year from 2000 to 2010. Peru reports the highest accumulated historical landings in the Pacific Ocean; but its contribution to annual landings has decreased since 1968. Still, Peru is among the top 12 countries exporting shark fins to the Hong Kong market. Although the government collects total weight by species, the number of specimens landed as well as population parameters (e.g. sex, size and weight) are not reported. Further, for some genera, species-level identification is deficient and so overestimates the biomass landed by species and underestimates the species diversity. Recently, regional efforts to regulate shark fishery have been implemented to support the conservation of sharks but in Peru work remains to be done.

  10. Mechanism of acute silver toxicity in marine invertebrates.

    Science.gov (United States)

    Bianchini, Adalto; Playle, Richard C; Wood, Chris M; Walsh, Patrick J

    2005-03-25

    In freshwater crustaceans and in both freshwater and marine fish, the key mechanism of acute silver toxicity involves ionoregulatory impairment. An inhibition of the Na+ ,K+-ATPase located at the basolateral membrane of the gill epithelium seems to be the key site for silver toxicity. However, studies to determine if the same mechanism of toxicity is occurring in marine invertebrates, which also are ionoregulators, had not been done. Thus, the present study was carried out to determine acute silver effects on hemolymph osmo- and ionoregulation in three marine invertebrates: the shrimp Penaeus duorarum, the sea hare Aplysia californica, and the sea urchin Diadema antillarum. Animals were exposed to silver (1 or 10 microg/L), as silver nitrate, in seawater for 48 h. Results show that acute silver exposure did not affect hemolymph osmolality or ion concentration (Na+, Cl-, K+, Ca2+ and Mg2+) in the three species studied. However, silver induced significant changes in the water content in shrimp gill and sea hare gill and hepatopancreas. Silver also caused significant changes in Na+ ,K+-ATPase activity and in both total and intracellular ion (Cl-, Na+, K+, Mg2+, and Ca2+) concentrations in different tissues of the three species studied. Overall, these results show that the key mechanism of acute silver toxicity in marine invertebrates is not associated with an osmotic or ionoregulatory impairment at the hemolymph level, as observed in freshwater fish and crustaceans and in seawater fish. However, they indicate that acute waterborne silver induces significant changes in Na+ ,K(+)-ATPase activity and probably affects other mechanisms involved in water and ion transport at the cell membrane level, inducing impairments in water and ion regulation at the cellular level in different tissues of marine invertebrates. These results indicate the need to consider other "toxic sites" than gills in any future extension of the biotic ligand model (BLM) for seawater.

  11. Opposed ciliary bands in the feeding larvae of sabellariid annelids.

    Science.gov (United States)

    Pernet, Bruno; Strathmann, Richard R

    2011-06-01

    The larvae of marine annelids capture food using an unusual diversity of suspension-feeding mechanisms. Many of the feeding mechanisms of larval annelids are poorly known despite the abundance and ecological significance of both larvae and adults of some annelid taxa. Here we show that larvae of two species of sabellariid annelids, Sabellaria cementarium and Phragmatopoma californica, bear prototrochal and metatrochal cilia that beat in opposition to each other. For larvae of S. cementarium, we provide evidence that these opposed bands of cilia are used to capture suspended particles. In video recordings, captured particles were overtaken by a prototrochal cilium and then moved with the cilium to the food groove, a band of cilia between the prototroch and metatroch. They were then transported by cilia of the food groove to the mouth. Lengths of the prototrochal cilia, lengths of the prototrochal ciliary band, size range of the particles captured, and estimated rates of clearance increased with larval age and body size. Confirmation of the presence of opposed bands in larvae of sabellariids extends their known occurrence in the annelids to members of 10 families. Opposed bands in these different taxa differ in the arrangements and spacing of prototrochal and metatrochal cilia, and in whether they are used in combination with other feeding mechanisms. Opposed bands appear to be particularly widespread among the larvae of sabellidan annelids (a clade that includes sabellariids, sabellids, and serpulids), even in some species whose larvae do not feed. A parsimony analysis suggests that opposed bands are ancestral in this clade of annelids.

  12. A Creek to Bay Biological Assessment in Oakland, California

    Science.gov (United States)

    Ahumada, E.; Ramirez, N.; Lopez, A.; Avila, M.; Ramirez, J.; Arroyo, D.; Bracho, H.; Casanova, A.; Pierson, E.

    2011-12-01

    In 2007, the Surface Water Ambient Monitoring Program (SWAMP) assessed the impact of trash on water quality in the Peralta Creek which is located in the Fruitvale district of Oakland, CA. This 2011 follow-up study will take further steps in evaluating the physical and biological impacts of pollution and human development on Peralta Creek and in the San Leandro Bay, where the Creek empties into the larger San Francisco Bay estuary. This study will utilize two forms of biological assessment in order to determine the level of water quality and ecosystem health of Peralta Creek and San Leandro Bay in Oakland, California. A Rapid Bioassesment Protocal (RBP) will be used as the method of biological assessment for Peralta Creek. RBP uses a biotic index of benthic macroinvertebrates to provide a measure of a water body's health. Larval trematodes found in two mud snails (Ilynassa obsoleta and Cerithidea californica) will be used to evaluate the health of the San Leandro Bay. Due to the complex life cycle of trematodes, the measure of trematode diversity and richness in host species serves as an indicator of estuarine health (Huspeni 2005). We have completed the assessment of one section of Peralta Creek, located at 2465 34th Avenue, Oakland, CA 94601. Abundance results indicate a moderately healthy creek because there were high levels of pollution tolerant benthic macroinvertebrates. The tolerant group of benthic macroinvertebrates includes such organisms as flatworms, leeches, and scuds. This is possibly due to this section of the creek being pumped up to the surface from culverts impacting the macroinvertebrate's life cycle. Another contributing factor to creek health is the amount of organic debris found in the creek, which inhibits the flow and oxygenation of the water, allowing for more pollution tolerant aquatic insects to persist. Further investigation is being conducted to fully assess the Peralta Creek watershed; from the preliminary results one can surmise that

  13. Silicoflagellate Fluxes in Cuenca Alfonso, Mexico During the 2002-2003 El Niño Event

    Science.gov (United States)

    Alvarez, I. G.; Martínez-López, A.; Silverberg, N.

    2007-05-01

    Changes in the circulation and water mass patterns in the Gulf of California are closely associated with changes in atmospheric circulation. At the interannual scale, such changes are associated with events like El Niño, which in the Gulf are characterized by greater penetration of tropical-equatorial water. Subsamples of sediment trap material, collected between January 2002 and February 2004 were examined with the aim of inferring average oceanographic conditions in Cuenca Alfonso, Bahia de La Paz and those during the relatively mild 2002- 03 El Niño. Analysis of the silicoflagellate data series reveals seasonal and interannual relationships between the silicoflagellate fluxes and the dynamics of the water column. Comparison of silicoflagellate fluxes with those of the diatom group indicate that the former represent 0-52% of their combined flux. Both silicate groups generally co-vary but show differences in intensity. Thirteen taxa made up the silicoflagellate species composition. The simultaneous occurrence of Dictyocha epiodon and Distephanus speculum with Dictyocha calida and Dictyocha californica during August 2002 to May 2003, indicated the presence of both California Current Water and Equatorial Surface Water in the area close to Cuenca Alfonso. This favored the increase, mainly in November-December, in the flux of the dominant species, Octactis pulchra (as high as 7 x 106 skeletons m-2 day-1). Spring, on the other hand, was notable for a drop in the total silicoflagellate flux, probably due to the influence of the El Niño event. The subsequent increase in species typical of warm water and the replacement of the dominant species (O. pulchra) by Dictyocha messanensis var messanensis, suggest that the effects of El Niño extended to the fall of 2003.

  14. First detection of the larval chalkbrood disease pathogen Ascosphaera apis (Ascomycota: Eurotiomycetes: Ascosphaerales) in adult bumble bees.

    Science.gov (United States)

    Maxfield-Taylor, Sarah A; Mujic, Alija B; Rao, Sujaya

    2015-01-01

    Fungi in the genus Ascosphaera (Ascomycota: Eurotiomycetes: Ascosphaerales) cause chalkbrood disease in larvae of bees. Here, we report the first-ever detection of the fungus in adult bumble bees that were raised in captivity for studies on colony development. Wild queens of Bombus griseocollis, B. nevadensis and B. vosnesenskii were collected and maintained for establishment of nests. Queens that died during rearing or that did not lay eggs within one month of capture were dissected, and tissues were examined microscopically for the presence of pathogens. Filamentous fungi that were detected were plated on artificial media containing broad spectrum antibiotics for isolation and identification. Based on morphological characters, the fungus was identified as Ascosphaera apis (Maasen ex Claussen) Olive and Spiltoir, a species that has been reported earlier only from larvae of the European honey bee, Apis mellifera, the Asian honey bee, Apis cerana, and the carpenter bee Xylocopa californica arizonensis. The identity of the fungus was confirmed using molecular markers and phylogenetic analysis. Ascosphaera apis was detected in queens of all three bumble bee species examined. Of 150 queens dissected, 12 (8%) contained vegetative and reproductive stages of the fungus. Both fungal stages were also detected in two workers collected from colonies with Ascosphaera-infected B. nevadensis queens. In this study, wild bees could have been infected prior to capture for rearing, or, the A. apis infection could have originated via contaminated European honey bee pollen fed to the bumble bees in captivity. Thus, the discovery of A. apis in adult bumble bees in the current study has important implications for commercial production of bumble bee colonies and highlights potential risks to native bees via pathogen spillover from infected bees and infected pollen.

  15. Comparative activity of baculoviruses against the codling moth Cydia pomonella and three other tortricid pests of tree fruit.

    Science.gov (United States)

    Lacey, L A; Vail, P V; Hoffmann, D F

    2002-05-01

    The granulovirus of Cydia pomonella (L.) (CpGV) offers potential for selective control of codling moth. Two major limitations of CpGV are its narrow host range and lack of persistence in the orchard agroecosystem. The nucleopolyhedroviruses of the alfalfa looper Autographa californica (Speyer) (AcMNPV) and those of the celery looper Anagrapha falcifera (Kirby) (AfMNPV) have broad host ranges. Comparative assays of CpGV, AcMNPV, and AfMNPV against codling moth neonate larvae revealed a 54-93-fold greater susceptibility of codling moth to the granulovirus than to the two nucleopolyhedroviruses based on the LC(50) values for each virus. The LC(50)s for CpGV, AfMNPV, and AcMNPV were 32.7 capsules/mm(2), 1.77 x 10(3) occlusion bodies (OBs)/mm(2), and 3.05 x 10(3)OBs/mm(2), respectively. The LT(50) determined for AfMNPV using an approximate LC(95) of the virus against neonate larvae was 3.6 days. Histological examination of tissues in moribund codling moth larvae that had been treated with AfMNPV revealed the presence of nonoccluded and unenveloped virus rods in midgut tissue. Neither OBs nor signs of infection were detected in other tissues. The activity of AfMNPV was also evaluated in three other tortricid apple pests (obliquebanded leafroller, Choristoneura rosaceana (Harris); Pandemis leafroller, Pandemis pyrusana Kearfott; and the oriental fruit moth, Grapholitha molesta (Busck)). Codling and Oriental fruit moths were significantly more susceptible to AfMNPV than were the two leafroller species.

  16. 6-Bromohypaphorine from Marine Nudibranch Mollusk Hermissenda crassicornis is an Agonist of Human α7 Nicotinic Acetylcholine Receptor

    Directory of Open Access Journals (Sweden)

    Igor E. Kasheverov

    2015-03-01

    Full Text Available 6-Bromohypaphorine (6-BHP has been isolated from the marine sponges Pachymatisma johnstoni, Aplysina sp., and the tunicate Aplidium conicum, but data on its biological activity were not available. For the nudibranch mollusk Hermissenda crassicornis no endogenous compounds were known, and here we describe the isolation of 6-BHP from this mollusk and its effects on different nicotinic acetylcholine receptors (nAChR. Two-electrode voltage-clamp experiments on the chimeric α7 nAChR (built of chicken α7 ligand-binding and glycine receptor transmembrane domains or on rat α4β2 nAChR expressed in Xenopus oocytes revealed no action of 6-BHP. However, in radioligand analysis, 6-BHP competed with radioiodinated α-bungarotoxin for binding to human α7 nAChR expressed in GH4C1 cells (IC50 23 ± 1 μM, but showed no competition on muscle-type nAChR from Torpedo californica. In Ca2+-imaging experiments on the human α7 nAChR expressed in the Neuro2a cells, 6-BHP in the presence of PNU120596 behaved as an agonist (EC50 ~80 μM. To the best of our knowledge, 6-BHP is the first low-molecular weight compound from marine source which is an agonist of the nAChR subtype. This may have physiological importance because H. crassicornis, with its simple and tractable nervous system, is a convenient model system for studying the learning and memory processes.

  17. Marine Natural Products Acting on the Acetylcholine-Binding Protein and Nicotinic Receptors: From Computer Modeling to Binding Studies and Electrophysiology

    Directory of Open Access Journals (Sweden)

    Denis Kudryavtsev

    2014-03-01

    Full Text Available For a small library of natural products from marine sponges and ascidians, in silico docking to the Lymnaea stagnalis acetylcholine-binding protein (AChBP, a model for the ligand-binding domains of nicotinic acetylcholine receptors (nAChRs, was carried out and the possibility of complex formation was revealed. It was further experimentally confirmed via competition with radioiodinated α-bungarotoxin ([125I]-αBgt for binding to AChBP of the majority of analyzed compounds. Alkaloids pibocin, varacin and makaluvamines С and G had relatively high affinities (Ki 0.5–1.3 μM. With the muscle-type nAChR from Torpedo californica ray and human neuronal α7 nAChR, heterologously expressed in the GH4C1 cell line, no competition with [125I]-αBgt was detected in four compounds, while the rest showed an inhibition. Makaluvamines (Ki ~ 1.5 μM were the most active compounds, but only makaluvamine G and crambescidine 359 revealed a weak selectivity towards muscle-type nAChR. Rhizochalin, aglycone of rhizochalin, pibocin, makaluvamine G, monanchocidin, crambescidine 359 and aaptamine showed inhibitory activities in electrophysiology experiments on the mouse muscle and human α7 nAChRs, expressed in Xenopus laevis oocytes. Thus, our results confirm the utility of the modeling studies on AChBPs in a search for natural compounds with cholinergic activity and demonstrate the presence of the latter in the analyzed marine biological sources.

  18. Accumulation of medium-chain, saturated fatty acyl moieties in seed oils of transgenic Camelina sativa.

    Science.gov (United States)

    Hu, Zhaohui; Wu, Qian; Dalal, Jyoti; Vasani, Naresh; Lopez, Harry O; Sederoff, Heike W; Qu, Rongda

    2017-01-01

    With its high seed oil content, the mustard family plant Camelina sativa has gained attention as a potential biofuel source. As a bioenergy crop, camelina has many advantages. It grows on marginal land with low demand for water and fertilizer, has a relatively short life cycle, and is stress tolerant. As most other crop seed oils, camelina seed triacylglycerols (TAGs) consist of mostly long, unsaturated fatty acyl moieties, which is not desirable for biofuel processing. In our efforts to produce shorter, saturated chain fatty acyl moieties in camelina seed oil for conversion to jet fuel, a 12:0-acyl-carrier thioesterase gene, UcFATB1, from California bay (Umbellularia californica Nutt.) was expressed in camelina seeds. Up to 40% of short chain laurate (C12:0) and myristate (C14:0) were present in TAGs of the seed oil of the transgenics. The total oil content and germination rate of the transgenic seeds were not affected. Analysis of positions of these two fatty acyl moieties in TAGs indicated that they were present at the sn-1 and sn-3 positions, but not sn-2, on the TAGs. Suppression of the camelina KASII genes by RNAi constructs led to higher accumulation of palmitate (C16:0), from 7.5% up to 28.5%, and further reduction of longer, unsaturated fatty acids in seed TAGs. Co-transformation of camelina with both constructs resulted in enhanced accumulation of all three medium-chain, saturated fatty acids in camelina seed oils. Our results show that a California bay gene can be successfully used to modify the oil composition in camelina seed and present a new biological alternative for jet fuel production.

  19. Accumulation of medium-chain, saturated fatty acyl moieties in seed oils of transgenic Camelina sativa.

    Directory of Open Access Journals (Sweden)

    Zhaohui Hu

    Full Text Available With its high seed oil content, the mustard family plant Camelina sativa has gained attention as a potential biofuel source. As a bioenergy crop, camelina has many advantages. It grows on marginal land with low demand for water and fertilizer, has a relatively short life cycle, and is stress tolerant. As most other crop seed oils, camelina seed triacylglycerols (TAGs consist of mostly long, unsaturated fatty acyl moieties, which is not desirable for biofuel processing. In our efforts to produce shorter, saturated chain fatty acyl moieties in camelina seed oil for conversion to jet fuel, a 12:0-acyl-carrier thioesterase gene, UcFATB1, from California bay (Umbellularia californica Nutt. was expressed in camelina seeds. Up to 40% of short chain laurate (C12:0 and myristate (C14:0 were present in TAGs of the seed oil of the transgenics. The total oil content and germination rate of the transgenic seeds were not affected. Analysis of positions of these two fatty acyl moieties in TAGs indicated that they were present at the sn-1 and sn-3 positions, but not sn-2, on the TAGs. Suppression of the camelina KASII genes by RNAi constructs led to higher accumulation of palmitate (C16:0, from 7.5% up to 28.5%, and further reduction of longer, unsaturated fatty acids in seed TAGs. Co-transformation of camelina with both constructs resulted in enhanced accumulation of all three medium-chain, saturated fatty acids in camelina seed oils. Our results show that a California bay gene can be successfully used to modify the oil composition in camelina seed and present a new biological alternative for jet fuel production.

  20. Arachidonic acid-mediated inhibition of a potassium current in the giant neurons of Aplysia

    Energy Technology Data Exchange (ETDEWEB)

    Carlson, R.O.

    1990-01-01

    Biochemical and electrophysiological approaches were used to investigate the role of arachidonic acid (AA) in the modulation of an inwardly rectifying potassium current (I{sub R}) in the giant neurons of the marine snail, Aplysia californica. Using ({sup 3}H)AA as tracer, the intracellular free AA pool in Aplysia ganglia was found to be in a state of constant and rapid turnover through deacylation and reacylation of phospholipid, primarily phosphatidyl-inositol. This constant turnover was accompanied by a constant release of free AA and eicosanoids into the extracellular medium. The effects of three pharmacological agents were characterized with regard to AA metabolism in Aplysia ganglia. 4-O-tetra-decanoylphorbol 13-acetate (TPA), an activator of protein kinase C, stimulated liberation of AA from phospholipid, and 4-bromophenacylbromide (BPB), an inhibitor of phospholipate A{sub 2}, inhibited this liberation. Indomethacin at 250 {mu}M was found to inhibit uptake of AA, likely through inhibition of acyl-CoA synthetase. These agents were also found to modulate I{sub R} in ways which were consistent with their biological effects: TPA inhibited I{sub R}, and both BPB and indomethacin stimulated I{sub R} . Modulation of I{sub R} by these substances was found not to involve cAMP metabolism. Acute application of exogenous AA did not affect I{sub R}; however, I{sub R} in giant neurons was found to be inhibited after dialysis with AA or other unsaturated fatty acids. Also, after perfusion with BSA overnight, a treatment which strips the giant neurons of AA in lipid storage, I{sub R} was found to have increased over 2-fold. This perfusion-induced increase was inhibited by the presence of AA or by pretreatment of the giant neurons with BPB. These results suggest AA, provided through constant turnover from phospholipid, mediates constitutive inhibition of I{sub R}.

  1. Pluripotent nontumorigenic multilineage differentiating stress enduring cells (Muse cells): a seven-year retrospective.

    Science.gov (United States)

    Fisch, Samantha C; Gimeno, María L; Phan, Julia D; Simerman, Ariel A; Dumesic, Daniel A; Perone, Marcelo J; Chazenbalk, Gregorio D

    2017-10-18

    Multilineage differentiating stress enduring (Muse) cells, discovered in the spring of 2010 at Tohoku University in Sendai, Japan, were quickly recognized by scientists as a possible source of pluripotent cells naturally present within mesenchymal tissues. Muse cells normally exist in a quiescent state, singularly activated by severe cellular stress in vitro and in vivo. Muse cells have the capacity for self-renewal while maintaining pluripotent cell characteristics indicated by the expression of pluripotent stem cell markers. Muse cells differentiate into cells representative of all three germ cell layers both spontaneously and under media-specific induction. In contrast to embryonic stem and induced pluripotent stem cells, Muse cells exhibit low telomerase activity, a normal karyotype, and do not undergo tumorigenesis once implanted in SCID mice. Muse cells efficiently home into damaged tissues and differentiate into specific cells leading to tissue regeneration and functional recovery as described in different animal disease models (i.e., fulminant hepatitis, muscle degeneration, skin ulcers, liver cirrhosis, cerebral stroke, vitiligo, and focal segmental glomerulosclerosis). Circulating Muse cells have been detected in peripheral blood, with higher levels present in stroke patients during the acute phase. Furthermore, Muse cells have inherent immunomodulatory properties, which could contribute to tissue generation and functional repair in vivo. Genetic studies in Muse cells indicate a highly conserved cellular mechanism as seen in more primitive organisms (yeast, Saccharomyces cerevisiae, Caenorhabditis elegans, chlamydomonas, Torpedo californica, drosophila, etc.) in response to cellular stress and acute injury. This review details the molecular and cellular properties of Muse cells as well as their capacity for tissue repair and functional recovery, highlighting their potential for clinical application in regenerative medicine.

  2. A new theraphosid spider toxin causes early insect cell death by necrosis when expressed in vitro during recombinant baculovirus infection.

    Directory of Open Access Journals (Sweden)

    Daniel Mendes Pereira Ardisson-Araújo

    Full Text Available Baculoviruses are the most studied insect viruses in the world and are used for biological control of agricultural and forest insect pests. They are also used as versatile vectors for expression of heterologous proteins. One of the major problems of their use as biopesticides is their slow speed to kill insects. Thus, to address this shortcoming, insect-specific neurotoxins from arachnids have been introduced into the baculovirus genome solely aiming to improve its virulence. In this work, an insecticide-like toxin gene was obtained from a cDNA derived from the venom glands of the theraphosid spider Brachypelma albiceps. The mature form of the peptide toxin (called Ba3 has a high content of basic amino acid residues, potential for three possible disulfide bonds, and a predicted three-stranded β-sheetDifferent constructions of the gene were engineered for recombinant baculovirus Autographa californica multiple nuclepolyhedrovirus (AcMNPV expression. Five different forms of Ba3 were assessed; (1 the full-length sequence, (2 the pro-peptide and mature region, (3 only the mature region, and the mature region fused to an (4 insect or a (5 virus-derived signal peptide were inserted separately into the genome of the baculovirus. All the recombinant viruses induced cell death by necrosis earlier in infection relative to a control virus lacking the toxin gene. However, the recombinant virus containing the mature portion of the toxin gene induced a faster cell death than the other recombinants. We found that the toxin construct with the signal peptide and/or pro-peptide regions delayed the necrosis phenotype. When infected cells were subjected to ultrastructural analysis, the cells showed loss of plasma membrane integrity and structural changes in mitochondria before death. Our results suggest this use of baculovirus is a potential tool to help understand or to identify the effect of insect-specific toxic peptides when produced during infection of insect

  3. Synthesis of selective agonists for the α7 nicotinic acetylcholine receptor with in situ click-chemistry on acetylcholine-binding protein templates.

    Science.gov (United States)

    Yamauchi, John G; Gomez, Kimberly; Grimster, Neil; Dufouil, Mikael; Nemecz, Akos; Fotsing, Joseph R; Ho, Kwok-Yiu; Talley, Todd T; Sharpless, K Barry; Fokin, Valery V; Taylor, Palmer

    2012-10-01

    The acetylcholine-binding proteins (AChBPs), which serve as structural surrogates for the extracellular domain of nicotinic acetylcholine receptors (nAChRs), were used as reaction templates for in situ click-chemistry reactions to generate a congeneric series of triazoles from azide and alkyne building blocks. The catalysis of in situ azide-alkyne cycloaddition reactions at a dynamic subunit interface facilitated the synthesis of potentially selective compounds for nAChRs. We investigated compound sets generated in situ with soluble AChBP templates through pharmacological characterization with α7 and α4β2 nAChRs and 5-hydroxytryptamine type 3A receptors. Analysis of activity differences between the triazole 1,5-syn- and 1,4-anti-isomers showed a preference for the 1,4-anti-triazole regioisomers among nAChRs. To improve nAChR subtype selectivity, the highest-potency building block for α7 nAChRs, i.e., 3α-azido-N-methylammonium tropane, was used for additional in situ reactions with a mutated Aplysia californica AChBP that was made to resemble the ligand-binding domain of the α7 nAChR. Fourteen of 50 possible triazole products were identified, and their corresponding tertiary analogs were synthesized. Pharmacological assays revealed that the mutated binding protein template provided enhanced selectivity of ligands through in situ reactions. Discrete trends in pharmacological profiles were evident, with most compounds emerging as α7 nAChR agonists and α4β2 nAChR antagonists. Triazoles bearing quaternary tropanes and aromatic groups were most potent for α7 nAChRs. Pharmacological characterization of the in situ reaction products established that click-chemistry synthesis with surrogate receptor templates offered novel extensions of fragment-based drug design that were applicable to multisubunit ion channels.

  4. A comparison between two brine shrimp assays to detect in vitro cytotoxicity in marine natural products

    Science.gov (United States)

    Carballo, José Luis; Hernández-Inda, Zaira L; Pérez, Pilar; García-Grávalos, María D

    2002-01-01

    Background The brine shrimp lethality assay is considered a useful tool for preliminary assessment of toxicity. It has also been suggested for screening pharmacological activities in plant extracts. However, we think that it is necessary to evaluate the suitability of the brine shrimp methods before they are used as a general bio-assay to test natural marine products for pharmacological activity. Material and Methods The bioactivity of the isopropanolic (2-PrOH) extracts of 14 species of marine invertebrates and 6 species of macroalgae was evaluated with the shrimp lethality assay (lethality assay), as well as with another assay based on the inhibition of hatching of the cyst (hatchability assay). The extracts were also assayed for cytotoxicity against two human cell lines, lung carcinoma A-549 and colon carcinoma HT-29, in order to assess the sensitivity of the shrimp assays to detect cytotoxic activity. Results Two sponges (Hyatella sp, Dysidea sp.), two gorgonians (Pacifigorgia adamsii, Muricea sp.), one tunicate (Polyclinum laxum), and three echinoderms (Holothuria impatiens, Pseudoconus californica and Pharia pyramidata) showed a strong cytostatic (growth inhibition) and cytotoxic effect. The hatchability assay showed a strong activity in 4 of the species active against the two human cell lines tested (Hyatella sp, Dysidea sp., Pacifigorgia adamsii and Muricea sp.), and the lethality assay also showed a high lethality in 4 of them (Pacifigorgia adamsii, Muricea sp., Polyclinum laxum, and Pharia pyramidata). Each bioassay detected activity in 50% of the species that were considered active against the two human cell lines tested. However, the simultaneous use of both bioassays increased the percentage to 75%. Conclusions Our results seem consistent with the correlation previously established between cytotoxicity and brine shrimp lethality in plant extracts. We suggest using both bioassays simultaneously to test natural marine products for pharmacological

  5. Fire severity and plant age in postfire resprouting of woody plants in sage scrub and chaparral

    Science.gov (United States)

    Keeley, Jon E.

    2006-01-01

    Postfire resprouting by woody plants confers a marked advantage in rate of recovery over species that regenerate entirely from seed. However, the predictability of this advantage varies markedly between species, with some showing nearly 100% rootcrown survival and others often much lower. This study examined patterns of fire-caused mortality and tested the relative importance of fire severity and plant age between various shrubs and subshrubs characteristic of chaparral and sage scrub associations. Resprouting success varied from about 10% for Eriogonum fasciculatum to a high of 98% for Quercus berberidifolia. For most of the shrub species, skeletons of resprouting plants were significantly taller than those of dead individuals of the same species, indicating less biomass consumption, and thus lower severity fires were associated with higher resprouting success. This pattern was less strongly the case with sage scrub species. Shrubs and subshrubs, however, differed in the effect of aboveground plant age (as estimated by basal diameter) on resprouting success. For most chaparral shrubs, age was not related to resprouting success, whereas in four out of five subshrub species, including Artemisia californica, Eriogonum fasciculatum, Salvia leucophylla, and S. mellifera, the youngest plants exhibited the highest resprouting success. I hypothesize that the reason for this inverse relationship between age and resprouting in certain sage scrub species is that, as these subshrubs age, there is a tendency to loose the resprouting ability and the mechanism is quite possibly because adventitious buds responsible for sprouting become buried by woody tissues. Patterns of character evolution in these sage scrub lineages support the hypothesis that the herbaceous perennial mode of seasonal aestivation evolved early and lignification is a more recently derived trait and this may have negative effects on resprouting as the plant ages.

  6. Tissue water relations of four co-occurring chaparral shrubs.

    Science.gov (United States)

    Davis, S D; Mooney, H A

    1986-11-01

    Chaparral shrubs of California have a suite of morphological and physiological adaptations to withstand the prolonged summer droughts of a mediterranean climate. Not all species of chaparral have the same rooting depth and there is some evidence that those with shallow roots have tissue that is most tolerant to water stress. We tested this notion by comparing the tissue water relations of four co-occurring chaparral shrubs: Quercus durata, Heteromeles arbutifolia, Adenostoma fasciculatum, and Rhamnus californica. We used a pressure-volume technique and a dew-point hygrometer to metsure seasonal changes in osmotic potential when plant tissue was fully hydrated and osmotic potential at predawn, midday, and the turgor loss point. We also calculated seasonal changes in the minimum daily turgor potential, saturated weight/dry weight ratio of leaf tissue, and the bulk modulus of elasticity. We had information on the seasonal water use patterns and apparent rooting depths of these same four shrubs from a previous study (Davis and Mooney 1986). All evidence indicated that Rhamnus had shallow roots and Quercus deep roots. Our results indicated that the tissue water relations of our four co-occurring chaparral shrubs were not alike. Even though Rhamnus had shallow roots, it had the least xerophytic tissue. Seasonal osmotic potential and saturated weight/dry weight ratios were relatively high and bulk modulus of elasticity and minimum daily turgor potentials were low. Furthermore, even though Quercus had deep roots and experienced no seasonal water stress at our study site, its tissue water relations indicated relatively high tolerance to water stress. We conclude that seasonal drought tolerance of stem and leaf tissue of co-occurring chaparral shrubs does not necessarily correspond to rooting depth, to soil moisture resources available to the shrub, or to the degree of seasonal water stress experienced by the shrub.

  7. A silencing suppressor protein (NSs) of a tospovirus enhances baculovirus replication in permissive and semipermissive insect cell lines.

    Science.gov (United States)

    Oliveira, Virgínia Carla; Bartasson, Lorrainy; de Castro, Maria Elita Batista; Corrêa, José Raimundo; Ribeiro, Bergmann Morais; Resende, Renato Oliveira

    2011-01-01

    The nonstructural protein (NSs) of the Tomato spotted wilt virus (TSWV) has been identified as an RNAi suppressor in plant cells. A recombinant Autographa californica multiple nucleopolyhedrovirus (AcMNPV) designated vAcNSs, containing the NSs gene under the control of the viral polyhedrin (polh) gene promoter, was constructed and the effects of NSs in permissive, semipermissive and nonpermissive insect cells to vAcNSs infection were evaluated. vAcNSs produced more budded virus when compared to wild type in semipermissive cells. Co-infection of vAcNSs with wild type baculoviruses clearly enhanced polyhedra production in all host cells. Confocal microscopy analysis showed that NSs accumulated in abundance in the cytoplasm of permissive and semipermissive cells. In contrast, high amounts of NSs were detected in the nuclei of nonpermissive cells. Co-infection of vAcNSs with a recombinant AcMNPV containing the enhanced green fluorescent protein (egfp) gene, significantly increased EGFP expression in semipermissive cells and in Anticarsia gemmatalis-hemocytes. Absence of small RNA molecules of egfp transcripts in this cell line and in a permissive cell line indicates the suppression of gene silencing activity. On the other hand, vAcNSs was not able to suppress RNAi in a nonpermissive cell line. Our data showed that NSs protein of TSWV facilitates baculovirus replication in different lepidopteran cell lines, and these results indicate that NSs could play a similar role during TSWV-infection in its thrips vector. Copyright © 2010 Elsevier B.V. All rights reserved.

  8. Photolabeling of membrane-bound Torpedo nicotinic acetylcholine receptor with the hydrophobic probe 3-trifluoromethyl-3-(m-(/sup 125/I)iodophenyl)diazirine

    Energy Technology Data Exchange (ETDEWEB)

    White, B.J.; Cohen, J.B.

    1988-11-29

    The hydrophobic, photoactivatable probe 3-trifluoromethyl-3-(m-(/sup 125/I)iodophenyl)diazirine ((/sup 125/I)TID) was used to label acetylcholine receptor rich membranes purified from Torpedo californica electric organ. All four subunits of the acetylcholine receptor (AChR) were found to incorporate label, with the ..gamma..-subunit incorporating approximately 4 times as much as each of the other subunits. Carbamylcholine, an agonist, and histrionicotoxin, a noncompetitive antagonist, both strongly inhibited labeling of all AChR subunits in a specific and dose-dependent manner. In contrast, the competitive antagonist ..cap alpha..-bungarotoxin and the noncompetitive antagonist phencyclidine had only modest effect on (/sup 125/I)TID labeling of the AChR. The regions of the AChR ..cap alpha..-subunit that incorporate (/sup 125/)TID were mapped by Staphylococcus aureus V8 protest digestion. The carbamylcholine-sensitive site of labeling was localized to a 20-kDa V8 cleavage fragment that begins at Ser-173 and is of sufficient length to contain the three hydrophobic regions M1, M2, and M3. A 10-kDa fragment beginning at Asn-339 and containing the hydrophobic region M4 also incorporated (/sup 125/I)TID but in a carbamylcholine-insensitive manner. Two further cleavage fragments, which together span about one-third of the ..cap alpha..-subunit amino terminus, incorporated no detectable (/sup 125/I)TID. The mapping results place constraints on suggested models of AChR subunit topology.

  9. Construction of occluded recombinant baculoviruses containing the full-length cry1Ab and cry1Ac genes from Bacillus thuringiensis

    Directory of Open Access Journals (Sweden)

    B.M. Ribeiro

    1998-06-01

    Full Text Available The administration of baculoviruses to insects for bioassay purposes is carried out, in most cases, by contamination of food surfaces with a known amount of occlusion bodies (OBs. Since per os infection is the natural route of infection, occluded recombinant viruses containing crystal protein genes (cry1Ab and cry1Ac from Bacillus thuringiensis were constructed for comparison with the baculovirus prototype Autographa californica nucleopolyhedrovirus (AcNPV. The transfer vector pAcUW2B was used for construction of occluded recombinant viruses. The transfer vector containing the crystal protein genes was cotransfected with linearized DNA from a non-occluded recombinant virus. The isolation of recombinant viruses was greatly facilitated by the reduction of background "wild type" virus and the increased proportion of recombinant viruses. Since the recombinant viruses containing full-length and truncated forms of the crystal protein genes did not seem to improve the pathogenicity of the recombinant viruses when compared with the wild type AcNPV, and in order to compare expression levels of the full-length crystal proteins produced by non-occluded and occluded recombinant viruses the full-length cry1Ab and cry1Ac genes were chosen for construction of occluded recombinant viruses. The recombinant viruses containing full-length and truncated forms of the crystal protein genes did not seem to improve its pathogenicity but the size of the larvae infected with the recombinant viruses was significantly smaller than that of larvae infected with the wild type virus.

  10. North American Lauraceae: terpenoid emissions, relative attraction and boring preferences of redbay ambrosia beetle, Xyleborus glabratus (coleoptera: curculionidae: scolytinae.

    Directory of Open Access Journals (Sweden)

    Paul E Kendra

    Full Text Available The invasive redbay ambrosia beetle, Xyleborus glabratus, is the primary vector of Raffaelea lauricola, a symbiotic fungus and the etiologic agent of laurel wilt. This lethal disease has caused severe mortality of redbay (Persea borbonia and swampbay (P. palustris trees in the southeastern USA, threatens avocado (P. americana production in Florida, and has potential to impact additional New World species. To date, all North American hosts of X. glabratus and suscepts of laurel wilt are members of the family Lauraceae. This comparative study combined field tests and laboratory bioassays to evaluate attraction and boring preferences of female X. glabratus using freshly-cut bolts from nine species of Lauraceae: avocado (one cultivar of each botanical race, redbay, swampbay, silkbay (Persea humilis, California bay laurel (Umbellularia californica, sassafras (Sassafras albidum, northern spicebush (Lindera benzoin, camphor tree (Cinnamomum camphora, and lancewood (Nectandra coriacea. In addition, volatile collections and gas chromatography-mass spectroscopy (GC-MS were conducted to quantify terpenoid emissions from test bolts, and electroantennography (EAG was performed to measure olfactory responses of X. glabratus to terpenoids identified by GC-MS. Significant differences were observed among treatments in both field and laboratory tests. Silkbay and camphor tree attracted the highest numbers of the beetle in the field, and lancewood and spicebush the lowest, whereas boring activity was greatest on silkbay, bay laurel, swampbay, and redbay, and lowest on lancewood, spicebush, and camphor tree. The Guatemalan cultivar of avocado was more attractive than those of the other races, but boring response among the three was equivalent. The results suggest that camphor tree may contain a chemical deterrent to boring, and that different cues are associated with host location and host acceptance. Emissions of α-cubebene, α-copaene, α-humulene, and

  11. Use of heteroduplex mobility assay for identification and differentiation of phytoplasmas in the aster yellows group and the clover proliferation group.

    Science.gov (United States)

    Wang, K; Hiruki, C

    2001-06-01

    ABSTRACT This paper describes the identification and differentiation of phytoplasmas by a highly sensitive diagnostic technique, DNA heteroduplex mobility assay (HMA). Closely related phytoplasma isolates of clover proliferation (CP), potato witches'-broom (PWB), and alfalfa witches'-broom (AWB) were collected from the field from 1990 to 1999. The entire 16S rRNA gene and 16/23S spacer region were amplified by polymerase chain reaction (PCR) from the field samples and standard CP, PWB, and AWB phytoplasmas and were subjected to restriction fragment length polymorphism (RFLP) analysis and HMA. Two subgroups (I and II) of phytoplasmas in the CP group were identified by HMA but not by RFLP analysis. The results were confirmed by 16/23S spacer region sequence data analysis. After HMA analyses of the PCR-amplified 16/23S spacer region, 14 phytoplasma isolates from field samples were classified into two aster yellows subgroups: subgroup I, phytoplasma isolates from China aster (Callistephus chinensis) yellows, French marigold (Tagetes patula) yellows, cosmos (Cosmos bipinnatus cv. Dazzler) yellows, clarkia (Clarkia unguiculata) yellows, California poppy (Eschscholzia californica cv. Tai Silk) yellows, monarda (Monarda fistulosa) yellows, and strawflower (Helichrysum bracteatum) yellows; and subgroup II, phytoplasma isolates from zinnia (Zinnia elegans cv. Dahlia Flower) yellows, Queen-Annes-Lace (Daucus carota) yellows, scabiosa (Scabiosa atropurpurea cv. Giant Imperial) yellows, Swan River daisy (Brachycombe multifida cv. Misty Pink) yellows, pot marigold (Calendula officinalis) yellows, purple coneflower (Echinacea purpurea) yellows, and feverfew (Chrysanthemum parthenium) yellows. The results indicate that HMA is a simple, rapid, highly sensitive and accurate method not only for identifying and classifying phytoplasmas but also for studying the molecular epidemiology of phytoplasmas.

  12. Transcriptome analysis of the Octopus vulgaris central nervous system.

    Directory of Open Access Journals (Sweden)

    Xiang Zhang

    Full Text Available BACKGROUND: Cephalopoda are a class of Mollusca species found in all the world's oceans. They are an important model organism in neurobiology. Unfortunately, the lack of neuronal molecular sequences, such as ESTs, transcriptomic or genomic information, has limited the development of molecular neurobiology research in this unique model organism. RESULTS: With high-throughput Illumina Solexa sequencing technology, we have generated 59,859 high quality sequences from 12,918,391 paired-end reads. Using BLASTx/BLASTn, 12,227 contigs have blast hits in the Swissprot, NR protein database and NT nucleotide database with E-value cutoff 1e(-5. The comparison between the Octopus vulgaris central nervous system (CNS library and the Aplysia californica/Lymnaea stagnalis CNS ESTs library yielded 5.93%/13.45% of O. vulgaris sequences with significant matches (1e(-5 using BLASTn/tBLASTx. Meanwhile the hit percentage of the recently published Schistocerca gregaria, Tilapia or Hirudo medicinalis CNS library to the O. vulgaris CNS library is 21.03%-46.19%. We constructed the Phylogenetic tree using two genes related to CNS function, Synaptotagmin-7 and Synaptophysin. Lastly, we demonstrated that O. vulgaris may have a vertebrate-like Blood-Brain Barrier based on bioinformatic analysis. CONCLUSION: This study provides a mass of molecular information that will contribute to further molecular biology research on O. vulgaris. In our presentation of the first CNS transcriptome analysis of O. vulgaris, we hope to accelerate the study of functional molecular neurobiology and comparative evolutionary biology.

  13. Ancient origin of somatic and visceral neurons

    Science.gov (United States)

    2013-01-01

    Background A key to understanding the evolution of the nervous system on a large phylogenetic scale is the identification of homologous neuronal types. Here, we focus this search on the sensory and motor neurons of bilaterians, exploiting their well-defined molecular signatures in vertebrates. Sensorimotor circuits in vertebrates are of two types: somatic (that sense the environment and respond by shaping bodily motions) and visceral (that sense the interior milieu and respond by regulating vital functions). These circuits differ by a small set of largely dedicated transcriptional determinants: Brn3 is expressed in many somatic sensory neurons, first and second order (among which mechanoreceptors are uniquely marked by the Brn3+/Islet1+/Drgx+ signature), somatic motoneurons uniquely co-express Lhx3/4 and Mnx1, while the vast majority of neurons, sensory and motor, involved in respiration, blood circulation or digestion are molecularly defined by their expression and dependence on the pan-visceral determinant Phox2b. Results We explore the status of the sensorimotor transcriptional code of vertebrates in mollusks, a lophotrochozoa clade that provides a rich repertoire of physiologically identified neurons. In the gastropods Lymnaea stagnalis and Aplysia californica, we show that homologues of Brn3, Drgx, Islet1, Mnx1, Lhx3/4 and Phox2b differentially mark neurons with mechanoreceptive, locomotory and cardiorespiratory functions. Moreover, in the cephalopod Sepia officinalis, we show that Phox2 marks the stellate ganglion (in line with the respiratory — that is, visceral— ancestral role of the mantle, its target organ), while the anterior pedal ganglion, which controls the prehensile and locomotory arms, expresses Mnx. Conclusions Despite considerable divergence in overall neural architecture, a molecular underpinning for the functional allocation of neurons to interactions with the environment or to homeostasis was inherited from the urbilaterian ancestor by

  14. Dehydrin, alcohol dehydrogenase, and central metabolite levels are associated with cold tolerance in diploid strawberry (Fragaria spp.).

    Science.gov (United States)

    Davik, Jahn; Koehler, Gage; From, Britta; Torp, Torfinn; Rohloff, Jens; Eidem, Petter; Wilson, Robert C; Sønsteby, Anita; Randall, Stephen K; Alsheikh, Muath

    2013-01-01

    The use of artificial freezing tests, identification of biomarkers linked to or directly involved in the low-temperature tolerance processes, could prove useful in applied strawberry breeding. This study was conducted to identify genotypes of diploid strawberry that differ in their tolerance to low-temperature stress and to investigate whether a set of candidate proteins and metabolites correlate with the level of tolerance. 17 Fragaria vesca, 2 F. nilgerrensis, 2 F. nubicola, and 1 F. pentaphylla genotypes were evaluated for low-temperature tolerance. Estimates of temperatures where 50 % of the plants survived (LT₅₀) ranged from -4.7 to -12.0 °C between the genotypes. Among the F. vesca genotypes, the LT₅₀ varied from -7.7 °C to -12.0 °C. Among the most tolerant were three F. vesca ssp. bracteata genotypes (FDP821, NCGR424, and NCGR502), while a F. vesca ssp. californica genotype (FDP817) was the least tolerant (LT₅₀) -7.7 °C). Alcohol dehydrogenase (ADH), total dehydrin expression, and content of central metabolism constituents were assayed in select plants acclimated at 2 °C. The LT₅₀ estimates and the expression of ADH and total dehydrins were highly correlated (r(adh) = -0.87, r (dehyd) = -0.82). Compounds related to the citric acid cycle were quantified in the leaves during acclimation. While several sugars and acids were significantly correlated to the LT₅₀ estimates early in the acclimation period, only galactinol proved to be a good LT₅₀ predictor after 28 days of acclimation (r(galact) = 0.79). It is concluded that ADH, dehydrins, and galactinol show great potential to serve as biomarkers for cold tolerance in diploid strawberry.

  15. género Digitaria (Poaceae, Panicoideae, Paniceae en Colombia y Venezuela

    Directory of Open Access Journals (Sweden)

    Andrea S. Vega

    2005-01-01

    Full Text Available Digitaria cuatrecasasii, nueva especie de Honduras, Panamá, Colombia y Venezuela, se describe e ilustra. Se discute la posición taxonómica de D. cuatrecasasii y se propone su inclusión en la sección Leianthae. Se provee una tabla comparativa con las especies de la sección y observaciones referidas a la especie más relacionada. Digitaria californica var. villosissima, D. corynotricha, D. curvinervis, D. fragilis y D. sacchariflora son citadas por primera vez en Colombia. Digitaria aequiglumis var. aequiglumis, D. argillacea var. nulliseta, D. ciliaris var. rhachiseta, D. costaricensis, D. eriantha, D. filiformis var. laeviglumis, D. lehmanniana var. dasyantha, D. parva, D. sacchariflora y D. ternata se mencionan por primera vez en Venezuela. Digitaria cardenasiana y D. villiculmis constituyen nuevos sinónimos de D. corynotricha; D. aequatorienis se subordina a D. pittieri. Se adicionan nuevas citas en los siguientes países: D. argillacea var. argillacea en Perú, D. argillacea var. nulliseta en Guatemala, D. curvinervis en Ecuador y México, D. eriantha en Ecuador, D. fragilis en Nicaragua y Panamá, D. lehmanniana var. lehmanniana en Cuba y D. leucites en México. El trabajo incluye sinonimia, iconografía, distribución geográfica y ecología, nombres vernáculos y exsiccata. Se provee también una clave para la identificación de los taxones. Once especies son ilustradas por primera vez.

  16. Immunization with Recombinantly Expressed LRP4 Induces Experimental Autoimmune Myasthenia Gravis in C57BL/6 Mice.

    Science.gov (United States)

    Ulusoy, Canan; Çavuş, Filiz; Yılmaz, Vuslat; Tüzün, Erdem

    2017-07-01

    Myasthenia gravis (MG) is an autoimmune disease of the neuromuscular junction (NMJ), characterized with muscle weakness. While MG develops due to acetylcholine receptor (AChR) antibodies in most patients, antibodies to muscle-specific receptor tyrosine kinase (MuSK) or low-density lipoprotein receptor-related protein 4 (LRP4) may also be identified. Experimental autoimmune myasthenia gravis (EAMG) has been previously induced by both LRP4 immunization and passive transfer of LRP4 antibodies. Our aim was to confirm previous results and to test the pathogenic effects of LRP4 immunization in a commonly used mouse strain C57BL/6 (B6) using a recombinantly expressed human LRP4 protein. B6 mice were immunized with human LRP4 in CFA, Torpedo Californica AChR in CFA or only CFA. Clinical and pathogenic aspects of EAMG were compared among groups. LRP4- and AChR-immunized mice showed comparable EAMG clinical severity. LRP4-immunized mice displayed serum antibodies to LRP4 and NMJ IgG and complement factor C3 deposits. IgG2 was the dominant anti-LRP4 isotype. Cultured lymph node cells of LRP4- and AChR-immunized mice gave identical pro-inflammatory cytokine (IL-6, IFN-γ and IL-17) responses to LRP4 and AChR stimulation, respectively. Our results confirm the EAMG-inducing action of LRP4 immunization and identify B6 as a LRP4-EAMG-susceptible mouse strain. Demonstration of complement fixing anti-LRP4 antibodies in sera and complement/IgG deposits at the NMJ of LRP4-immunized mice indicates complement activation as a putative pathogenic mechanism. We have thus developed a practical LRP4-induced EAMG model using a non-conformational protein and a widely available mouse strain for future investigation of LRP4-related MG.

  17. Oxygen diffusion: an enzyme-controlled variable parameter.

    Science.gov (United States)

    Erdmann, Wilhelm; Kunke, Stefan

    2014-01-01

    Previous oxygen microelectrode studies have shown that the oxygen diffusion coefficient (DO₂) increases during extracellular PO₂ decreases, while intracellular PO₂ remained unchanged and thus cell function (spike activity of neurons). Oxygen dependency of complex multicellular organisms requires a stable and adequate oxygen supply to the cells, while toxic concentrations have to be avoided. Oxygen brought to the tissue by convection diffuses through the intercellular and cell membranes, which are potential barriers to diffusion. In gerbil brain cortex, PO₂ and DO₂ were measured by membrane-covered and by bare gold microelectrodes, as were also spike potentials. Moderate respiratory hypoxia was followed by a primary sharp drop of tissue PO₂ that recovered to higher values concomitant with an increase of DO₂. A drop in intracellular PO₂ recovered immediately. Studies on the abdominal ganglion of aplysia californica showed similar results.Heterogeneity is a feature of both normal oxygen supply to tissue and supply due to a wide range of disturbances in oxygen supply. Oxygen diffusion through membranes is variable thereby ensuring adequate intracellular PO₂. Cell-derived glucosamine oxidase seems to regulate the polymerization/depolymerisation ratio of membrane mucopolysaccharides and thus oxygen diffusion.Variability of oxygen diffusion is a decisive parameter for regulating the supply/demand ratio of oxygen supply to the cell; this occurs in highly developed animals as well as in species of a less sophisticated nature. Autoregulation of oxygen diffusion is as important as the distribution/perfusion ratio of the capillary meshwork and as the oxygen extraction ratio in relation to oxygen consumption of the cell. Oxygen diffusion resistance is the cellular protection against luxury oxygen supply (which can result in toxic oxidative species leading to mutagenesis).

  18. Bacterial production of free fatty acids from freshwater macroalgal cellulose

    Science.gov (United States)

    Hoovers, Spencer W.; Marner, Wesley D.; Brownson, Amy K.; Lennen, Rebecca M.; Wittkopp, Tyler M.; Yoshitani, Jun; Zulkifly, Shahrizim; Graham, Linda E.; Chaston, Sheena D.; McMahon, Katherine D.

    2013-01-01

    The predominant strategy for using algae to produce biofuels relies on the overproduction of lipids in microalgae with subsequent conversion to biodiesel (methyl-esters) or green diesel (alkanes). Conditions that both optimize algal growth and lipid accumulation rarely overlap, and differences in growth rates can lead to wild species outcompeting the desired lipid-rich strains. Here, we demonstrate an alternative strategy in which cellulose contained in the cell walls of multicellular algae is used as a feedstock for cultivating biofuel-producing micro-organisms. Cellulose was extracted from an environmental sample of Cladophora glomerata-dominated periphyton that was collected from Lake Mendota, WI, USA. The resulting cellulose cake was hydrolyzed by commercial enzymes to release fermentable glucose. The hydrolysis mixture was used to formulate an undefined medium that was able to support the growth, without supplementation, of a free fatty acid (FFA)-overproducing strain of Escherichia coli (Lennen et. al 2010). To maximize free fatty acid production from glucose, an isopropyl β-D-1-thiogalactopyranoside (IPTG)-inducible vector was constructed to express the Umbellularia californica acyl–acyl carrier protein (ACP) thioesterase. Thioesterase expression was optimized by inducing cultures with 50 μM IPTG. Cell density and FFA titers from cultures grown on algae-based media reached 50% of those (~90 μg/mL FFA) cultures grown on rich Luria–Bertani broth supplemented with 0.2% glucose. In comparison, cultures grown in two media based on AFEX-pretreated corn stover generated tenfold less FFA than cultures grown in algae-based media. This study demonstrates that macroalgal cellulose is a potential carbon source for the production of biofuels or other microbially synthesized compounds. PMID:21643704

  19. Mechanism behind Resistance against the Organophosphate Azamethiphos in Salmon Lice (Lepeophtheirus salmonis.

    Directory of Open Access Journals (Sweden)

    Kiranpreet Kaur

    Full Text Available Acetylcholinesterase (AChE is the primary target for organophosphates (OP. Several mutations have been reported in AChE to be associated with the reduced sensitivity against OP in various arthropods. However, to the best of our knowledge, no such reports are available for Lepeophtheirus salmonis. Hence, in the present study, we aimed to determine the association of AChE(s gene(s with resistance against OP. We screened the AChE genes (L. salmonis ace1a and ace1b in two salmon lice populations: one sensitive (n=5 and the other resistant (n=5 for azamethiphos, a commonly used OP in salmon farming. The screening led to the identification of a missense mutation Phe362Tyr in L. salmonis ace1a, (corresponding to Phe331 in Torpedo californica AChE in all the samples of the resistant population. We confirmed the potential role of the mutation, with reduced sensitivity against azamethiphos in L. salmonis, by screening for Phe362Tyr in 2 sensitive and 5 resistant strains. The significantly higher frequency of the mutant allele (362Tyr in the resistant strains clearly indicated the possible association of Phe362Tyr mutation in L. salmonis ace1a with resistance towards azamethiphos. The 3D modelling, short term survival experiments and enzymatic assays further supported the imperative role of Phe362Tyr in reduced sensitivity of L. salmonis for azamethiphos. Based on all these observations, the present study, for the first time, presents the mechanism of resistance in L. salmonis against azamethiphos. In addition, we developed a rapid diagnostic tool for the high throughput screening of Phe362Tyr mutation using High Resolution Melt analysis.

  20. A sublittoral population of Pleurophycus gardneri Setchell and Saunders 1900 (Phaeophyceae: Laminariaceae) in central California

    Science.gov (United States)

    VanBlaricom, Glenn R.; Reed, Daniel C.; Harrold, Christopher; Bodkin, James L.

    1986-01-01

    Published distributional records for the stipitate kelp Pleurophycus gardneri Setchell and Saunders 1900 (Phaeophyceae: Laminariaceae) indicae a geographic range from Montague Island (59°58’N, 147°22W), Alaska to Fort Bragg (39°27’N, 123°47’W), California (Druehl 1969, 1970; Kjeldsen 1972). P. gardneri is found primarily in rocky intertidal and shallow subtidal locations (Scagel 1967; Nicholson 1976). In California, populations of P. gardneri have been reported only from the lower rocky intertidal near Fort Bragg (Kjeldsen 1972).On 7 and 8 July 1982 and 23 March 1984 we censused stipitate kelps during SCUBS dives at a site 2.3 km south southeast of Pt. Sierra Nevada (35°41’ N, 121°18’W). we counted kelps in 1 x 5-m plots along a 50-m tape laid across the bottom in an arbitrarily predetermined direction from the skiff anchor. We also measured water depth at 1-m intervals along the tape, using a SCUBA depth gauge. On 20 August 1982, we used the same tehniques to sample kelp densities at a site 2.4 km east southeast of Pt. Piedras Blancas (35°39’N, 121°15’W).The most abundant kelps at the Pt. Sierra Nevada ste were Pterygophora californica Ruprect 1852 (Phaeophyceae: Alariaceae) and a species we tentatively identified as P. gardneri (Table 1). Based on specimens we collected on 8 July 1982, our field identification was subsequently confirmed by I. A. Abbot. Voucher specimens were placed in the Gilbert M. Smith Herbarium at Hopkins Marine Station, Stanford University, Pacific Grove, California.

  1. Deep mRNA sequencing of the Tritonia diomedea brain transcriptome provides access to gene homologues for neuronal excitability, synaptic transmission and peptidergic signalling.

    Directory of Open Access Journals (Sweden)

    Adriano Senatore

    Full Text Available The sea slug Tritonia diomedea (Mollusca, Gastropoda, Nudibranchia, has a simple and highly accessible nervous system, making it useful for studying neuronal and synaptic mechanisms underlying behavior. Although many important contributions have been made using Tritonia, until now, a lack of genetic information has impeded exploration at the molecular level.We performed Illumina sequencing of central nervous system mRNAs from Tritonia, generating 133.1 million 100 base pair, paired-end reads. De novo reconstruction of the RNA-Seq data yielded a total of 185,546 contigs, which partitioned into 123,154 non-redundant gene clusters (unigenes. BLAST comparison with RefSeq and Swiss-Prot protein databases, as well as mRNA data from other invertebrates (gastropod molluscs: Aplysia californica, Lymnaea stagnalis and Biomphalaria glabrata; cnidarian: Nematostella vectensis revealed that up to 76,292 unigenes in the Tritonia transcriptome have putative homologues in other databases, 18,246 of which are below a more stringent E-value cut-off of 1x10-6. In silico prediction of secreted proteins from the Tritonia transcriptome shotgun assembly (TSA produced a database of 579 unique sequences of secreted proteins, which also exhibited markedly higher expression levels compared to other genes in the TSA.Our efforts greatly expand the availability of gene sequences available for Tritonia diomedea. We were able to extract full length protein sequences for most queried genes, including those involved in electrical excitability, synaptic vesicle release and neurotransmission, thus confirming that the transcriptome will serve as a useful tool for probing the molecular correlates of behavior in this species. We also generated a neurosecretome database that will serve as a useful tool for probing peptidergic signalling systems in the Tritonia brain.

  2. Shark fisheries in the Southeast Pacific: A 61-year analysis from Peru [version 2; referees: 1 approved, 2 approved with reservations

    Directory of Open Access Journals (Sweden)

    Adriana Gonzalez-Pestana

    2016-04-01

    Full Text Available Peruvian waters exhibit high conservation value for sharks. This contrasts with a lag in initiatives for their management and a lack of studies about their biology, ecology and fishery. We investigated the dynamics of Peruvian shark fishery and its legal framework identifying information gaps for recommending actions to improve management. Further, we investigated the importance of the Peruvian shark fishery from a regional perspective. From 1950 to 2010, 372,015 tons of sharks were landed in Peru. From 1950 to 1969, we detected a significant increase in landings; but from 2000 to 2011 there was a significant decrease in landings, estimated at 3.5% per year. Six species represented 94% of landings: blue shark (Prionace glauca, shortfin mako (Isurus oxyrinchus, smooth hammerhead (Sphyrna zygaena, common thresher (Alopias vulpinus, smooth-hound (Mustelus whitneyi and angel shark (Squatina californica. Of these, the angel shark exhibits a strong and significant decrease in landings: 18.9% per year from 2000 to 2010. Peru reports the highest accumulated historical landings in the Pacific Ocean; but its contribution to annual landings has decreased since 1968. Still, Peru is among the top 12 countries exporting shark fins to the Hong Kong market. Although the government collects total weight by species, the number of specimens landed as well as population parameters (e.g. sex, size and weight are not reported. Further, for some genera, species-level identification is deficient and so overestimates the biomass landed by species and underestimates the species diversity. Recently, regional efforts to regulate shark fishery have been implemented to support the conservation of sharks but in Peru work remains to be done.

  3. Homology and homoplasy of swimming behaviors and neural circuits in the Nudipleura (Mollusca, Gastropoda, Opisthobranchia)

    Science.gov (United States)

    Newcomb, James M.; Sakurai, Akira; Lillvis, Joshua L.; Gunaratne, Charuni A.; Katz, Paul S.

    2012-01-01

    How neural circuit evolution relates to behavioral evolution is not well understood. Here the relationship between neural circuits and behavior is explored with respect to the swimming behaviors of the Nudipleura (Mollusca, Gastropoda, Opithobranchia). Nudipleura is a diverse monophyletic clade of sea slugs among which only a small percentage of species can swim. Swimming falls into a limited number of categories, the most prevalent of which are rhythmic left–right body flexions (LR) and rhythmic dorsal–ventral body flexions (DV). The phylogenetic distribution of these behaviors suggests a high degree of homoplasy. The central pattern generator (CPG) underlying DV swimming has been well characterized in Tritonia diomedea and in Pleurobranchaea californica. The CPG for LR swimming has been elucidated in Melibe leonina and Dendronotus iris, which are more closely related. The CPGs for the categorically distinct DV and LR swimming behaviors consist of nonoverlapping sets of homologous identified neurons, whereas the categorically similar behaviors share some homologous identified neurons, although the exact composition of neurons and synapses in the neural circuits differ. The roles played by homologous identified neurons in categorically distinct behaviors differ. However, homologous identified neurons also play different roles even in the swim CPGs of the two LR swimming species. Individual neurons can be multifunctional within a species. Some of those functions are shared across species, whereas others are not. The pattern of use and reuse of homologous neurons in various forms of swimming and other behaviors further demonstrates that the composition of neural circuits influences the evolution of behaviors. PMID:22723353

  4. Transcriptome analysis of the freshwater pearl mussel (Cristaria plicata) mantle unravels genes involved in the formation of shell and pearl.

    Science.gov (United States)

    Wang, Xuefeng; Liu, Zhiming; Wu, Wenjian

    2017-04-01

    Cristaria plicata, a bivalve widespread in Eastern Asia fresh water, is utilized as the freshwater pearl mussel in China. With a high economic value in pearl production, it is also an ideal object used for the studies on biomineralization in freshwater. In the research, we performed a large-scale sequencing of Cristaria plicata mantle transcriptome using Illumina HiSeq™ 2500, obtaining 98,501 unigenes with 67,817,724 bases. 22.28 and 16.64% of the unigenes were annotated in the NR and Swiss-Prot databases, respectively. Most of the annotated unigenes were homologous with proteins of Crassostrea gigas (47.4%) and some were similar to proteins of Aplysia californica (16.7%). Here, we identified 109 homologous unigenes of 15 decided shell matrix proteins, including nacrein, Pif, perlucin, tyrosinase (Tyr), PfN44, PUSP1, chitinase, shell matrix protein, MSI80, fibronectin type III, AmOxCo, perlwapin, BMSP, PfCHS1 and CaLP. Two other mantle transcriptomes of Pinctada margaritifera and Pinctada fucata were also analyzed to perform a biomineralization protein comparison of the three molluscan transcriptomes. All the three compared mollusks shared four proteins, including nacrein, Pif, Tyr and PfCHS1. It was also discovered that Cristaria plicata shared more biomineralization proteins with Pinctada fucata than that with Pinctada margaritifera. Our study explored a whole draft of mantle transcriptome of freshwater mussel and unraveled genes involved in the formation of shell and pearl, making it possible to identify massive novel biomineralization proteins in mollusks.

  5. The significance of dynamical architecture for adaptive responses to mechanical loads during rhythmic behavior.

    Science.gov (United States)

    Shaw, Kendrick M; Lyttle, David N; Gill, Jeffrey P; Cullins, Miranda J; McManus, Jeffrey M; Lu, Hui; Thomas, Peter J; Chiel, Hillel J

    2015-02-01

    Many behaviors require reliably generating sequences of motor activity while adapting the activity to incoming sensory information. This process has often been conceptually explained as either fully dependent on sensory input (a chain reflex) or fully independent of sensory input (an idealized central pattern generator, or CPG), although the consensus of the field is that most neural pattern generators lie somewhere between these two extremes. Many mathematical models of neural pattern generators use limit cycles to generate the sequence of behaviors, but other models, such as a heteroclinic channel (an attracting chain of saddle points), have been suggested. To explore the range of intermediate behaviors between CPGs and chain reflexes, in this paper we describe a nominal model of swallowing in Aplysia californica. Depending upon the value of a single parameter, the model can transition from a generic limit cycle regime to a heteroclinic regime (where the trajectory slows as it passes near saddle points). We then study the behavior of the system in these two regimes and compare the behavior of the models with behavior recorded in the animal in vivo and in vitro. We show that while both pattern generators can generate similar behavior, the stable heteroclinic channel can better respond to changes in sensory input induced by load, and that the response matches the changes seen when a load is added in vivo. We then show that the underlying stable heteroclinic channel architecture exhibits dramatic slowing of activity when sensory and endogenous input is reduced, and show that similar slowing with removal of proprioception is seen in vitro. Finally, we show that the distributions of burst lengths seen in vivo are better matched by the distribution expected from a system operating in the heteroclinic regime than that expected from a generic limit cycle. These observations suggest that generic limit cycle models may fail to capture key aspects of Aplysia feeding

  6. Comparative Analysis and Distribution of Omega-3 lcPUFA Biosynthesis Genes in Marine Molluscs.

    Science.gov (United States)

    Surm, Joachim M; Prentis, Peter J; Pavasovic, Ana

    2015-01-01

    Recent research has identified marine molluscs as an excellent source of omega-3 long-chain polyunsaturated fatty acids (lcPUFAs), based on their potential for endogenous synthesis of lcPUFAs. In this study we generated a representative list of fatty acyl desaturase (Fad) and elongation of very long-chain fatty acid (Elovl) genes from major orders of Phylum Mollusca, through the interrogation of transcriptome and genome sequences, and various publicly available databases. We have identified novel and uncharacterised Fad and Elovl sequences in the following species: Anadara trapezia, Nerita albicilla, Nerita melanotragus, Crassostrea gigas, Lottia gigantea, Aplysia californica, Loligo pealeii and Chlamys farreri. Based on alignments of translated protein sequences of Fad and Elovl genes, the haeme binding motif and histidine boxes of Fad proteins, and the histidine box and seventeen important amino acids in Elovl proteins, were highly conserved. Phylogenetic analysis of aligned reference sequences was used to reconstruct the evolutionary relationships for Fad and Elovl genes separately. Multiple, well resolved clades for both the Fad and Elovl sequences were observed, suggesting that repeated rounds of gene duplication best explain the distribution of Fad and Elovl proteins across the major orders of molluscs. For Elovl sequences, one clade contained the functionally characterised Elovl5 proteins, while another clade contained proteins hypothesised to have Elovl4 function. Additional well resolved clades consisted only of uncharacterised Elovl sequences. One clade from the Fad phylogeny contained only uncharacterised proteins, while the other clade contained functionally characterised delta-5 desaturase proteins. The discovery of an uncharacterised Fad clade is particularly interesting as these divergent proteins may have novel functions. Overall, this paper presents a number of novel Fad and Elovl genes suggesting that many mollusc groups possess most of the

  7. Comparative Analysis and Distribution of Omega-3 lcPUFA Biosynthesis Genes in Marine Molluscs.

    Directory of Open Access Journals (Sweden)

    Joachim M Surm

    Full Text Available Recent research has identified marine molluscs as an excellent source of omega-3 long-chain polyunsaturated fatty acids (lcPUFAs, based on their potential for endogenous synthesis of lcPUFAs. In this study we generated a representative list of fatty acyl desaturase (Fad and elongation of very long-chain fatty acid (Elovl genes from major orders of Phylum Mollusca, through the interrogation of transcriptome and genome sequences, and various publicly available databases. We have identified novel and uncharacterised Fad and Elovl sequences in the following species: Anadara trapezia, Nerita albicilla, Nerita melanotragus, Crassostrea gigas, Lottia gigantea, Aplysia californica, Loligo pealeii and Chlamys farreri. Based on alignments of translated protein sequences of Fad and Elovl genes, the haeme binding motif and histidine boxes of Fad proteins, and the histidine box and seventeen important amino acids in Elovl proteins, were highly conserved. Phylogenetic analysis of aligned reference sequences was used to reconstruct the evolutionary relationships for Fad and Elovl genes separately. Multiple, well resolved clades for both the Fad and Elovl sequences were observed, suggesting that repeated rounds of gene duplication best explain the distribution of Fad and Elovl proteins across the major orders of molluscs. For Elovl sequences, one clade contained the functionally characterised Elovl5 proteins, while another clade contained proteins hypothesised to have Elovl4 function. Additional well resolved clades consisted only of uncharacterised Elovl sequences. One clade from the Fad phylogeny contained only uncharacterised proteins, while the other clade contained functionally characterised delta-5 desaturase proteins. The discovery of an uncharacterised Fad clade is particularly interesting as these divergent proteins may have novel functions. Overall, this paper presents a number of novel Fad and Elovl genes suggesting that many mollusc groups possess

  8. Baculovirus F-Box Protein LEF-7 Modifies the Host DNA Damage Response To Enhance Virus Multiplication

    Science.gov (United States)

    Mitchell, Jonathan K.; Byers, Nathaniel M.

    2013-01-01

    The DNA damage response (DDR) of a host organism represents an effective antiviral defense that is frequently manipulated and exploited by viruses to promote multiplication. We report here that the large DNA baculoviruses, which require host DDR activation for optimal replication, encode a conserved replication factor, LEF-7, that manipulates the DDR via a novel mechanism. LEF-7 suppresses DDR-induced accumulation of phosphorylated host histone variant H2AX (γ-H2AX), a critical regulator of the DDR. LEF-7 was necessary and sufficient to block γ-H2AX accumulation caused by baculovirus infection or DNA damage induced by means of pharmacological agents. Deletion of LEF-7 from the baculovirus genome allowed γ-H2AX accumulation during virus DNA synthesis and impaired both very late viral gene expression and production of infectious progeny. Thus, LEF-7 is essential for efficient baculovirus replication. We determined that LEF-7 is a nuclear F-box protein that interacts with host S-phase kinase-associated protein 1 (SKP1), suggesting that LEF-7 acts as a substrate recognition component of SKP1/Cullin/F-box (SCF) complexes for targeted protein polyubiquitination. Site-directed mutagenesis demonstrated that LEF-7's N-terminal F-box is necessary for γ-H2AX repression and Autographa californica multiple nucleopolyhedrovirus (AcMNPV) replication events. We concluded that LEF-7 expedites virus replication most likely by selective manipulation of one or more host factors regulating the DDR, including γ-H2AX. Thus, our findings indicate that baculoviruses utilize a unique strategy among viruses for hijacking the host DDR by using a newly recognized F-box protein. PMID:24027328

  9. Thirty-seventh supplement to the American Ornithologists' Union Check-list of North American birds

    Science.gov (United States)

    Monroe, Burt L.; Banks, Richard C.; Fitzpatrick, John W.; Howell, Thomas R.; Johnson, Ned K.; Ouellet, Henri; Remsen, J.V.; Storer, Robert W.

    1989-01-01

    This third supplement subsequent to the 6th edition (1983) of the A.O.U. "Check-list of North American Birds" consists of changes adopted by the Committee on Classification and Nomenclature as of 1 March 1989. The changes fall into nine categories: (1) six species are added to the main list (Pterodroma longirostris, Larus crassirostris, Streptopelia decaocto, Cocccyzus julieni, Chrysolampis mosquitus, Emberiza aureola) because of new distributional information; (2) five species (Ara cubensis, Chlorostilbon bracei, Empidonax occidentalis, Polioptila californica, Pipilo crissalis) are added to the main list because of the splitting of species already on the list; (3) one name (Anthus rubescens) is changed because of the splitting of a species from outside the Checklist area; (4) two names (Morus bassanus, Nyctanassa violacea) is removed from the main list to Appendix B because of re-evaluation of Northern Hemisphere records; (6) three species (Pterodrama rostrata, P. alba, P. solandri) are moved from Appendix A to Appendix B, and one (P. defilippiana) is added to Appendix B because of questionable sight records; (7)A.O.U. numbers are added to three species (Ciccaba virgata, Myiopagis viridicata, Molothrus bonariensis) on the basis on new distributional records or supporting data; (8) several corrections in spelling or citations are made; and (9) English names are changed for twelve species to accommodate worldwide usage of these names. No new distributional information is included except as indicated above (i.e. minor changes of distribution are not noted). These actions bring the number of species recognized as occurring in North America (main list) to 1,945.

  10. Shark fisheries in the Southeast Pacific: A 61-year analysis from Peru

    Science.gov (United States)

    Gonzalez-Pestana, Adriana; Kouri J., Carlos; Velez-Zuazo, Ximena

    2016-01-01

    Peruvian waters exhibit high conservation value for sharks. This contrasts with a lag in initiatives for their management and a lack of studies about their biology, ecology and fishery. We investigated the dynamics of Peruvian shark fishery and its legal framework identifying information gaps for recommending actions to improve management. Further, we investigated the importance of the Peruvian shark fishery from a regional perspective. From 1950 to 2010, 372,015 tons of sharks were landed in Peru. From 1950 to 1969, we detected a significant increase in landings; but from 2000 to 2011 there was a significant decrease in landings, estimated at 3.5% per year. Six species represented 94% of landings: blue shark ( Prionace glauca), shortfin mako ( Isurus oxyrinchus), smooth hammerhead ( Sphyrna zygaena), common thresher ( Alopias vulpinus), smooth-hound ( Mustelus whitneyi) and angel shark ( Squatina californica). Of these, the angel shark exhibits a strong and significant decrease in landings: 18.9% per year from 2000 to 2010. Peru reports the highest accumulated historical landings in the Pacific Ocean; but its contribution to annual landings has decreased since 1968. Still, Peru is among the top 12 countries exporting shark fins to the Hong Kong market. Although the government collects total weight by species, the number of specimens landed as well as population parameters (e.g. sex, size and weight) are not reported. Further, for some genera, species-level identification is deficient and so overestimates the biomass landed by species and underestimates the species diversity. Recently, regional efforts to regulate shark fishery have been implemented to support the conservation of sharks but in Peru work remains to be done. PMID:27635216

  11. Chronic sleep deprivation differentially affects short and long-term operant memory in Aplysia.

    Science.gov (United States)

    Krishnan, Harini C; Noakes, Eric J; Lyons, Lisa C

    2016-10-01

    The induction, formation and maintenance of memory represent dynamic processes modulated by multiple factors including the circadian clock and sleep. Chronic sleep restriction has become common in modern society due to occupational and social demands. Given the impact of cognitive impairments associated with sleep deprivation, there is a vital need for a simple animal model in which to study the interactions between chronic sleep deprivation and memory. We used the marine mollusk Aplysia californica, with its simple nervous system, nocturnal sleep pattern and well-characterized learning paradigms, to assess the effects of two chronic sleep restriction paradigms on short-term (STM) and long-term (LTM) associative memory. The effects of sleep deprivation on memory were evaluated using the operant learning paradigm, learning that food is inedible, in which the animal associates a specific netted seaweed with failed swallowing attempts. We found that two nights of 6h sleep deprivation occurring during the first or last half of the night inhibited both STM and LTM. Moreover, the impairment in STM persisted for more than 24h. A milder, prolonged sleep deprivation paradigm consisting of 3 consecutive nights of 4h sleep deprivation also blocked STM, but had no effect on LTM. These experiments highlight differences in the sensitivity of STM and LTM to chronic sleep deprivation. Moreover, these results establish Aplysia as a valid model for studying the interactions between chronic sleep deprivation and associative memory paving the way for future studies delineating the mechanisms through which sleep restriction affects memory formation. Copyright © 2016 Elsevier Inc. All rights reserved.

  12. Biological and molecular characterization of a multicapsid nucleopolyhedrovirus from Thysanoplusia orichalcea (L.) (Lepidoptera: Noctuidae).

    Science.gov (United States)

    Cheng, Xiao-Wen; Carner, Gerald R; Lange, Martin; Jehle, Johannes A; Arif, Basil M

    2005-02-01

    A multicapsid nucleopolyhedrovirus (ThorMNPV) that was co-isolated with a single nucleocapid ThorSNPV from mixed infected larvae of Thysanoplusia orichalcea L. (Lepidoptea: Noctuidae) is characterized. Scanning electron microscopy of ThorMNPV showed a dodecahedral-shaped occlusion body (OB). The occluded virions contained one to as many as eight nucleocapsids/virion. Virion band profiles in gradient centrifugation were consistent in at least 10 rounds of centrifugation from different virion sample preparations. The ThorMNPV had high virulence to third instar Trichoplusia ni and Pseudoplusia includens with LD50 values of 17 and 242OBs per larva, respectively. However, ThorMNPV did not cause mortality in Spodoptera exigua, Spodoptera frugiperda, Spodoptera eridania, Anticarsia gemmatalis, and Helicoverpa zea. ThorMNPV replicates in cells of various tissues such as the fat body and tracheal epithelium cells. T. ni High 5 cells were permissive to ThorMNPV in terms of infection and viral DNA transfection, but SF-21 was less permissive and the infection process was slower. Production of OBs by ThorMNPV in the nuclei of SF-21 was not well pronounced. The genome size of ThorMNPV was estimated to be 136 kb. The polyhedrin gene open reading frame (ORF) was cloned and completely sequenced. The promoter sequence is identical to that of Autographa californica MNPV. Phylogenetic analyses using partial sequences of the polh, lef-8, and lef-9 revealed that ThorMNPV is a member of the Group I NPVs and is related but distinct from the AcMNPV/Rachiplusia ou NPV/Bombyx mori NPV cluster.

  13. Physiological, Molecular and Genetic Mechanisms of Long-Term Habituation

    Energy Technology Data Exchange (ETDEWEB)

    Calin-Jageman, Robert J

    2009-09-12

    Work funded on this grant has explored the mechanisms of long-term habituation, a ubiquitous form of learning that plays a key role in basic cognitive functioning. Specifically, behavioral, physiological, and molecular mechanisms of habituation have been explored using a simple model system, the tail-elicited siphon-withdrawal reflex (T-SWR) in the marine mollusk Aplysia californica. Substantial progress has been made on the first and third aims, providing some fundamental insights into the mechanisms by which memories are stored. We have characterized the physiological correlates of short- and long-term habituation. We found that short-term habituation is accompanied by a robust sensory adaptation, whereas long-term habituation is accompanied by alterations in sensory and interneuron synaptic efficacy. Thus, our data indicates memories can be shifted between different sites in a neural network as they are consolidated from short to long term. At the molecular level, we have accomplished microarray analysis comparing gene expression in both habituated and control ganglia. We have identified a network of putatively regulated transcripts that seems particularly targeted towards synaptic changes (e.g. SNAP25, calmodulin) . We are now beginning additional work to confirm regulation of these transcripts and build a more detailed understanding of the cascade of molecular events leading to the permanent storage of long-term memories. On the third aim, we have fostered a nascent neuroscience program via a variety of successful initiatives. We have funded over 11 undergraduate neuroscience scholars, several of whom have been recognized at national and regional levels for their research. We have also conducted a pioneering summer research program for community college students which is helping enhance access of underrepresented groups to life science careers. Despite minimal progress on the second aim, this project has provided a) novel insight into the network mechanisms by

  14. Identification of a high-efficiency baculovirus DNA replication origin that functions in insect and mammalian cells.

    Science.gov (United States)

    Wu, Yueh-Lung; Wu, Carol-P; Huang, Yu-Hui; Huang, Sheng-Ping; Lo, Huei-Ru; Chang, Hao-Shuo; Lin, Pi-Hsiu; Wu, Ming-Cheng; Chang, Chia-Jung; Chao, Yu-Chan

    2014-11-01

    The p143 gene from Autographa californica multinucleocapsid nucleopolyhedrovirus (AcMNPV) has been found to increase the expression of luciferase, which is driven by the polyhedrin gene promoter, in a plasmid with virus coinfection. Further study indicated that this is due to the presence of a replication origin (ori) in the coding region of this gene. Transient DNA replication assays showed that a specific fragment of the p143 coding sequence, p143-3, underwent virus-dependent DNA replication in Spodoptera frugiperda IPLB-Sf-21 (Sf-21) cells. Deletion analysis of the p143-3 fragment showed that subfragment p143-3.2a contained the essential sequence of this putative ori. Sequence analysis of this region revealed a unique distribution of imperfect palindromes with high AT contents. No sequence homology or similarity between p143-3.2a and any other known ori was detected, suggesting that it is a novel baculovirus ori. Further study showed that the p143-3.2a ori can replicate more efficiently in infected Sf-21 cells than baculovirus homologous regions (hrs), the major baculovirus ori, or non-hr oris during virus replication. Previously, hr on its own was unable to replicate in mammalian cells, and for mammalian viral oris, viral proteins are generally required for their proper replication in host cells. However, the p143-3.2a ori was, surprisingly, found to function as an efficient ori in mammalian cells without the need for any viral proteins. We conclude that p143 contains a unique sequence that can function as an ori to enhance gene expression in not only insect cells but also mammalian cells. Baculovirus DNA replication relies on both hr and non-hr oris; however, so far very little is known about the latter oris. Here we have identified a new non-hr ori, the p143 ori, which resides in the coding region of p143. By developing a novel DNA replication-enhanced reporter system, we have identified and located the core region required for the p143 ori. This ori contains

  15. Neogene stratigraphy, foraminifera, diatoms, and depositional history of Maria Madre Island, Mexico: Evidence of early Neogene marine conditions in the southern Gulf of California

    Science.gov (United States)

    McCloy, C.; Ingle, J.C.; Barron, J.A.

    1988-01-01

    Foraminifera and diatoms have been analyzed from an upper Miocene through Pleistocene(?) sequence of marine sediments exposed on Maria Madre Island, largest of the Tre??s Marias Islands off the Pacific coast of Mexico. The Neogene stratigraphic sequence exposed on Maria Madre Island includes a mid-Miocene(?) non-marine and/or shallow marine sandstone unconformably overlain by a lower upper Miocene to uppermost Miocene upper to middle bathyal laminated and massive diatomite, mudstone, and siltstone unit. This unit is unconformably overlain by lower Pliocene middle to lower bathyal sandstones and siltstones which, in turn, are unconformably overlain by upper Pliocene through Pleistocene(?) upper bathyal to upper middle bathyal foraminiferal limestones and siltstones. These beds are unconformably capped by Pleistocene terrace deposits. Basement rocks on the island include Cretaceous granite and granodiorite, and Tertiary(?) andesites and rhyolites. The upper Miocene diatomaceous unit contains a low diversity foraminiferal fauna dominated by species of Bolivina indicating low oxygen conditions in the proto-Gulf Maria Madre basin. The diatomaceous unit grades into a mudstone that contains a latest Miocene upper to middle bathyal biofacies characterized by Baggina californica and Uvigerina hootsi along with displaced neritic taxa. An angular unconformity separates the upper Miocene middle bathyal sediments from overlying lower Pliocene siltstones and mudstones that contain a middle to lower bathyal biofacies and abundant planktonic species including Neogloboquadrina acostaensis and Pulleniatina primalis indicating an early Pliocene age. Significantly, this Pliocene unit contains common occurrences of benthic species restricted to Miocene sediments in California including Bulimina uvigerinaformis. Pliocene to Pleistocene(?) foraminiferal limestones and siltstones characterize submarine bank accumulations formed during uplift of the Tre??s Marias Island area, and include

  16. Heterogeneous Inhibition in Macroscopic Current Responses of Four Nicotinic Acetylcholine Receptor Subtypes by Cholesterol Enrichment.

    Science.gov (United States)

    Báez-Pagán, Carlos A; Del Hoyo-Rivera, Natalie; Quesada, Orestes; Otero-Cruz, José David; Lasalde-Dominicci, José A

    2016-08-01

    The nicotinic acetylcholine receptor (nAChR), located in the cell membranes of neurons and muscle cells, mediates the transmission of nerve impulses across cholinergic synapses. In addition, the nAChR is also found in the electric organs of electric rays (e.g., the genus Torpedo). Cholesterol, which is a key lipid for maintaining the correct functionality of membrane proteins, has been found to alter the nAChR function. We were thus interested to probe the changes in the functionality of different nAChRs expressed in a model membrane with modified cholesterol to phospholipid ratios (C/P). In this study, we examined the effect of increasing the C/P ratio in Xenopus laevis oocytes expressing the neuronal α7, α4β2, muscle-type, and Torpedo californica nAChRs in their macroscopic current responses. Using the two-electrode voltage clamp technique, it was found that the neuronal α7 and Torpedo nAChRs are significantly more sensitive to small increases in C/P than the muscle-type nAChR. The peak current versus C/P profiles during enrichment display different behaviors; α7 and Torpedo nAChRs display a hyperbolic decay with two clear components, whereas muscle-type and α4β2 nAChRs display simple monophasic decays with different slopes. This study clearly illustrates that a physiologically relevant increase in membrane cholesterol concentration produces a remarkable reduction in the macroscopic current responses of the neuronal α7 and Torpedo nAChRs functionality, whereas the muscle nAChR appears to be the most resistant to cholesterol inhibition among all four nAChR subtypes. Overall, the present study demonstrates differential profiles for cholesterol inhibition among the different types of nAChR to physiological cholesterol increments in the plasmatic membrane. This is the first study to report a cross-correlation analysis of cholesterol sensitivity among different nAChR subtypes in a model membrane.

  17. Rapid and efficient filtration-based procedure for separation and safe analysis of CBRN mixed samples.

    Directory of Open Access Journals (Sweden)

    Mostafa Bentahir

    Full Text Available Separating CBRN mixed samples that contain both chemical and biological warfare agents (CB mixed sample in liquid and solid matrices remains a very challenging issue. Parameters were set up to assess the performance of a simple filtration-based method first optimized on separate C- and B-agents, and then assessed on a model of CB mixed sample. In this model, MS2 bacteriophage, Autographa californica nuclear polyhedrosis baculovirus (AcNPV, Bacillus atrophaeus and Bacillus subtilis spores were used as biological agent simulants whereas ethyl methylphosphonic acid (EMPA and pinacolyl methylphophonic acid (PMPA were used as VX and soman (GD nerve agent surrogates, respectively. Nanoseparation centrifugal devices with various pore size cut-off (30 kD up to 0.45 µm and three RNA extraction methods (Invisorb, EZ1 and Nuclisens were compared. RNA (MS2 and DNA (AcNPV quantification was carried out by means of specific and sensitive quantitative real-time PCRs (qPCR. Liquid chromatography coupled to time-of-flight mass spectrometry (LC/TOFMS methods was used for quantifying EMPA and PMPA. Culture methods and qPCR demonstrated that membranes with a 30 kD cut-off retain more than 99.99% of biological agents (MS2, AcNPV, Bacillus Atrophaeus and Bacillus subtilis spores tested separately. A rapid and reliable separation of CB mixed sample models (MS2/PEG-400 and MS2/EMPA/PMPA contained in simple liquid or complex matrices such as sand and soil was also successfully achieved on a 30 kD filter with more than 99.99% retention of MS2 on the filter membrane, and up to 99% of PEG-400, EMPA and PMPA recovery in the filtrate. The whole separation process turnaround-time (TAT was less than 10 minutes. The filtration method appears to be rapid, versatile and extremely efficient. The separation method developed in this work constitutes therefore a useful model for further evaluating and comparing additional separation alternative procedures for a safe handling and

  18. Interaction of alpha-conotoxin ImII and its analogs with nicotinic receptors and acetylcholine-binding proteins: additional binding sites on Torpedo receptor.

    Science.gov (United States)

    Kasheverov, Igor E; Zhmak, Maxim N; Fish, Alexander; Rucktooa, Prakash; Khruschov, Alexey Yu; Osipov, Alexey V; Ziganshin, Rustam H; D'hoedt, Dieter; Bertrand, Daniel; Sixma, Titia K; Smit, August B; Tsetlin, Victor I

    2009-11-01

    alpha-Conotoxins interact with nicotinic acetylcholine receptors (nAChRs) and acetylcholine-binding proteins (AChBPs) at the sites for agonists/competitive antagonists. alpha-Conotoxins blocking muscle-type or alpha7 nAChRs compete with alpha-bungarotoxin. However, alpha-conotoxin ImII, a close homolog of the alpha7 nAChR-targeting alpha-conotoxin ImI, blocked alpha7 and muscle nAChRs without displacing alpha-bungarotoxin (Ellison et al. 2003, 2004), suggesting binding at a different site. We synthesized alpha-conotoxin ImII, its ribbon isomer (ImIIiso), 'mutant' ImII(W10Y) and found similar potencies in blocking human alpha7 and muscle nAChRs in Xenopus oocytes. Both isomers displaced [(125)I]-alpha-bungarotoxin from human alpha7 nAChRs in the cell line GH(4)C(1) (IC(50) 17 and 23 microM, respectively) and from Lymnaea stagnalis and Aplysia californica AChBPs (IC(50) 2.0-9.0 microM). According to SPR measurements, both isomers bound to immobilized AChBPs and competed with AChBP for immobilized alpha-bungarotoxin (K(d) and IC(50) 2.5-8.2 microM). On Torpedo nAChR, alpha-conotoxin [(125)I]-ImII(W10Y) revealed specific binding (K(d) 1.5-6.1 microM) and could be displaced by alpha-conotoxin ImII, ImIIiso and ImII(W10Y) with IC(50) 2.7, 2.2 and 3.1 microM, respectively. As alpha-cobratoxin and alpha-conotoxin ImI displaced [(125)I]-ImII(W10Y) only at higher concentrations (IC(50)> or = 90 microM), our results indicate that alpha-conotoxin ImII and its congeners have an additional binding site on Torpedo nAChR distinct from the site for agonists/competitive antagonists.

  19. Assessment of the functionality and stability of detergent purified nAChR from Torpedo using lipidic matrixes and macroscopic electrophysiology.

    Science.gov (United States)

    Padilla-Morales, Luis F; Colón-Sáez, José O; González-Nieves, Joel E; Quesada-González, Orestes; Lasalde-Dominicci, José A

    2016-01-01

    In our previous study we examined the functionality and stability of nicotinic acetylcholine receptor (nAChR)-detergent complexes (nAChR-DCs) from affinity-purified Torpedo californica (Tc) using fluorescence recovery after photobleaching (FRAP) in Lipidic Cubic Phase (LCP) and planar lipid bilayer (PLB) recordings for phospholipid and cholesterol like detergents. In the present study we enhanced the functional characterization of nAChR-DCs by recording macroscopic ion channel currents in Xenopus oocytes using the two electrode voltage clamp (TEVC). The use of TEVC allows for the recording of macroscopic currents elicited by agonist activation of nAChR-DCs that assemble in the oocyte plasma membrane. Furthermore, we examined the stability of nAChR-DCs, which is obligatory for the nAChR crystallization, using a 30 day FRAP assay in LCP for each detergent. The present results indicate a marked difference in the fractional fluorescence recovery (ΔFFR) within the same detergent family during the 30 day period assayed. Within the cholesterol analog family, sodium cholate and CHAPSO displayed a minimum ΔFFR and a mobile fraction (MF) over 80%. In contrast, CHAPS and BigCHAP showed a marked decay in both the mobile fraction and diffusion coefficient. nAChR-DCs containing phospholipid analog detergents with an alkylphosphocholine (FC) and lysofoscholine (LFC) of 16 carbon chains (FC-16, LFC-16) were more effective in maintaining a mobile fraction of over 80% compared to their counterparts with shorter acyl chain (C12, C14). The significant differences in macroscopic current amplitudes, activation and desensitization rates among the different nAChR-DCs evaluated in the present study allow to dissect which detergent preserves both, agonist activation and ion channel function. Functionality assays using TEVC demonstrated that LFC16, LFC14, and cholate were the most effective detergents in preserving macroscopic ion channel function, however, the nAChR-cholate complex

  20. Use of Biostratigraphy to Increase Production, Reduce Operating Costs and Risks and Reduce Environmental Concerns in Oil Well Drilling

    Energy Technology Data Exchange (ETDEWEB)

    Edward Marks

    2005-09-09

    out at the top of the late Miocene, early Mohnian: Bolivina aff hughesi, Rotalia becki, Suggrunda californica, Virgulina grandis, Virgulina ticensis, Bulimina ecuadorana, Denticula lauta and Nonion medio-costatum. Please see Appendix B, Fig. 1, Neogene Zones, p. 91 and Appendix C, chart 5, p. 99 By the use of Stratigraphy, employing both Paleontology and Lithology, we can increase hydrocarbon production, reduce operating costs and risks by the identification of the productive sections, and reduce environmental concerns by drilling less dry holes needlessly.

  1. Characterization of two methylenedioxy bridge-forming cytochrome P450-dependent enzymes of alkaloid formation in the Mexican prickly poppy Argemone mexicana.

    Science.gov (United States)

    Díaz Chávez, Maria Luisa; Rolf, Megan; Gesell, Andreas; Kutchan, Toni M

    2011-03-01

    Formation of the methylenedioxy bridge is an integral step in the biosynthesis of benzo[c]phenanthridine and protoberberine alkaloids in the Papaveraceae family of plants. This reaction in plants is catalyzed by cytochrome P450-dependent enzymes. Two cDNAs that encode cytochrome P450 enzymes belonging to the CYP719 family were identified upon interrogation of an EST dataset prepared from 2-month-old plantlets of the Mexican prickly poppy Argemone mexicana that accumulated the benzo[c]phenanthridine alkaloid sanguinarine and the protoberberine alkaloid berberine. CYP719A13 and CYP719A14 are 58% identical to each other and 77% and 60% identical, respectively, to stylopine synthase CYP719A2 of benzo[c]phenanthridine biosynthesis in Eschscholzia californica. Functional heterologous expression of CYP719A14 and CYP719A13 in Spodoptera frugiperda Sf9 cells produced recombinant enzymes that catalyzed the formation of the methylenedioxy bridge of (S)-cheilanthifoline from (S)-scoulerine and of (S)-stylopine from (S)-cheilanthifoline, respectively. Twenty-seven potential substrates were tested with each enzyme. Whereas CYP719A14 transformed only (S)-scoulerine to (S)-cheilanthifoline (K(m) 1.9±0.3; k(cat)/K(m) 1.7), CYP719A13 converted (S)-tetrahydrocolumbamine to (S)-canadine (K(m) 2.7±1.3; k(cat)/K(m) 12.8), (S)-cheilanthifoline to (S)-stylopine (K(m) 5.2±3.0; k(cat)/K(m) 2.6) and (S)-scoulerine to (S)-nandinine (K(m) 8.1±1.9; k(cat)/K(m) 0.7). These results indicate that although CYP719A14 participates in only sanguinarine biosynthesis, CYP719A13 can be involved in both sanguinarine and berberine formation in A. mexicana. Copyright © 2010 Elsevier Inc. All rights reserved.

  2. Comparison of next generation sequencing technologies for transcriptome characterization

    Directory of Open Access Journals (Sweden)

    Soltis Douglas E

    2009-08-01

    Full Text Available Abstract Background We have developed a simulation approach to help determine the optimal mixture of sequencing methods for most complete and cost effective transcriptome sequencing. We compared simulation results for traditional capillary sequencing with "Next Generation" (NG ultra high-throughput technologies. The simulation model was parameterized using mappings of 130,000 cDNA sequence reads to the Arabidopsis genome (NCBI Accession SRA008180.19. We also generated 454-GS20 sequences and de novo assemblies for the basal eudicot California poppy (Eschscholzia californica and the magnoliid avocado (Persea americana using a variety of methods for cDNA synthesis. Results The Arabidopsis reads tagged more than 15,000 genes, including new splice variants and extended UTR regions. Of the total 134,791 reads (13.8 MB, 119,518 (88.7% mapped exactly to known exons, while 1,117 (0.8% mapped to introns, 11,524 (8.6% spanned annotated intron/exon boundaries, and 3,066 (2.3% extended beyond the end of annotated UTRs. Sequence-based inference of relative gene expression levels correlated significantly with microarray data. As expected, NG sequencing of normalized libraries tagged more genes than non-normalized libraries, although non-normalized libraries yielded more full-length cDNA sequences. The Arabidopsis data were used to simulate additional rounds of NG and traditional EST sequencing, and various combinations of each. Our simulations suggest a combination of FLX and Solexa sequencing for optimal transcriptome coverage at modest cost. We have also developed ESTcalc http://fgp.huck.psu.edu/NG_Sims/ngsim.pl, an online webtool, which allows users to explore the results of this study by specifying individualized costs and sequencing characteristics. Conclusion NG sequencing technologies are a highly flexible set of platforms that can be scaled to suit different project goals. In terms of sequence coverage alone, the NG sequencing is a dramatic advance

  3. Rapid and Efficient Filtration-Based Procedure for Separation and Safe Analysis of CBRN Mixed Samples

    Science.gov (United States)

    Bentahir, Mostafa; Laduron, Frederic; Irenge, Leonid; Ambroise, Jérôme; Gala, Jean-Luc

    2014-01-01

    Separating CBRN mixed samples that contain both chemical and biological warfare agents (CB mixed sample) in liquid and solid matrices remains a very challenging issue. Parameters were set up to assess the performance of a simple filtration-based method first optimized on separate C- and B-agents, and then assessed on a model of CB mixed sample. In this model, MS2 bacteriophage, Autographa californica nuclear polyhedrosis baculovirus (AcNPV), Bacillus atrophaeus and Bacillus subtilis spores were used as biological agent simulants whereas ethyl methylphosphonic acid (EMPA) and pinacolyl methylphophonic acid (PMPA) were used as VX and soman (GD) nerve agent surrogates, respectively. Nanoseparation centrifugal devices with various pore size cut-off (30 kD up to 0.45 µm) and three RNA extraction methods (Invisorb, EZ1 and Nuclisens) were compared. RNA (MS2) and DNA (AcNPV) quantification was carried out by means of specific and sensitive quantitative real-time PCRs (qPCR). Liquid chromatography coupled to time-of-flight mass spectrometry (LC/TOFMS) methods was used for quantifying EMPA and PMPA. Culture methods and qPCR demonstrated that membranes with a 30 kD cut-off retain more than 99.99% of biological agents (MS2, AcNPV, Bacillus Atrophaeus and Bacillus subtilis spores) tested separately. A rapid and reliable separation of CB mixed sample models (MS2/PEG-400 and MS2/EMPA/PMPA) contained in simple liquid or complex matrices such as sand and soil was also successfully achieved on a 30 kD filter with more than 99.99% retention of MS2 on the filter membrane, and up to 99% of PEG-400, EMPA and PMPA recovery in the filtrate. The whole separation process turnaround-time (TAT) was less than 10 minutes. The filtration method appears to be rapid, versatile and extremely efficient. The separation method developed in this work constitutes therefore a useful model for further evaluating and comparing additional separation alternative procedures for a safe handling and

  4. Food for Pollinators: Quantifying the Nectar and Pollen Resources of Urban Flower Meadows.

    Directory of Open Access Journals (Sweden)

    Damien M Hicks

    Full Text Available Planted meadows are increasingly used to improve the biodiversity and aesthetic amenity value of urban areas. Although many 'pollinator-friendly' seed mixes are available, the floral resources these provide to flower-visiting insects, and how these change through time, are largely unknown. Such data are necessary to compare the resources provided by alternative meadow seed mixes to each other and to other flowering habitats. We used quantitative surveys of over 2 million flowers to estimate the nectar and pollen resources offered by two exemplar commercial seed mixes (one annual, one perennial and associated weeds grown as 300m2 meadows across four UK cities, sampled at six time points between May and September 2013. Nectar sugar and pollen rewards per flower varied widely across 65 species surveyed, with native British weed species (including dandelion, Taraxacum agg. contributing the top five nectar producers and two of the top ten pollen producers. Seed mix species yielding the highest rewards per flower included Leontodon hispidus, Centaurea cyanus and C. nigra for nectar, and Papaver rhoeas, Eschscholzia californica and Malva moschata for pollen. Perennial meadows produced up to 20x more nectar and up to 6x more pollen than annual meadows, which in turn produced far more than amenity grassland controls. Perennial meadows produced resources earlier in the year than annual meadows, but both seed mixes delivered very low resource levels early in the year and these were provided almost entirely by native weeds. Pollen volume per flower is well predicted statistically by floral morphology, and nectar sugar mass and pollen volume per unit area are correlated with flower counts, raising the possibility that resource levels can be estimated for species or habitats where they cannot be measured directly. Our approach does not incorporate resource quality information (for example, pollen protein or essential amino acid content, but can easily do so

  5. Food for Pollinators: Quantifying the Nectar and Pollen Resources of Urban Flower Meadows

    Science.gov (United States)

    Hicks, Damien M.; Ouvrard, Pierre; Baldock, Katherine C. R.; Baude, Mathilde; Goddard, Mark A.; Kunin, William E.; Mitschunas, Nadine; Memmott, Jane; Morse, Helen; Nikolitsi, Maria; Osgathorpe, Lynne M.; Potts, Simon G.; Robertson, Kirsty M.; Scott, Anna V.; Sinclair, Frazer; Westbury, Duncan B.; Stone, Graham N.

    2016-01-01

    Planted meadows are increasingly used to improve the biodiversity and aesthetic amenity value of urban areas. Although many ‘pollinator-friendly’ seed mixes are available, the floral resources these provide to flower-visiting insects, and how these change through time, are largely unknown. Such data are necessary to compare the resources provided by alternative meadow seed mixes to each other and to other flowering habitats. We used quantitative surveys of over 2 million flowers to estimate the nectar and pollen resources offered by two exemplar commercial seed mixes (one annual, one perennial) and associated weeds grown as 300m2 meadows across four UK cities, sampled at six time points between May and September 2013. Nectar sugar and pollen rewards per flower varied widely across 65 species surveyed, with native British weed species (including dandelion, Taraxacum agg.) contributing the top five nectar producers and two of the top ten pollen producers. Seed mix species yielding the highest rewards per flower included Leontodon hispidus, Centaurea cyanus and C. nigra for nectar, and Papaver rhoeas, Eschscholzia californica and Malva moschata for pollen. Perennial meadows produced up to 20x more nectar and up to 6x more pollen than annual meadows, which in turn produced far more than amenity grassland controls. Perennial meadows produced resources earlier in the year than annual meadows, but both seed mixes delivered very low resource levels early in the year and these were provided almost entirely by native weeds. Pollen volume per flower is well predicted statistically by floral morphology, and nectar sugar mass and pollen volume per unit area are correlated with flower counts, raising the possibility that resource levels can be estimated for species or habitats where they cannot be measured directly. Our approach does not incorporate resource quality information (for example, pollen protein or essential amino acid content), but can easily do so when suitable

  6. Immune responses of Helicoverpa armigera to different kinds of pathogens

    Directory of Open Access Journals (Sweden)

    Zhao Xiao-Fan

    2010-03-01

    Full Text Available Abstract Background Insects react against pathogens through innate immunity. The cotton bollworm Helicoverpa armigera (H. armigera is an important defoliator and an extremely destructive pest insect of many crops. The elucidation of the mechanism of the immune response of H. armigera to various pathogens can provide a theoretical basis for new approaches to biologically control this pest. Results Four kinds of pathogens Bacillus thuringiensis, Klebsiella pneumoniae, Candida albicans, and Autographa californica multiple nucleocapsid nucleopolyhedrovirus harbored green fluorescence protein and polyhedron (AcMNPV-GFP were used to challenge the insect. The cellular and humoral immune responses to the pathogens were analyzed in the challenged H. armigera. The results show that in the five kinds of haemocytes, only granulocytes phagocytized the Gram-negative and Gram-positive bacteria and fungi. All haemocytes can be infected by AcMNPV. Fourteen immune-related genes including pattern recognition receptors (PRRs such as peptidoglycan recognition proteins (HaPGRP and HaPGRP C and Gram-Negative Bacteria-Binding Protein (HaGNBP, and antimicrobial peptides (AMPs such as cecropin-1, 2 and 3 (HaCec-1, 2 and 3, lysozyme (HaLys, attacin (HaAtt, gallerimycin-like (HaGall, gloverin-like (HaGlo, moricin-like (HaMor, cobatoxin-like (HaCob, galiomicin-like (HaGali, and immune inducible protein (HaIip appeared in different expression profiles to different pathogen infections. The transcripts of 13 immune related genes (except HaPGRPC are obviously up-regulated by Gram-positive bacteria. HaCec-1 and 3, HaMor, HaAtt, HaLys, HaIip, HaPGRP and HaGNBP are greatly up-regulated after fungal infection. HaGNBP, HaCec-2, HaGall, HaGlo, HaMor, HaCob, HaGali obviously increased in Gram-negative bacterial infection. Only five genes, HaGNBP, HaCec-1, HaGali, HaGlo, and HaLys, are weakly up-regulated after viral infection. The AMP transcripts had higher expression levels than the

  7. Mollusks from late Mesozoic seep deposits, chiefly in California.

    Science.gov (United States)

    Kaim, Andrzej; Jenkins, Robert G; Tanabe, Kazushige; Kiel, Steffen

    2014-09-17

    to high-spired littoriniform adult shells and juvenile teleoconchs with a subsutural ramp. Paskentana hamiltonensis sp. nov. is described from the Early Cretaceous of California. Ataphrus is considered to represent a nomen dubium because its type species is poorly preserved and there are uncertainties regarding its type locality and age. The bivalves reported herein belong to known species, but our new material revealed additional characters, and/or their supraspecific position is revised and new combinations are proposed: Solemya stantoni Vokes, 1955 is transferred to Acharax, Nucula gabbi Stanton, 1895 is transferred to Leionucula, Pecten complexicostata Gabb, 1869 is transferred to Lyriochlamys, Astarte californica Stanton, 1895 is transferred to Neocrassina, Astarte trapezoidalis Stanton, 1895 is transferred to Oxyeurax, and Corbula? persulcata Stanton, 1895 is transferred to Cuspidaria? 

  8. Memory maintenance by PKMζ — an evolutionary perspective

    Directory of Open Access Journals (Sweden)

    Sacktor Todd

    2012-09-01

    Full Text Available Abstract Long-term memory is believed to be maintained by persistent modifications of synaptic transmission within the neural circuits that mediate behavior. Thus, long-term potentiation (LTP is widely studied as a potential physiological basis for the persistent enhancement of synaptic strength that might sustain memory. Whereas the molecular mechanisms that initially induce LTP have been extensively characterized, the mechanisms that persistently maintain the potentiation have not. Recently, however, a candidate molecular mechanism linking the maintenance of LTP and the storage of long-term memory has been identified. The persistent activity of the autonomously active, atypical protein kinase C (aPKC isoform, PKMζ, is both necessary and sufficient for maintaining LTP. Furthermore, blocking PKMζ activity by pharmacological or dominant negative inhibitors disrupts previously stored long-term memories in a variety of neural circuits, including spatial and trace memories in the hippocampus, aversive memories in the basolateral amygdala, appetitive memories in the nucleus accumbens, habit memory in the dorsal lateral striatum, and elementary associations, extinction, and skilled sensorimotor memories in the neocortex. During LTP and memory formation, PKMζ is synthesized de novo as a constitutively active kinase. This molecular mechanism for memory storage is evolutionarily conserved. PKMζ formation through new protein synthesis likely originated in early vertebrates ~500 million years ago during the Cambrian period. Other mechanisms for forming persistently active PKM from aPKC are found in invertebrates, and inhibiting this atypical PKM disrupts long-term memory in the invertebrate model systems Drosophila melanogaster and Aplysia californica. Conversely, overexpressing PKMζ enhances memory in flies and rodents. PKMζ persistently enhances synaptic strength by maintaining increased numbers of AMPA receptors at postsynaptic sites, a mechanism

  9. Food for Pollinators: Quantifying the Nectar and Pollen Resources of Urban Flower Meadows.

    Science.gov (United States)

    Hicks, Damien M; Ouvrard, Pierre; Baldock, Katherine C R; Baude, Mathilde; Goddard, Mark A; Kunin, William E; Mitschunas, Nadine; Memmott, Jane; Morse, Helen; Nikolitsi, Maria; Osgathorpe, Lynne M; Potts, Simon G; Robertson, Kirsty M; Scott, Anna V; Sinclair, Frazer; Westbury, Duncan B; Stone, Graham N

    2016-01-01

    Planted meadows are increasingly used to improve the biodiversity and aesthetic amenity value of urban areas. Although many 'pollinator-friendly' seed mixes are available, the floral resources these provide to flower-visiting insects, and how these change through time, are largely unknown. Such data are necessary to compare the resources provided by alternative meadow seed mixes to each other and to other flowering habitats. We used quantitative surveys of over 2 million flowers to estimate the nectar and pollen resources offered by two exemplar commercial seed mixes (one annual, one perennial) and associated weeds grown as 300m2 meadows across four UK cities, sampled at six time points between May and September 2013. Nectar sugar and pollen rewards per flower varied widely across 65 species surveyed, with native British weed species (including dandelion, Taraxacum agg.) contributing the top five nectar producers and two of the top ten pollen producers. Seed mix species yielding the highest rewards per flower included Leontodon hispidus, Centaurea cyanus and C. nigra for nectar, and Papaver rhoeas, Eschscholzia californica and Malva moschata for pollen. Perennial meadows produced up to 20x more nectar and up to 6x more pollen than annual meadows, which in turn produced far more than amenity grassland controls. Perennial meadows produced resources earlier in the year than annual meadows, but both seed mixes delivered very low resource levels early in the year and these were provided almost entirely by native weeds. Pollen volume per flower is well predicted statistically by floral morphology, and nectar sugar mass and pollen volume per unit area are correlated with flower counts, raising the possibility that resource levels can be estimated for species or habitats where they cannot be measured directly. Our approach does not incorporate resource quality information (for example, pollen protein or essential amino acid content), but can easily do so when suitable data

  10. Baculovirus-challenge and poor nutrition inflict within-generation fitness costs without triggering transgenerational immune priming.

    Science.gov (United States)

    Shikano, Ikkei; Hua, Kevin Ngoc; Cory, Jenny S

    2016-05-01

    Invertebrate hosts that survive pathogen challenge can produce offspring that are more resistant to the same pathogen via immune priming, thereby improving the fitness of their offspring in the same pathogen environment. Most evidence for immune priming comes from exposure to bacteria and there are limited data on other groups of pathogens. Poor parental nutrition has also been shown to result in the transgenerational transfer of pathogen resistance and increased immunocompetence. Here, we combine exposure to an insect DNA virus with a change in the parental diet to examine both parental costs and transgenerational immune priming. We challenged the cabbage looper, Trichoplusia ni, with a low dose of the baculovirus, Autographa californica multiple nucleopolyhedrovirus (AcMNPV) and altered dietary protein to carbohydrate ratio (p:c ratio) after virus exposure. Insects fed a low protein diet had lower haemolymph protein concentrations, and exhibited costs of smaller pupae and slower development, while survivors of virus challenge developed more slowly, irrespective of p:c ratio, and those that were virus-challenged and fed on a low protein diet showed a reduction in haemocyte density. In addition, AcMNPV-challenged parents laid fewer eggs earlier in egg laying although egg size was the same as for unchallenged parents. There was no evidence for increased resistance to AcMNPV (immune priming) or changes in haemocyte number (as proxy for constitutive cellular immunity) in the offspring either as a result of parental AcMNPV-challenge or low dietary p:c ratio. Therefore, although pathogen-challenge and nutritional changes can affect host development and reproduction, this does not necessarily translate into transgenerational immune priming. Our findings contrast with an earlier study on another type of baculovirus, a granulovirus, where immune priming was suggested. This indicates that transgenerational immune priming is not universal in invertebrates and is likely to

  11. A synoptic review of the genus Stagmomantis (Mantodea: Mantidae).

    Science.gov (United States)

    Maxwell, Michael R

    2014-02-21

    Stagmomantis is a remarkable genus within the Mantodea, being relatively species-rich and geographically widespread.  Yet, the number of species within the genus remains curiously unresolved.  The present synoptic review surveys the literature on Stagmomantis to identify named species for which scientific consensus exists, as well as to summarize basic biological information for each species, including geographic distribution, morphological features, and sex-specific biometric data.  The review identifies 23 consensus taxa within Stagmomantis:  22 separate species, with one of these species, S. montana, split into two subspecies (S. m. montana and S. m. sinaloae).   The review indicates morphological features that may prove to be diagnostic for a given species, particularly when examined in conjunction with male genitalia.  Such features include dark spots on the anterior femur (S. amazonica, S. centralis, S. marginata, S. nahua, S. venusta, S. vicina), spines or denticulations on the anterior coxa (S. colorata, S. montana montana, S. parvidentata, S. theophila), and dark bands on abdominal tergites (S. californica, S. colorata, S. domingensis).  Color variation of certain features with respect to body coloration, such as stigma coloration and body and leg markings, requires more attention. Information on life history, reproduction, and ecology are summarized, particularly for temperate populations of S. carolina and S. limbata.  While the 23 consensus taxa represent a robust appraisal of the existing literature, some taxonomic uncertainties remain.  The status of two species are somewhat unclear (S. marginata and S. tolteca), calling for taxonomic evaluation.  Furthermore, proposed within-genus groupings deserve examination, as do possible subdivisions within some species (e.g., S. limbata, S. parvidentata).  Information on basic morphology and biometry remains incomplete for nearly all species.  Extreme examples are S. amazonica, S. costalis, and S

  12. Monitoring breeding and migration of neotropical migratory birds at Point Loma, San Diego County, California, 5-year summary, 2011–15

    Science.gov (United States)

    Lynn, Suellen; Madden, Melanie C.; Kus, Barbara E.

    2017-04-27

    across 5 years. Annual breeding productivity for most species was low in 2014 and high in 2015. Bewick’s wren had the highest breeding productivity of the six most commonly captured species, followed by bushtit. Orange-crowned warbler had the lowest breeding productivity. Breeding productivity was a significant predictor of population size the next year for bushtit, but not for any other resident breeding species examined.Adult survivorship was generally high from 2013 to 14, and low from 2014 to 15. Wrentits had the highest survivorship of the most common species captured, followed by California towhee and orange-crowned warbler. Adult survivorship was lowest for bushtits and spotted towhees. Adult survivorship was a significant predictor of population size for bushtits, but not for any other resident species examined.Our monitoring results indicate that Point Loma provides breeding habitat for seven species of conservation concern. One of these species, the federally threatened Polioptila californica californica (California gnatcatcher), was documented breeding at the study site.

  13. Construction of a medicinal leech transcriptome database and its application to the identification of leech homologs of neural and innate immune genes

    Directory of Open Access Journals (Sweden)

    Wincker Patrick

    2010-06-01

    evolutionarily conserved sequences, representing all known pathways involved in these important functions. Conclusions The sequences obtained for Hirudo transcripts represent the first major database of genes expressed in this important model system. Comparison of translated open reading frames (ORFs with the other openly available leech datasets, the genome and transcriptome of Helobdella robusta, shows an average identity at the amino acid level of 58% in matched sequences. Interestingly, comparison with other available Lophotrochozoans shows similar high levels of amino acid identity, where sequences match, for example, 64% with Capitella capitata (a polychaete and 56% with Aplysia californica (a mollusk, as well as 58% with Schistosoma mansoni (a platyhelminth. Phylogenetic comparisons of putative Hirudo innate immune response genes present within the Hirudo transcriptome database herein described show a strong resemblance to the corresponding mammalian genes, indicating that this important physiological response may have older origins than what has been previously proposed.

  14. ФЛОРИСТИЧЕСКИЕ НАХОДКИ В БАССЕЙНЕ ВЕРХНЕГО ЕНИСЕЯ (III

    Directory of Open Access Journals (Sweden)

    D. N. Shaulo

    2016-12-01

    Full Text Available В результате экспедиционных исследований, анализа ранее опубликованных работ и просмотра материалов, хранящихся в гербариях ЦСБС (NS, NSK, заповедниках «Азас» и "Саяно-Шушенский", уточнены сведения о видовом составе флоры бассейна Верхнего Енисея. Впервые во флоре Тувы отмечены Aquilegia aradanica, Eschscholzia californica, Sisymbrium volgense, Louseania triloba, Cotoneaster mongolicus, Microcerasus tomentosa, Prunus salicina subsp. ussuriensis, Sorbaria sorbifolia, Medicago x varia, Tagetes patula; новыми видами пополнилась флора государственного природного заповедника "Азас" – Alisma gramineum, Calla palustris; во флоре южной части Красноярского края (Западный Саян – Aquilegia synakensis. Уточнено распространение и обнаружены новые местонахождения редких на этой территории видов – Sphoerophysa salsula, Alisma gramineum, Hordeum bogdanii, Acorus calamus.

  15. Biosafety of Recombinant and Wild Type Nucleopolyhedroviruses as Bioinsecticides

    Directory of Open Access Journals (Sweden)

    Bruce D. Hammock

    2007-06-01

    Full Text Available The entomopathogenic Autographa californica (Speyer nucleopolyhedrovirus (AcMNPV has been genetically modified to increase its speed of kill. The potential adverse effects of a recombinant AcMNPV (AcAaIT as well as wild type AcMNPV and wild type Spodoptera littoralis NPV (SlNPV were studied. Cotton plants were treated with these viruses at concentrations that were adjusted to resemble the recommended field application rate (4 x 1012 PIBs/feddan, feddan = 4,200 m2 and 3rd instar larvae of S. littoralis were allowed to feed on the contaminated plants. SDS-PAGE, ELISA, and DNA analyses were used to confirm that larvae that fed on these plants were virus-infected. Polyhedra that were purified from the infected larvae were subjected to structural protein analysis. A 32 KDa protein was found in polyhedra that were isolated from all of the viruses. Subtle differences were found in the size and abundance of ODV proteins. Antisera against polyhedral proteins isolated from AcAaIT polyhedra were raised in rabbits. The terminal bleeds from rabbits were screened against four coating antigens (i.e., polyhedral proteins from AcAaIT, AcAaIT from field-infected larvae (AcAaIT-field, AcMNPV, and SlNPV using a two-dimensional titration method with the coated antigen format. Competitive inhibition experiments were conducted in parallel to optimize antibody and coating antigen concentrations for ELISA. The IC50 values for each combination ranged from 1.42 to 163 μg/ml. AcAaIT-derived polyhedrin gave the lowest IC50 value, followed by those of SlNPV, AcAaIT-field, and AcMNPV. The optimized ELISA system showed low cross reactivity for AcMNPV (0.87%, AcAaIT-field (1.2%, and SlNPV (4.0%. Genomic DNAs isolated from AcAaIT that were passaged in larvae of S. littoralis that were reared in the laboratory or field did not show any detectable differences. Albino rats (male and female that were treated with AcAaIT, AcMNPV or SlNPV (either orally or by intraperitoneal