Tratamento cirúrgico da litíase vesical: revisão de literatura

Directory of Open Access Journals (Sweden)

Fabio Cesar Miranda Torricelli

Full Text Available Cálculos vesicais são raros e a maioria dos casos ocorre em homens adultos com obstrução infravesical. Atualmente, existem poucos dados sobre o melhor tratamento desta doença. O objetivo desta revisão foi discutir alguns aspectos da patogênese e abordar o tratamento da litíase vesical. Uma ampla pesquisa na base de dados da "National Library of Medicine"/Pubmed foi realizada com os seguintes unitermos e descritores: vesical ou bexiga associados a cálculo, pedra ou litíase, e cistolitotripsia. Cento e setenta e um artigos foram identificados. Os artigos foram avaliados independentemente por dois revisores com experiência em urolitíase. Foram incluídos quando os resultados, complicações e seguimento foram claramente reportados. No final, 32 estudos preencheram os critérios de inclusão. Nota-se que diversas opções para o tratamento da litíase vesical estão disponíveis, porém não há estudos randomizados comparando-as. Diferentes taxas de pacientes livres de cálculo são descritas, sendo: litotripsia extracorpórea com ondas de choque (75-100%, cistolitotripsia transureteroscópica (63-100%, cistolitotripsia percutânea (89-100% e cirurgia aberta (100%. O acesso percutâneo apresenta menor morbidade com resultados semelhantes ao tratamento transuretral, enquanto a litotrispsia extracorpórea apresenta as menores de taxas de eliminação de cálculos e fica reservada aos pacientes de alto risco cirúrgico.

IR Image upconversion using band-limited ASE illumination fiber sources.

Science.gov (United States)

Maestre, H; Torregrosa, A J; Capmany, J

2016-04-18

We study the field-of-view (FOV) of an upconversion imaging system that employs an Amplified Spontaneous Emission (ASE) fiber source to illuminate a transmission target. As an intermediate case between narrowband laser and thermal illumination, an ASE fiber source allows for higher spectral intensity than thermal illumination and still keeps a broad wavelength spectrum to take advantage of an increased non-collinear phase-matching angle acceptance that enlarges the FOV of the upconversion system when compared to using narrowband laser illumination. A model is presented to predict the angular acceptance of the upconverter in terms of focusing and ASE spectral width and allocation. The model is experimentally checked in case of 1550-630 nm upconversion.

High-sensitive portable ASE-2 X-ray analyzer of sulfur in mineral oil

International Nuclear Information System (INIS)

Anchugov, I.S.; Goganov, A.D.; Plotnikov, R.I.

2007-01-01

The high-sensitivity ASE-2 analyzer of sulfur on the basis of existing ASE-I device is designed. ASE-2 analyzer realizes a standard method of energy dispersion X-ray fluorescent determinations of a sulfur mass fraction in mineral oil and allows to carry out the quantitative determination of sulfur in hydrocarbonic raw material and fuel in a 0.002-5 mass.% range [ru

Candidíase vulvovaginal: fatores predisponentes do hospedeiro e virulência das leveduras

OpenAIRE

Álvares,Cassiana Aparecida; Svidzinski,Terezinha Inez Estivalet; Consolaro,Márcia Edilaine Lopes

2007-01-01

INTRODUÇÃO: Leveduras do gênero Candida são patógenos oportunistas freqüentemente isolados das superfícies mucosas de indivíduos normais, mas podem levar ao desenvolvimento de infecções denominadas candidíases, que variam desde lesões superficiais até infecções disseminadas. OBJETIVOS: Ampliar os conhecimentos sobre candidíase vulvovaginal (CVV: infecção de vulva e vagina, causada por leveduras comensais que habitam a mucosa vaginal) e candidíase vulvovaginal recorrente (CVVR: ocorrência de q...

Periungual capillaroscopy in psoriasis Capilaroscopia periungueal em psoríase

Directory of Open Access Journals (Sweden)

Camila Ferrari Ribeiro

2012-08-01

Full Text Available BACKGROUND: Nailfold capillaroscopy is a useful technique for evaluating changes in microcirculation. OBJECTIVE: To investigate changes at nailfold capillaroscopy in psoriatic patients compared with controls. METHODS: Nailfold capillaroscopy was performed in 46 psoriatic patients and 50 controls to assess microscopic morphological changes, capillary density and the presence of areas with devascularization. RESULTS: Patients with psoriasis had lower capillary density (p=0.0005, increased avascular areas (p=0.0035 and an increased number of morphologically abnormal capillaries (coiled, pFUNDAMENTOS: A capilaroscopia periungueal é um método utilizado no estudo de alterações da microcirculação. OBJETIVO: Verificar alterações na capilaroscopia periungueal de pacientes com psoríase, comparando-os com controles saudáveis. MÉTODOS: A capilaroscopia periungueal foi realizada em 46 pacientes com psoríase e 50 controles, utilizando-se um estereomicroscópio e observando-se alterações morfológicas, densidade capilar e presença de áreas com desvascularização. RESULTADOS: Pacientes com psoríase tinham menor densidade capilar (p=0,0005, maior presença de áreas avasculares (p=0,0035 e de capilares morfologicamente alterados (enrodilhados; p<0.0001 do que os controles. Não se encontrou associação entre densidade capilar e tempo de doença (p=0.92 ou grau de envolvimento cutâneo medido pelo PASI (p=0.59. A presença de áreas avasculares foi mais comum em indivíduos com psoríase que tinham envolvimento ungueal (p=0,047. CONCLUSÃO: Pacientes com psoríase têm menor densidade capilar e presença de capilares morfologicamente alterados em relação aos controles.

Avaliação da resposta imune celular em pacientes com candidíase recorrente

OpenAIRE

Carvalho,Lucas P.; Bacellar,Olívia; Neves,Nilma A.; Carvalho,Edgar M.; Jesus,Amélia R. de

2003-01-01

A candidíase recorrente cutânea ou mucosa é caracterizada pela ocorrência de, no mínimo, 4 episódios de candidíase no período de um ano. Não são conhecidos os fatores que levam à recorrência desta infecção. O presente estudo avaliou a resposta linfoproliferativa e a produção de IFN-g de pacientes com candidíase recorrente. Os índices de estimulação da resposta linfoproliferativa em culturas de células de pacientes com candidíase recorrente estimuladas com antígeno de Candida albicans, PPD e T...

Avaliação da resposta imune celular em pacientes com candidíase recorrente

OpenAIRE

Carvalho, Lucas Pedreira de; Bacellar, Maria Olívia Amado Ramos; Neves, Nilma Antas; Carvalho Filho, Edgar Marcelino de; Jesus, Amélia R. de

2003-01-01

p. 571-576 A candidíase recorrente cutânea ou mucosa é caracterizada pela ocorrência de, no mínimo, 4 episódios de candidíase no período de um ano. Não são conhecidos os fatores que levam à recorrência desta infecção. O presente estudo avaliou a resposta linfoproliferativa e a produção de IFN-g de pacientes com candidíase recorrente. Os índices de estimulação da resposta linfoproliferativa em culturas de células de pacientes com candidíase recorrente estimuladas com antígeno de Candida alb...

KEBIJAKAN INVESTASI ASING BIDANG PERTAMBANGAN DI KABUPATEN POHUWATO PROVINSI GORONTALO KEBIJAKAN INVESTASI ASING BIDANG PERTAMBANGAN DI KABUPATEN POHUWATO PROVINSI GORONTALO KEBIJAKAN INVESTASI ASING BIDANG PERTAMBANGAN DI KABUPATEN POHUWATO PROVINSI GORONTALO KASUS PT. PANI DHARMA MAS KASUS PT. PANI DHARMA MAS KASUS PT. PANI DHARMA MAS

OpenAIRE

PUYO, AJENG MAWADDAH PUYO AJENG MAWADDAH PUYO AJENG MAWADDAH

2016-01-01

2016 AJENG MAWADDAH PUYO, E 131 12 003, "Kebijakan Investasi Asing Dalam Bidang Pertambangan di Kabupaten Pohuwato Provinsi Gorontalo Kasus PT. Pani Dharma MAS", dibawah bimbingan Dr. H. Adi Suryadi B., MA selaku pembimbing I dan Pusparida Syahdan. S.sos., MSI, Departemen Ilmu Hubungan internasional, Fakultas Ilmu Sosial dan Ilmu Politik, Universitas Hasanuddin. Penelitian ini bertujuan untuk mengetahui peran stakeholders dalam perumusan kebijakan investasi asing da...

HEX kiirustab ASe end registreerima / Virkko Lepassalu

Index Scriptorium Estoniae

Lepassalu, Virkko, 1971-

2003-01-01

Ilmunud ka: Delovõje Vedomosti 28. mai lk. 2. Eesti väärtpaberite keskregistri seaduse ja äriseadustiku muudatustest, mille kohaselt peavad 1. juuliks kõik aktsiaseltsid olema end väärtpaberite keskregistris arvele võtnud. Lisatud tabel: kolmandik ASe registreerimata

Estudo piloto sobre alimentos que devem ser evitados nos portadores de psoríase

OpenAIRE

Festugato,Moira

2011-01-01

FUNDAMENTOS: Psoríase é uma doença inflamatória crônica, sistêmica, mediada por fatores imunológicos. Serão abordados os alimentos que atuam sobre estes fatores, contribuindo para a psoríase. Como doença sistêmica, que compartilha o mesmo substrato fisiopatológico com outras comorbidades, a dieta alimentar também leva à piora das comorbidades. OBJETIVO: Destacar um grupo de alimentos que pode atuar como um fator de manifestação e/ou agravo da psoríase e ao mesmo tempo viabilizar estratégias i...

Quantum yield measurements of light-induced H₂ generation in a photosystem I-[FeFe]-H₂ase nanoconstruct.

Science.gov (United States)

Applegate, Amanda M; Lubner, Carolyn E; Knörzer, Philipp; Happe, Thomas; Golbeck, John H

2016-01-01

The quantum yield for light-induced H2 generation was measured for a previously optimized bio-hybrid cytochrome c 6-crosslinked PSI(C13G)-1,8-octanedithiol-[FeFe]-H2ase(C97G) (PSI-H2ase) nanoconstruct. The theoretical quantum yield for the PSI-H2ase nanoconstruct is 0.50 molecules of H2 per photon absorbed, which equates to a requirement of two photons per H2 generated. Illumination of the PSI-H2ase nanoconstruct with visible light between 400 and 700 nm resulted in an average quantum yield of 0.10-0.15 molecules of H2 per photon absorbed, which equates to a requirement of 6.7-10 photons per H2 generated. A possible reason for the difference between the theoretical and experimental quantum yield is the occurrence of non-productive PSI(C13G)-1,8-octanedithiol-PSIC13G (PSI-PSI) conjugates, which would absorb light without generating H2. Assuming the thiol-Fe coupling is equally efficient at producing PSI-PSI conjugates as well as in producing PSI-H2ase nanoconstructs, the theoretical quantum yield would decrease to 0.167 molecules of H2 per photon absorbed, which equates to 6 photons per H2 generated. This value is close to the range of measured values in the current study. A strategy that purifies the PSI-H2ase nanoconstructs from the unproductive PSI-PSI conjugates or that incorporates different chemistries on the PSI and [FeFe]-H2ase enzyme sites could potentially allow the PSI-H2ase nanoconstruct to approach the expected theoretical quantum yield for light-induced H2 generation.

Imunologia da hanseníase Immunology of leprosy

Directory of Open Access Journals (Sweden)

Vanessa Amaral Mendonça

2008-08-01

Full Text Available A hanseníase é doença crônica infecciosa que se caracteriza por apresentar formas clínicas contrastantes, que são dependentes da interação do bacilo com a resposta imune do hospedeiro. O estudo dos processos imunológicos torna-se fundamental para o entendimento dos mecanismos envolvidos na apresentação e no desenvolvimento da doença. Neste artigo, é revisada a imunopatogênese da hanseníase.Leprosy is a chronic infectious disease characterized by contrasting clinical forms that are dependent on the interactions between the bacillus and the host immune response. Thus, the study of the immunological process is extremely relevant for the comprehension of the mechanisms involved in leprosy presentation and development. In this paper, the immunopathogenesis of leprosy is reviewed.

The Roles of Fission Yeast Ase1 in Mitotic Cell Division, Meiotic Nuclear Oscillation, and Cytokinesis Checkpoint SignalingD⃞V⃞

OpenAIRE

Yamashita, Akira; Sato, Masamitsu; Fujita, Akiko; Yamamoto, Masayuki; Toda, Takashi

2005-01-01

The Ase1/Prc1 proteins constitute a conserved microtubule-associated protein family that is implicated in central spindle formation and cytokinesis. Here we characterize a role for fission yeast Ase1. Ase1 localizes to microtubule overlapping zones and displays dynamic alterations of localization during the cell cycle. In particular, its spindle localization during metaphase is reduced substantially, followed by robust appearance at the spindle midzone in anaphase. ase1 deletions are viable b...

Giardíase e helmintíases em crianças de creches e escolas de 1° e 2° graus (públicas e privadas da cidade de Mirassol (SP, Brasil

Directory of Open Access Journals (Sweden)

Machado Renato Carlos

1999-01-01

Full Text Available O presente trabalho mostrou freqüências diferentes de parasitoses intestinais (giardíase e helmintíases entre crianças de pré-escolas e de escolas de 1 e 2 Graus, públicas e privadas. Pesquisou-se 199 indivíduos, sendo 96 pertencentes às instituições públicas e 103 pertencentes às instituições particulares. Nas instituições públicas as freqüências de giardíase foram maiores que nas instituições privadas. Para as helmintíases, as freqüências foram semelhantes entre as creches, porém maiores na escola pública em relação à particular. Indicadores do nível sócio-econômico, de escolaridade, de saneamento básico, como determinantes de parasitose intestinal, evidenciaram que as maiores freqüências de parasitoses ocorreram tanto entre as crianças de baixa renda quanto entre as que tinham pais com nível de escolaridade mais baixo. Também a origem das hortaliças foi um fator significativo para determinação destas parasitoses.

Trace Elements Concentrations in Water and Aquatic Biota from Ase ...

African Journals Online (AJOL)

Trace Elements Concentrations in Water and Aquatic Biota from Ase Creek in Niger ... arsenic, chromium, lead, molybdenum, bismuth and cadmium using atomic ... metal pollution, metal variation, environmental monitoring, bioaccumulation.

ATP-ase positive cells in human oral mucosa transplanted to nude mice

DEFF Research Database (Denmark)

Dabelsteen, E; Kirkeby, S

1981-01-01

A model to study the differentiation of human oral epithelium in vivo utilizing transplantation of human tissue to nude mice has been described. Previous studies have described the epithelial cells in this model. In this study we demonstrate that 8 d after transplantation, Langerhans cells, ident......, identified as ATP-ase positive dendritic cells, have almost disappeared from the transplanted epithelium whereas at day 21 after transplantation such cells were abundant. It is suggested that the ATP-ase positive cells which reappear in the transplanted epithelium are of mouse origin....

Pitiríase versicolor e síndrome da imunodeficiência adquirida (SIDA

Directory of Open Access Journals (Sweden)

Roza Marlon Soares

2003-01-01

Full Text Available FUNDAMENTOS: A pitiríase versicolor é uma infecção crônica recorrente da camada córnea causada pela Malassezia furfur, geralmente assintomática, podendo ser causa de fungemia. A síndrome da imunodeficiência adquirida caracteriza-se por uma importante depressão celular, o que propicia a ocorrência de infecções oportunistas. OBJETIVOS: Dados a imunodepressão causada pelo HIV e o risco da presença de M. furfur em sua forma patogênica no imunocomprometido, realizou-se este trabalho comparativo buscando as reais diferenças da pitiríase versicolor no imunocompetente e no imunodeprimido pelo HIV. PACIENTES E MÉTODOS: Foram avaliados, no período de julho de 1998 a junho de 1999, 50 pacientes HIV positivos do Hospital Universitário da UFJF. Como grupo controle, foram examinados de forma aleatória 50 pacientes soronegativos para HIV. Para cada paciente foi preenchido um protocolo constando de identificação e exames clínicos e laboratoriais. RESULTADOS: A pitiríase versicolor foi diagnosticada clinicamente no grupo HIV positivo em sete (14% pacientes, resultado coincidente no grupo controle. Quanto ao passado para a pitiríase versicolor, 12 (24% pacientes já haviam apresentado tal doença no grupo HIV positivo, e igual incidência ocorreu no grupo controle. CONCLUSÕES: A pitiríase versicolor não se mostrou mais freqüente e nem mais agressiva na população imunodeprimida pelo HIV em relação ao grupo controle, enquanto a dermatite seborréica apresentou-se mais freqüente no grupo infectado pelo HIV.

Estrongiloidíase em pacientes com pênfigo foliáceo

OpenAIRE

Tavares-Neto,José; Alves,Denise Barcelos; Franciscon,José Umberto; Serrano,Carlos Roberto S.

1991-01-01

Em 30 pacientes com pênfigo foliáceo, a freqüência da estrongiloidíase foi de 40,0%, através de três exames de Baermann-Moraes. No "Hospital do Pênfigo", em Uberaba, as freqüências da estrongiloidíase nos funcionários (n = 14) e escolares (n = 47) da Escola-creche, anexa, também foram altas, respectivamente 35,7% e 23,4%. Em 7 (58,3 %) das 12 amostras do solo, do jardim/pátio do "Hospital", foram observadas formas de vida livre do Strongyloides stercoralis. O fator ambiental e a predisposição...

Considerations in going public on the ASE

International Nuclear Information System (INIS)

Romanzin, G.A.

1997-01-01

The possible reasons why an oil or gas company would seek public equity and financing and a listing on a stock exchange were discussed. This crucial decision for junior companies is often prompted by the need for expansion capital. In the last three years, 456 companies decided to list on the Alberta Stock Exchange (ASE) using the two most commonly used methods of going public: the Exchange Offering Prospectus (EOP) program, and the Junior Capital Pool (JCP) program. The EOP program is a simplified form of prospectus in which the distribution of securities is made through the facilities of the ASE. Companies that do not have significant operating assets, other than cash, nor agreements in place to acquire operating assets, are eligible under the JCP program which involves a two-stage process. Stage one requires the filing and clearing of a prospectus through the Alberta Securities Commission and the listing of the company's shares on the Exchange. Stage two requires completing a major transaction within 18 months of being listed on the Exchange. Details of the minimum listing requirements for either the EOP or the JCP programs were described

The association between anomalous self-experiences, self-esteem and depression in first episode schizophrenia

Directory of Open Access Journals (Sweden)

Elisabeth Haug

2016-11-01

Full Text Available Background: Anomalous self-experiences (ASEs aggregate in schizophrenia spectrum disorders, but the relationship between ASEs, and depression has been studied to a limited extent. Lower self-esteem has been shown to be associated with depression in early psychosis. Our hypothesis is that ASEs in early phases of schizophrenia are linked to lower levels of self-esteem, which in turn is associated with depression. Aim: The aim is to examine the relationship between ASEs, self-esteem and depression in first-episode schizophrenia spectrum disorders.Method: ASEs were assessed in 55 patients with first-episode schizophrenia by means of the Examination of anomalous Self-Experience (EASE instrument. Assessment of depression was based on the Calgary Depression Scale for Schizophrenia (CDSS. Self-esteem was measured using the Rosenberg Self-Esteem Scale (RSES. Symptom severity was assessed using the Structured Clinical Interview for the Positive and Negative Syndrome Scale (SCI-PANSS. Substance misuse was measured with the Drug Use Disorder Identification Test (DUDIT, and alcohol use was measured with the Alcohol Use Disorder Identification Test (AUDIT. Data on childhood adjustment were collected using the Premorbid Adjustment Scale (PAS. Data on childhood trauma were collected using the Norwegian version of the Childhood Trauma Questionnaire, short form (CTQ-SF. Results: Analyses detected a significant association between current depression and ASEs as measured by the EASE in women, but not in men. The effect of ASEs on depression appeared to be mediated by self-esteem. No other characteristics associated with depression influenced the relationship between depression, self-esteem and ASEs. Conclusion: Evaluating ASEs can assist clinicians in understanding patients’ experience of self-esteem and depressive symptoms. The complex interaction between ASEs, self-esteem, depression and suicidality could be a clinical target for the prevention of suicidality

The Association between Anomalous Self-experiences, Self-esteem and Depressive Symptoms in First Episode Schizophrenia.

Science.gov (United States)

Haug, Elisabeth; Øie, Merete G; Andreassen, Ole A; Bratlien, Unni; Romm, Kristin L; Møller, Paul; Melle, Ingrid

2016-01-01

Background: Anomalous self-experiences (ASEs) aggregate in schizophrenia spectrum disorders, but the relationship between ASEs, and depression has been studied to a limited extent. Lower self-esteem has been shown to be associated with depression in early psychosis. Our hypothesis is that ASEs in early phases of schizophrenia are linked to lower levels of self-esteem, which in turn is associated with depression. Aim: The aim is to examine the relationship between ASEs, self-esteem and depression in first-episode schizophrenia spectrum disorders. Method: ASEs were assessed in 55 patients with first-episode schizophrenia by means of the Examination of anomalous Self-Experience (EASE) instrument. Assessment of depression was based on the Calgary Depression Scale for Schizophrenia (CDSS). Self-esteem was measured using the Rosenberg Self-Esteem Scale (RSES). Symptom severity was assessed using the Structured Clinical Interview for the Positive and Negative Syndrome Scale (SCI-PANSS). Substance misuse was measured with the Drug Use Disorder Identification Test (DUDIT), and alcohol use was measured with the Alcohol Use Disorder Identification Test (AUDIT). Data on childhood adjustment were collected using the Premorbid Adjustment Scale (PAS). Data on childhood trauma were collected using the Norwegian version of the Childhood Trauma Questionnaire, short form (CTQ-SF). Results: Analyses detected a significant association between current depression and ASEs as measured by the EASE in women, but not in men. The effect of ASEs on depression appeared to be mediated by self-esteem. No other characteristics associated with depression influenced the relationship between depression, self-esteem and ASEs. Conclusion: Evaluating ASEs can assist clinicians in understanding patients' experience of self-esteem and depressive symptoms. The complex interaction between ASEs, self-esteem, depression and suicidality could be a clinical target for the prevention of suicidality in this

Accelerated solvent extraction (ASE) - a fast and automated technique with low solvent consumption for the extraction of solid samples (T12)

International Nuclear Information System (INIS)

Hoefler, F.

2002-01-01

Full text: Accelerated solvent extraction (ASE) is a modern extraction technique that significantly streamlines sample preparation. A common organic solvent as well as water is used as extraction solvent at elevated temperature and pressure to increase extraction speed and efficiency. The entire extraction process is fully automated and performed within 15 minutes with a solvent consumption of 18 ml for a 10 g sample. For many matrices and for a variety of solutes, ASE has proven to be equivalent or superior to sonication, Soxhlet, and reflux extraction techniques while requiring less time, solvent and labor. First ASE has been applied for the extraction of environmental hazards from solid matrices. Within a very short time ASE was approved by the U.S. EPA for the extraction of BNAs, PAHs, PCBs, pesticides, herbicides, TPH, and dioxins from solid samples in method 3545. Especially for the extraction of dioxins the extraction time with ASE is reduced to 20 minutes in comparison to 18 h using Soxhlet. In food analysis ASE is used for the extraction of pesticide and mycotoxin residues from fruits and vegetables, the fat determination and extraction of vitamins. Time consuming and solvent intensive methods for the extraction of additives from polymers as well as for the extraction of marker compounds from herbal supplements can be performed with higher efficiencies using ASE. For the analysis of chemical weapons the extraction process and sample clean-up including derivatization can be automated and combined with GC-MS using an online ASE-APEC-GC system. (author)

Comparison of ASE and SFE with Soxhlet, Sonication, and Methanolic Saponification Extractions for the Determination of Organic Micropollutants in Marine Particulate Matter.

Science.gov (United States)

Heemken, O P; Theobald, N; Wenclawiak, B W

1997-06-01

The methods of accelerated solvent extraction (ASE) and supercritical fluid extraction (SFE) of polycyclic aromatic hydrocarbons (PAHs), aliphatic hydrocarbons, and chlorinated hydrocarbons from marine samples were investigated. The results of extractions of a certified sediment and four samples of suspended particulate matter (SPM) were compared to classical Soxhlet (SOX), ultrasonication (USE), and methanolic saponification extraction (MSE) methods. The recovery data, including precision and systematic deviations of each method, were evaluated statistically. It was found that recoveries and precision of ASE and SFE compared well with the other methods investigated. Using SFE, the average recoveries of PAHs in three different samples ranged from 96 to 105%, for ASE the recoveries were in the range of 97-108% compared to the reference methods. Compared to the certified values of sediment HS-6, the average recoveries of SFE and ASE were 87 and 88%, most compounds being within the limits of confidence. Also, for alkanes the average recoveries by SFE and ASE were equal to the results obtained by SOX, USE, and MSE. In the case of SFE, the recoveries were in the range 93-115%, and ASE achieved recoveries of 94-107% as compared to the other methods. For ASE and SFE, the influence of water on the extraction efficiency was examined. While the natural water content of the SPM sample (56 wt %) led to insufficient recoveries in ASE and SFE, quantitative extractions were achieved in SFE after addition of anhydrous sodium sulfate to the sample. Finally, ASE was applied to SPM-loaded filter candles whereby a mixture of n-hexane/acetone as extraction solvent allowed the simultaneous determination of PAHs, alkanes, and chlorinated hydrocarbons.

1998 NASA-ASEE-Stanford Summer Faculty Fellowship Program

Science.gov (United States)

1998-01-01

This report presents the essential features and highlights of the 1998 Summer Faculty Fellowship Program at Ames Research Center and Dryden Flight Research Center in a comprehensive and concise form. Summary reports describing the fellows' technical accomplishments are enclosed in the attached technical report. The proposal for the 1999 NASA-ASEE-Stanford Summer Faculty Fellowship Program is being submitted under separate cover. Of the 31 participating fellows, 27 were at Ames and 4 were at Dryden. The Program's central feature is the active participation by each fellow in one of the key technical activities currently under way at either the NASA Ames Research Center or the NASA Dryden Flight Research Center. The research topic is carefully chosen in advance to satisfy the criteria of: (1) importance to NASA, (2) high technical level, and (3) a good match to the interests, ability, and experience of the fellow, with the implied possibility of NASA-supported follow-on work at the fellow's home institution. Other features of the Summer Faculty Fellowship Program include participation by the fellows in workshops and seminars at Stanford, the Ames Research Center, and other off-site locations. These enrichment programs take place either directly or remotely, via the Stanford Center for Professional Development, and also involve specific interactions between fellows and Stanford faculty on technical and other academic subjects. A few, brief remarks are in order to summarize the fellows' opinions of the summer program. It is noteworthy that 90% of the fellows gave the NASA-Ames/Dryden- Stanford program an "excellent" rating and the remaining 10%, "good." Also, 100% would recommend the program to their colleagues as an effective means of furthering their professional development as teachers and researchers. Last, but not least, 87% of the fellows stated that a continuing research relationship with their NASA colleagues' organization probably would be maintained. Therefore

Ase1p Organizes Antiparallel Microtubule Arrays during Interphase and Mitosis in Fission YeastV⃞

OpenAIRE

Loïodice, Isabelle; Staub, Jayme; Setty, Thanuja Gangi; Nguyen, Nam-Phuong T.; Paoletti, Anne; Tran, P. T.

2005-01-01

Proper microtubule organization is essential for cellular processes such as organelle positioning during interphase and spindle formation during mitosis. The fission yeast Schizosaccharomyces pombe presents a good model for understanding microtubule organization. We identify fission yeast ase1p, a member of the conserved ASE1/PRC1/MAP65 family of microtubule bundling proteins, which functions in organizing the spindle midzone during mitosis. Using fluorescence live cell imaging, we show that ...

The feeding ecology of schilbeid catfishes in river Ase, Niger delta ...

African Journals Online (AJOL)

The feeding ecology of schilbeid catfishes in river Ase, Niger delta, Southern Nigeria. ... Open Access DOWNLOAD FULL TEXT ... in feeding intensity were described for Eutropius niloticus and Schilbe mystus which had adequate data.

Candidíase em pacientes aidéticos

Directory of Open Access Journals (Sweden)

C.E.O.P. Campos

1992-09-01

Full Text Available Trinta e cinco aidéticos entre 19 e 55 anos admitidos e tratados de candidíase no Hospital Emílio Ribas, SP, com ELISA positivo para HIV e confirmado pelo Western Blot. Tuberculose em 9 sendo 2 com pericardite; neurotoxoplasmose em 6; neurocriptococose em 5; herpes labial em 4; pneumocistose em 3 e sarcoma de Kaposi em 2, achavam-se associadas. A concentração inibitória mínima 50% (MIC 50% para os azoles foi: ketoconazol= 2,2 µg/ml; itraconazol- 21,0 µg/ml; fluconazol = 19,0 µg/ml. O MIC 50% para ospolienos: nistatina- 50,0 µg/ml; anfotericina B= 0,12 µg/ml e para 5 fluorcitosina= 1,6 µg/ml nas 35 amostras de Candida isoladas. Testes não paramétricos de Siegel revelaram significante identificação (80% das Candida albicans na candidíase, e que a dose de AMB não modificou o número de óbitos, precoce e tardio, ocorridos nesses aidéticos. O uso prévio dos azoles e da nistatina explicaria, talvez, o elevado MIC 50% observado nas amostras de Candida isoladas.

Epidemiologia da hanseníase em coorte de contatos intradomiciliares no Rio de Janeiro (1987-1991

Directory of Open Access Journals (Sweden)

Matos Haroldo José de

1999-01-01

Full Text Available Este trabalho foi desenvolvido para estudar os fatores que influem no adoecimento dos contatos intradomiciliares de hanseníase. Foi estabelecida uma coorte de contatos intradomiciliares de hanseníase no setor de Hanseníase da Fiocruz, no Rio de Janeiro. Entre 1987 e 1991, em que foram acompanhados 670 contatos saudáveis, a taxa de incidência por pessoa-ano de follow-up foi de 0,01694. Porém, houve variação com o tempo de acompanhamento de cada indivíduo, sendo de 0,06385 ao final do primeiro ano, de 0,03299 ao final do segundo, 0,02370 ao final do terceiro, 0,018622 ao final do quarto e 0,01694 ao final do período. Foi especificado um modelo de regressão logística para os indivíduos acompanhados nos primeiros cinco anos, envolvendo 758 contatos, incluindo nessa situação os casos co-prevalentes. O risco de incidência de hanseníase está relacionado com a negatividade do teste de Mitsuda, com OR de 3,093 (IC95% = 1,735-5,514, com a vacinação pelo BCG, OR de 0,3802 (IC95% = 0,2151-0,66719, e com a forma multibacilar do caso-índice, OR de 2,547 (IC95% = 1,249-5,192. Os resultados indicam que a incidência da hanseníase em contatos está associada à forma multibacilar da doença e aos fatores imunes dos contatos.

A new ASE filter: the 20-fold prism monochromator

NARCIS (Netherlands)

Bakker, L.P.; Freriks, J.M.; Kroesen, G.M.W.

1999-01-01

A new ASE filter is presented, consisting of 20 dispersion prisms and two spatial filters. The transmission of the filter is measured with a ring-dye laser. The 1 width of the filter is 0.23 nm. The transmission is approximately 80% for the transmitted wavelengths. The rejection is in the order of .

Free electron laser amplifier experiments on SG-1

International Nuclear Information System (INIS)

Hui Zhongxi; Zhou Chuanming; Wu Ruian

1994-01-01

The SG-1 FEL facility is composed of a linear induction accelerator (LIA), an electron beam transport system, a wiggler, a microwave source and a diagnostic system. SG-1 LIA provides a 2 kA, 3.0 MeV beam with a normalized emittance of 0.4∼0.6 (π rad·cm), an energy spread (FWHM) of 4%, resulting in a beam brightness of nearly 10 8 A/πm·rad) 2[1] . The beam current through the wiggler is about 600 A. The first ASE experiments began in September 1991. A 2.6-m long wiggler with a peak magnetic field of 0.3 T was used. At 35.8∼36.5 GHz an ASE output of 0.5 W was obtained for a beam current of nearly 50 A. After a shutdown of about 8 months, the second series of ASE experiments began in October 1992. The second series of ASE experiments were performed with a wiggler magnetic field between 0.25∼0.27 T. The maximum output power is about 100 kw for B w = 0.24 T, I = 600 A, At ν = 35.2 GHz. Based on the ASE experiments the amplifier experiments was carried out on SG-1. Using an 300 W input signal (TE 01 ), a beam current of about 600 A and wiggler magnetic fields of 0.24∼0.28 T, the authors measured the FEL output power as a function of the wiggler magnetic field. The resonant magnetic field was about 0.25 T. Meanwhile, in order to study the amplifier gain, the authors measured the FEL output power as a function of the wiggler length at a peak wiggler magnetic field of 0.26 T. The exponential gain is approximately 19 dB/m and the maximum output power is about 10 MW

Significant effect of NSP-ase enzyme supplementation in sunflower meal-based diet on the growth and nutrient digestibility in broilers.

Science.gov (United States)

Bilal, M; Mirza, M A; Kaleem, M; Saeed, M; Reyad-Ul-Ferdous, Md; Abd El-Hack, M E

2017-04-01

The response of broiler chickens to 3 levels of sunflower meal and 2 levels of NSP-ase enzyme combination (with and without) was investigated in 3 × 2 factorial arrangement under complete randomized design (CRD). A total of 240 Hubbard broiler chicks were fed on practical mash diets having 2950 kcal of ME and 21% CP from 1 to 42 days of age. The BW gain was not significantly reduced when 25% SFM was added in the diets during 1 to 42 days of age. Supplementation of NSP-ase in broiler diets (day 1-42 overall) demonstrated non-significant differences (p Replacement of SBM with SFM or inclusion of SFM at higher level (25%) increased/deteriorated FCR. The addition of exogenous NSP-ase showed a significant improvement (p < 0.01) in feed:gain. The improvement was clearly demonstrated when SFM was added to the experimental diet at 15% or even 20%. Supplementation of NSP-ase at the 25% inclusion level could not, however, sustain the beneficial effect, which was possibly due to excessively high dietary CF. No difference was noted across the treatments regarding carcass response. Relative gizzard weight and intestinal weight were observed to be improved in birds consuming higher levels of SFM (p = 0.00). The digestibility of CF was observed to improve when SFM was used at 20% and 25% in the diets. No improvement in the digestibility of CF was observed with NSP-ase supplementation, which meant other factors were clearly involved. Supplementation of NSP-ase improved FCR up to 20% SFM. At 25% SFM, no improvement in the digestibility of CF was observed with NSP-ase supplementation. Journal of Animal Physiology and Animal Nutrition © 2016 Blackwell Verlag GmbH.

Atuação do enfermeiro no controle epidemiológico da hanseníase

Directory of Open Access Journals (Sweden)

Sara Augusta dos Santos

1992-09-01

Full Text Available Analisou-se seníase, na Seção de Dermatologia Sanitária do Hospital Universitário Pedro Ernesto, UERJ. Pretendeu-se alcançar três objetivos entre eles comparar a qualidade do controle epidemiológico dos casos novos de hanseníase em registro ativo de 1986, com os mesmos casos relativos ao período de 1987. Aplicou-se o método descritivo e análise de documentos dos prontuários desses clientes. Utilizou-se um formulário com questões de múltipla escolha e preenchimento de claros, totalizando 27 itens. Constatou-se que o enfermeiro interfere nas variáveis: exames para firmar diagnóstico, exames de contatos e educação para saúde, contribuindo para a melhoria da qualidade assistencial do hanseniano. Conclui-se que há diferença significativa na qualidade do controle epidemiológico da hanseníase entre os grupos constituídos.

Implicações clínicas e imunológicas da associação entre o HTLV-1 e a estrongiloidíase

OpenAIRE

Porto, Maria Aurélia da Fonseca; Muniz, André Luís Nunes; Oliveira Júnior, Jamary; Carvalho Filho, Edgar Marcelino de

2002-01-01

P. 641-649,Nov-Dez. A estrongiloidíase é uma das mais importantes helmintíases em países tropicais e estudos epidemiológicos têm demonstrado associação desta parasitose com o vírus HTLV-1. Em regiões onde estes dois agentes são endêmicos a coinfecção pode resultar no desenvolvimento de formas disseminadas da estrongiloidíase assim como em estrongiloidíase recorrente. Enquanto que o vírus HTLV-1 está relacionado com uma alta produção de IFN-g e desvio da resposta imune para o tipo Th1, a pr...

Implicações clínicas e imunológicas da associação entre o HTLV-1 e a estrongiloidíase

OpenAIRE

Porto,Maria Aurélia F.; Muniz,André; Oliveira Júnior,Jamary; Carvalho,Edgar Marcelino

2002-01-01

A estrongiloidíase é uma das mais importantes helmintíases em países tropicais e estudos epidemiológicos têm demonstrado associação desta parasitose com o vírus HTLV-1. Em regiões onde estes dois agentes são endêmicos a coinfecção pode resultar no desenvolvimento de formas disseminadas da estrongiloidíase assim como em estrongiloidíase recorrente. Enquanto que o vírus HTLV-1 está relacionado com uma alta produção de IFN-γ e desvio da resposta imune para o tipo Th1, a proteção contra helm...

Fístula vesicovaginal por litíase: relato de caso

Directory of Open Access Journals (Sweden)

Chambô Filho Antônio

2003-01-01

Full Text Available As fístulas de etiologia traumática são raras, sobretudo as intrínsecas por litíase vesical. O manejo dessas fístulas tem controvérsias no que diz respeito à técnica cirúrgica ideal. Uma variedade de tratamentos tem sido descrita, incluindo reparação cirúrgica por vias transvaginal e transabdominal. Os autores relatam o caso de uma paciente com queixa de perda urinária contínua com evolução de seis meses, sendo identificado ao exame especular orifício fistuloso no terço médio da parede anterior da vagina, por onde se exteriorizava urina. Nesta topografia, identificava-se, durante o toque bimanual, estrutura de consistência pétrea. A suspeita de litíase vesical foi confirmada pela radiografia de pelve. O tratamento cirúrgico se deu em dois tempos, com exérese do cálculo vesical e posterior correção da fístula por via vaginal.

Associação timoma e estrongiloidíase intestinal grave

OpenAIRE

Godoy,Pérsio; Campos,Christian Marcellus Camargos; Costa,Guilherme; Castro,Lúcia Porto Fonseca de

1998-01-01

Os autores relatam o caso de um homem de 59 anos de idade com timoma e estrongiloidíase intestinal grave. São revistos aspectos da resposta imunitária relacionados ao tumor e, possivelmente, implicados no desenvolvimento da hiperinfecção pelo Strongyloides stercoralis.

Q-factor improvement of degenerate four-wave-mixing regenerators for ASE degraded signals

Science.gov (United States)

Lu, Hang; Wu, Bao-jian; Geng, Yong; Zhou, Xing-yu; Sun, Fan

2017-11-01

All-optical regenerators can be used to suppress amplified spontaneous emission (ASE) noise introduced by cascaded erbium doped fiber amplifiers (EDFAs) in optical fiber communication systems and lead to the improvement of optical receiver sensitivity. By introducing the Q-factor transfer function (QTF), we evaluate the Q-factor performance of degenerate four-wave mixing (DFWM) regenerators with clock pump and reveal the differences between the optimal input powers determined from the static and dynamic power tranfer function (PTF) and the QTF curves. Our simulation shows that the clock-pump regnerator is capable of improving the Q-facor and receiver sensitivity for 40 Gbit/s ASE-degraded return-to-zero on-off keying (RZ-OOK) signal by 2.58 dB and 4.2 dB, respectively.

Urolitíase: estudo comparativo em bovinos Guzerá oriundos de propriedades com e sem o problema

Directory of Open Access Journals (Sweden)

S.R. Sacco

2011-03-01

Full Text Available Diversos fatores podem contribuir para a formação de cálculos urinários, dentre estes, o desequilíbrio nutricional e a dureza da água consumida pelos ruminantes. O objetivo deste estudo foi identificar as características de propriedades que predispõem à urolitíase, através da avaliação da água, da dieta e determinações séricas e urinárias de cálcio, fósforo, magnésio, cloretos, sódio, potássio, cálculo da excreção fracionada (EF dos eletrólitos, e da creatinina, proteína total, albumina e globulinas séricas. Foram colhidas amostras de sangue e urina de bovinos, Guzerá, criados semi intensivamente, distribuídos por dois grupos. O primeiro denominado grupo urolitíase (Gu, composto de animais com histórico, sinais clínicos e confirmação ultrassonográfica que apresentavam urolitíase; o segundo: grupo controle (Gc, sem histórico, nem sintomas da doença. Os bovinos do grupo urolitíase consumiam água com dureza total na concentração de 166,0mg CaCO3/L. A dieta dos animais do Gu apresentava maior concentração de fósforo e relação Ca:P inadequada. Os teores de fósforo sérico e urinário dos animais do Gu foram maiores do que os do Gc, assim como a concentração sérica de magnésio (p0,05, mas houve diminuição significativa nas EFs de magnésio, cloretos e de potássio do grupo urolitíase (p<0,05. A união destes fatores contribuiu para a ocorrência da urolitíase, sendo dureza total da água e a alta concentração de fósforo na dieta os principais fatores na gênese dos cálculos em bovinos.

Candidíase oral como marcador de prognóstico em pacientes portadores do HIV

OpenAIRE

Cavassani Valdinês Gonçalves dos Santos; Andrade Sobrinho Jozias de; Homem Maria da Graça Naclério; Rapoport Abrão

2002-01-01

Introdução: A candidíase oral é uma das doenças oportunistas mais fortemente associadas à infecção pelo Vírus da Imunodeficiência Humana (HIV). Vários relatos epidemiológicos enfatizam a prevalência da candidíase em pacientes HIV positivos e ressaltam a sua importância como marcador da progressão da doença e preditivo para o aumento da imunodepressão. Objetivo: Verificar as alterações estomatológicas em pacientes portadores do HIV tratados no Hospital Heliópolis - São Paulo, Brasil e comparar...

Eletrólise com radiofrequência no tratamento da triquíase Treatment of trichiasis with high-frequency radio wave electrosurgery

Directory of Open Access Journals (Sweden)

Rodrigo Beraldi Kormann

2007-03-01

Full Text Available OBJETIVOS: Triquíase é uma condição adquirida dos cílios, que perdem o direcionamento normal e tocam a superfície ocular. O tratamento da triquíase tem sido um problema terapêutico. Apesar das várias modalidades de tratamento: epilação mecânica, eletrólise com bipolar, crioterapia, fotocoagulação com laser de argônio e procedimentos cirúrgicos, a recidiva da triquíase é comum. Com o objetivo de encontrar técnica próxima ao ideal, realizamos estudo utilizando eletrólise com aparelho de radiofreqüência, avaliando-se a efetividade da técnica. MÉTODOS: Foram estudados, prospectivamente, 34 pacientes (54 segmentos palpebrais com triquíase, submetidos à eletrólise com aparelho de radiofreqüência. Reavaliaram-se os pacientes em oito semanas, quanto à cura, recidiva e possíveis complicações. RESULTADOS: Observou-se a cura da triquíase com apenas uma única sessão de eletrólise com radiofreqüência em 22 pacientes e com duas ou mais sessões em 12 pacientes. CONCLUSÃO: A eletrólise com aparelho de radiofreqüência é método simples, de baixo custo, que não demanda experiência do cirurgião, com ausência de complicações relevantes e com alto índice de sucesso.PURPOSE: Trichiasis is an acquired condition in which the eyelashes are directed posteriorly, touching the surface of the cornea. It poses a complex therapeutic problem. Despite several therapeutic options (epilation, electroepilation, cryotherapy, laser ablation and standard surgical techniques, relapse is frequent. METHODS: A prospective, nonmasked study was conducted to determine the efficacy of high-frequency radioelectrosurgery for treatment of trichiasis. Thirty-four patients (fifty-four eyelid segments were treated with this technique. After eight weeks, all patients were reviewed regarding the success rate, relapse and complications. RESULTS: Cure was achieved after only one session of treatment in twenty-two patients, and two or more sessions

NASA/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1985. [Space Stations and Their Environments

Science.gov (United States)

Chilton, R. G. (Editor); Williams, C. E. (Editor)

1986-01-01

The 1985 NASA/ASEE Summer Faculty Fellowship Research Program was conducted by Texas A&M University and the Johnson Space Center. The ten week program was operated under the auspices of the American Society for Engineering Education (ASEE). The faculty fellows spent the time at JSC engaged in research projects commensurate with their interests and background and worked in collaboration with NASA/JSC colleagues. This document is a compilation of the final reports of their research during the summer of 1985.

ATP-ase activity in the human oral mucous membrane, the guinea pig and the rabbit epidermis. A light- and electronmicroscopical investigation

DEFF Research Database (Denmark)

Zelander, T; Kirkeby, S

1984-01-01

The activity for ATP-ase was investigated in cells of rabbit and guinea pig epidermis and human oral mucosa. Observations both in the light- and electron microscope indicate that the ATP-ase positive cells of guinea pig and human epithelia are Langerhans cells while in the rabbit epidermis...

Change in ATP-ase activity and transport of rna of liver cell nuclei of pregnant rats and embryos following irradiation

International Nuclear Information System (INIS)

Shamsutdinova, G.T.; Mirkhamidova, P.; Ibragimkhodzhaeva, M.P.; Mirakhmedov, A.K.

1990-01-01

The effect of radiation on ATP-ase activity in rat liver nuclei and RNA transport of isolated liver nuclei in vitro is studied. It is shown that irradiation changes RNA transport from isolated liver cell nuclei of maternal organism and embryos. Irradiation during prefetus and fetus periods changes ATP-ase activity of embryon and maternal organism nuclei

Optical band gap study of a-Se and Se-Sb thin films

International Nuclear Information System (INIS)

Kaur, Ramandeep; Singh, Palwinder; Thakur, Anup

2016-01-01

Amorphous selenium (a-Se) and a-Se_9_5Sb_5 alloy were prepared using melt quenching technique. X-ray diffraction (XRD) pattern confirmed the amorphous nature of the prepared samples. Composition of the prepared samples has been determined using Energy dispersive X-ray fluorescence (EDXRF) technique. Differential thermal analysis (DTA) confirmed the glassy nature of the prepared samples. Thin films of the prepared samples were deposited on glass substrate using thermal evaporation method. Amorphous nature of the deposited films was confirmed using XRD. Optical properties of these films were obtained from the UV-VIS transmission spectra, at normal incidence, over 200-1100 nm spectral range. The optical absorption edge was described by using the model given by the Tauc. Optical band gap of the deposited films was calculated using Tauc plot. Optical characterization showed that average transmission and optical band gap decreased with the addition of antinomy.

Peran Sistem Informasi Dalam Meningkatkan Investasi Asing Pada Sektor Properti Di Indonesia di Era Pasar Bebas

Directory of Open Access Journals (Sweden)

Yosi Agustiawan

2016-02-01

Full Text Available Abstrak Pasar bebas adalah hasil dari proses globalisasi yang telah menciptakan integrasi ekonomi antar negara. Artikel ini mengkaji dampak globalisasi di pasar properti global dan peran sistem informasi untuk meningkatkan investasi asing di Indonesia. Meningkatnya investasi asing langsung (Foreign Direct Investmen/FDI yang mengalir ke negara berkembang termasuk Indonesia di berbagai sektor termasuk properti telah memberikan banyak manfaat untuk meningkatkan ekonomi. Buruknya peraturan kepemilikan tanah dan infrastruktur adalah masalah utama yang harus diatasi untuk menjaga agar investor asing masih berniat untuk menanamkan modalnya dalam pasar properti global. Sistem informasi dapat digunakan sebagai alat yang efektif untuk mengatasi masalah-masalah tersebut melalui penggunaan e-government dan perencanaan strategis implementasi sistem informasi dalam proyek infrastruktur. Kata kunci: globalisasi, investasi asing, pasar properti global, e-government, sistem informasi. Abstract Cross-border relationships do not only affect many aspects but it also creates economic integration among countries. This essay examines the impact of globalization on the property market and the role of information system to promote foreign direct investment (FDI in Indonesia. Allowing foreign direct investment (FDI flows to those developing in various industries including property has clearly provided positive opportunities to improve their economic. Poor land regulations and infrastructure are the main issues that must be overcome to maintain foreign investor still intend to capitalize on the global property market. Information system can be used as effective tool to resolve those issues through e-government and trategic implementation in projects infrastructure. Key word: globalization, foreign direct investment, global property market, e-government, system information

Terapia fotodinâmica para tratamento de candidíase vulvovaginal em modelo experimental com camundongas

OpenAIRE

Santi, Maria Eugenia Simões Onofre de

2014-01-01

Candidíase vulvovaginal é a segunda mais comum infecção ginecológica e afeta 75% das mulheres pelo menos uma vez durante seu período reprodutivo. A candidíase vulvovaginal recorrente representa um desafio à prática ginecológica, uma vez que muitas pacientes experimentam recorrências imediatamente após finalizarem um tratamento. A terapia fotodinâmica (PDT) é considerada uma abordagem terapêutica no tratamento de infecções fúngicas. O objetivo deste estudo foi investigar a eficácia da PDT em v...

Tendências da hanseníase no Tocantins, um estado hiperendêmico do Norte do Brasil, 2001-2012

Directory of Open Access Journals (Sweden)

Lorena Dias Monteiro

2015-05-01

Full Text Available A hanseníase é hiperendêmica no Estado do Tocantins, Brasil. O objetivo do estudo foi analisar as tendências dos indicadores da hanseníase no Tocantins em 2001-2012. Análise de dados advindos do Sistema de Informação de Agravos de Notificação (SINAN. Incluíram-se casos novos de residentes no Tocantins. Calcularam-se os indicadores da hanseníase e analisaram-se as tendências temporais por meio de regressão polinomial. Houve tendência significativa e decrescente para a detecção geral (R2 = 0,40; p 0,05, detecção de casos com grau 2 de incapacidade física (R2 = 0,37; p > 0,05 e proporção de casos com grau 2 (R2 = 0,49; p > 0,05. Houve aumento significativo para a proporção de casos com grau 1 de incapacidade (R2 = 0,82; p < 0,05 e proporção de casos multibacilares (R2 = 0,81; p < 0,05. O Tocantins apresenta regiões com alta transmissão e diagnóstico tardio da hanseníase, apontando a expansão da doença de forma heterogênea na análise temporal.

Perjanjian Berbahasa Asing yang Dibuat Oleh Notaris Berdasarkan Undang-Undang Nomor 30 Tahun 2004 Tentang Jabatan Notaris

Directory of Open Access Journals (Sweden)

Aliya Sandra Dewi

2016-04-01

Full Text Available Perjanjian Berbahasa Asing yang Dibuat Notaris Berdasarkan Undang-Undang Nomor 30 Tahun 2004. Posisi notaris sebagai fungsionaris dalam masyarakat dianggap sebagai tempat resmi yang dapat memperoleh saran. Segala sesuatu yang ditulis dan ditetapkan sudah benar dan pejabat produsen resmi dalam dokumen kekuatan hukum, khususnya dokumen yang berkaitan dengan kontrak yang terjadi di masyarakat. Dengan perkembangan hubungan antara subjek hukum warga negara yang berbeda untuk membuat perjanjian dalam bahasa asing selalu digunakan antara pihak-pihak yang memilikin perbedaan karena perbedaan bahasa kewarganegaraan.DOI:10.15408/jch.v1i1.2922

X-ray effects on the activity of a Mg2+-dependent, Na+- and K+-activable microsomal membrane ATP-ase system

International Nuclear Information System (INIS)

Froehlich, D.

1978-01-01

The bahviour of a Mg 2+ -dependent, Na + - and K + -activable ATP-ase sytem on irradiation was investigated using a microsome fraction of guinea pig myocardial cells prepared by fractionated centrifugation. The Na + - and K + -activable component, transport-ATPase, was particularly radiation-sensitive. Three stages of development were observed for a 1,500 R radiation damage until 24 h p.r.. In the first stage, until 30 minutes p.r., the activity of transport-ATP-ase was inhibited. This was followed by repair processes which had reached a peak value clearly higher than the control values at 4 hours p.r.. In the third stage, the activity was reduced again; 15 and 24 hours after termination of exposure, values again were nearly the same as after 30 minutes where a maximum was observed for this radiation dose. Radiation-induced electrolyte displacements, active transport, and radiation-induced inhibition of transport-ATP-ase were correlated and discussed; the assumption was that changes in, the electrolyte conditions in the membranes on irradiation are at least partly due to the described inhibition of transport-ATP-ase. (orig./AJ) [de

The сalix[4]arene C-107 is highly effective supramolecular inhibitor of the Na(+,K(+-АТРase of plasmatic membrane

Directory of Open Access Journals (Sweden)

O. V. Bevza

2013-04-01

Full Text Available The inhibition of the Na+,K+-АТРase activity of the myometrium cell plasma membranes with calixarene С-107 (5,17-diamino(2-pyridylmethylphosphono-11,23-di-tret-butyl-26,28-dihydroxy-25,27-dipropoxycalix[4]arene was investigated. It has been shown that calixarene С-107 reduced the Na+,K+-АТРase activity more efficiently than ouabain did, while it did not practically influence the “basal” Mg2+-АТРase activity of the same membrane. The magnitude of the cofficient of inhibition I0.5 was 33 ± 4 nМ, Hill coefficient was 0.38 ± 0.06. The model calixa­rene C-150 – the calixarene “scaffold” (26,28-dihydroxy-25,27-dipropoxycalix[4]arene, and the model compound М-3 (4-hydroxyaniline(2-pyridinemethylphosphonic acid – a fragment of the calixarene С-107, had practically no influence on the enzymatic activity of Na+,K+-АТРase and Mg2+-АТРаse. We carried out the computer simulation of interaction of calixarenes C-107 and the mentioned model compound with ligand binding sites of the Na+,K+-АТРase of plasma membrane and structure foundation of their intermolecular interaction was found out. The participation of hydrogen, hydrophobic, electrostatic and π-π (stacking interaction between calixarene and enzyme aminoacid residues, some of which are located near the active center of Na+,K+-АТРase, was discussed.

Novos aspectos na evolução clínica da pitiríase versicolor New aspects in the clinical course of pityriasis versicolor

Directory of Open Access Journals (Sweden)

Valéria Maria de Souza Framil

2011-12-01

Full Text Available FUNDAMENTO: A pitiríase versicolor é uma doença infecciosa causada por várias espécies de Malassezia com uma tendência a se tornar recidivante ou crônica. OBJETIVOS: Este trabalho foi conduzido na tentativa de conhecer a evolução clínica da pitiríase versicolor em relação ao número de recidivas após um tratamento adequado no período de 12 meses e correlacionar o número de recidivas com as espécies de Malassezia isoladas. MATERIAL E MÉTODOS: Cento e dois pacientes com diagnóstico clínico e laboratorial de pitiríase versicolor foram acompanhados por um período de 12 meses para observarmos o número de recidivas da doença. RESULTADOS: A pitiríase versicolor, após um tratamento adequado, apresentou três tipos de evolução clínica num período de 12 meses: pitiríase versicolor sem nenhum episódio de recidiva (32,35%; pitiríase versicolor recidivante, com um a quatro episódios de recidiva (52,94% devidos a fatores de predisposição relacionados; e pitiríase versicolor crônica, com mais de quatro episódios de recidiva (14,70% sem nenhuma relação com fatores de predisposição. CONCLUSÕES: A pitiríase versicolor apresentou uma evolução clínica de acordo com o número de episódios de recidiva da doença analisados durante um período de 12 meses que pode ser considerada da seguinte maneira: pitiríase versicolor com cura clínica e micológica, pitiríase versicolor recidivante e pitiríase versicolor crônica.BACKGROUND: Pytiriasis versicolor is an infectious disease caused by several Malassezia species which has a tendency to become relapsing or chronic. OBJECTIVES: This study was conducted in an attempt to investigate the clinical course of pityriasis versicolor with regard to the number of relapses after a 12-month therapy and correlate this number with isolates of Malassezia species. MATERIAL AND METHODS: 102 patients with clinical and laboratory diagnosis of pityriasis versicolor were monitored for 12

Platelet activating factor-acylhydrolase (PAF-ase) activity is higher in serum of men than women and is related to levels of low density lipoprotein (LDL)

International Nuclear Information System (INIS)

Farr, R.S.; Howell, S.E.; Wardlow, M.L.

1986-01-01

PAF-ase is a specific serum enzyme that inactivates PAF by hydrolyzing acetate from the sn-2 position of the glycerol backbone. A reproducible PAF-ase activity assay was developed. A unit is based on the amount of serum required to release 3.61 +/- 0.042 pm 3 H-acetate from 10 pm 3 H-labeled PAF after incubation for 1 hr at 37 0 C. Assays on two single reference serums repeated 7 days were 0.63 +/- 0.013 U and 1.33 +/- 0.031 U. Serum from 20 normal men and 20 normal premenopausal women had significantly different (p = <0.001) levels of 1.32 +/- 0.072 U and 0.97 +/- 0.051 U respectively. They previously reported that PAF-ase is associated with B-lipoprotein. Therefore, total cholesterol (TC), LDL and high density lipoproteins (HDL) were determined on these 40 serums. Regression analysis revealed PAF-ase units were correlated with LDL (r = 0.740; p = < 0.001) and, parenthetically, with the TC (r = 0.620; p = < 0.001) but not with HDL. These correlations were similar for men and women. Thus, serum PAF-ase was partially controlled by serum LDL levels and the higher PAF-ase levels in serum from men were due in part to higher (p = < 0.01) LDL levels in men (147.6 +/- 6.9 mg/dl) as contrasted to women (119.0 +/- 7.6 mg/dl). PAF is a potent inflammatory, bronchoconstrictive and hypotensive agent. These data indicate that sex and serum LDL levels of subjects must be considered during future studies of the role of PAF vs PAF-ase in different disease states

The effects of low-intensity electromagnetic irradiation at the frequencies of 51.8 and 53 GHz and antibiotic ceftazidime on Lactobacillus acidophilus F0F1 ATP-ase activity

International Nuclear Information System (INIS)

Soghomonyan, D.R.

2013-01-01

The effects of low intensity electromagnetic irradiation (EMI) at the frequencies 51.8 and 53 GHz and antibiotic ceftazidime on N,N'-dicyclohexylcarbodiimide (DCCD), inhibited ATP-ase activity of Lactobacillus acidophilus membrane vesicles were investigated. It was shown that both frequencies decreased the ATP-ase activity, moreover, ceftazidime increase the sensitivity of cells to DCCD, inhibitor of the F 0 F 1 -ATP-ase. EMI combined with ceftazidime and DCCD markedly decreased the ATPase activity. The F 0 F 1 -ATP-ase is suggested can be a target for the effects observed

Aspectos epidemiológicos dateníase-cisticercose na área endêmica de Lagamar, MG

OpenAIRE

Silva-Vergara, Mario León; Prata, Aluízio; Vieira, Cláudio de Oliveira; Castro, João Henrique; Micheletti, Luciane Giroto; Otaño, Arturo Santana; Franquini Júnior, João

1995-01-01

Um inquérito epidemiológico sobre teníase-cisticercose foi realizado em Lagamar- MG em 1992. Cadastradas 1109 casas com 3344 habitantes. O inquérito abrangeu 875 (86%) famílias e foi respondido por um informante que, em 80% dos casos, foi o pai. Na cidade havia 100 chiqueiros em 100 (11,4%) casas que albergavam 406 suínos, em condições extremamente precárias. Em 300 (34,2%) casas havia o antecedente de teníase em algum membro da família. O antecedente de convulsão foi relatado por 125 (14,2%)...

Pulse distortion, energy extraction, and ASE in an HF amplifier with angular multiplexing

International Nuclear Information System (INIS)

McGuire, E.J.

1976-09-01

It has been proposed that 1 ns pulses can be efficiently extracted from the e-beam initiated HF laser by angular multiplexing, i.e., filling the amplifier with the 1 ns pulses, 1 ns apart in time, each pulse at a slightly different angle; each pulse has an input intensity of 1 W/cm 2 per line and almost fills the amplifier. We have treated this in a one dimensional model, neglecting transverse amplified spontaneous emission. We conclude that the scheme is efficient, and that most of the pulses are amplified but not distorted. The first few pulses are distorted by transient effects and the last pulse has an enhanced tail. The ratio of peak pulse intensity to forward ASE at the output is 10 4 . We then include transverse ASE and find a drastically different situation. ASE saturates the inversion after a short time depending on pulse intensity (4 ns at I/sub o/ = 1 W/cm 2 , 7 ns at I/sub o/ = 100 W/cm 2 ). The saturation time is only weakly dependent on the transverse reflection coefficient. Calculations were done on an amplifier system designed for 10 KJ output. At an incident peak pulse intensity of 10 4 W/cm 2 -line (.77 MW/cm 2 for 77 lines) 2.5 KJ was obtained in amplified pulse energy, i.e., only 6 pulses of the 24 pulse train were fully amplified. The calculations indicate that double passing the pulse train through the amplifier would enhance the energy extracted

Effect of hydrogen peroxide on the main kinetic parameters of ATP hydrolysis by ouabain sensitive Na+, K+-ATP-ase in spermatozoa of infertile men

Directory of Open Access Journals (Sweden)

Р. В. Фафула

2017-12-01

Full Text Available Background: It is known that Na+,K+-ATP-ase plays important role in physiology of spermatozoa including their motility. Na+,K+-ATP-ase is one of the targets for reactive oxygen species. Hyperproduction of reactive oxygen species can damage sperm cells and it is considered to be as one of the mechanisms of male infertility. Objectives: To evaluate the H2O2 effect on the main kinetic parameters of ATP hydrolysis by ouabain-sensitive Na+,K+-ATPase of spermatozoa of fertile (normozoospermia and infertility men (asthenozoospermia. Materials and methods: Na+, K+-ATP-ase activity was determined spectrophotometrically by production of Pi. Concentration dependencies ware linearized in Lineweaver-Burk plot. Results: Effective inhibitory effect of H2O2 on ouabain-sensitive Na+,K+-ATP-ase activity of sperm cells of fertile and infertile men was demonstrated. The effects of H2O2 on the main kinetic parameters of the ATP hydrolysis with the involvement of Na+, K+-ATP-ase was studied. In the whole range of studied concentrations of ATP the Na+, K+-ATP-ase activity of spermatozoa of fertile and infertile men was reduced in the presence of H2O2 in the incubation medium. However, the optimal activity of the Na+, K+-ATP-ase activity of sperm cells in both normozoospermic and asthenozoospermic men was observed in the presence of 5 mM ATP in the incubation medium. By linearization of concentration curves in Lineweaver-Burk plot the main kinetic parameters of Na+, K+-activated, Mg2+-dependent ATP hydrolysis in the sperm cells of fertile and infertile men were determined. Under the effect of H2O2, the affinity constant of enzyme to ATP in normozoospermic and asthenozoospermic men increases several times. The initial maximum rate of ATP hydrolysis was significantly reduced only in the spermatozoa of fertile men with normozoospermia. Conclusions: Under conditions of H2O2-induced oxidative stress the inhibition of ouabain-sensitive Na+,K+-ATP-ase activity in sperm cells

Caso fatal de balantidíase intestinal

Directory of Open Access Journals (Sweden)

Maria da Conceição Pinheiro

1991-09-01

Full Text Available Caso fatal de balantidíase em mulher desnutrida de 63 anos, criadora de porcos, da zona rural de Uberaba. A doença evoluiu em oito dias com disenteria, náusea e vômitos, culminando em óbito por enterorragia. A necropsia constatou-se colite ulcerada causada por B. coli, facilmente identificado ao exame histológico do intestino grosso.A fatal case of a 63-year old pig-raising country woman with an eight-day course of nausea, vomiting. dysentery with intestinal bleeding the latter being the direct cause of death. The autopsy showed ulcerative colitis due to B. coli, which was easily observed on histological examination of the large bowel.

PELAKSANAAN ITIKAD BAIK MEMORY OF UNDERSTANDINGDALAM PERJANJIAN JOINT VENTUREPERUSAHAAN MODAL ASING

Directory of Open Access Journals (Sweden)

Heru Guntoro

2014-11-01

Full Text Available This paper examines the perspective of law in implementation good conviction memory of understanding in joint venture agreement and the result from law implementation memory of understanding in join venture agreement in the supreme court decision. This research is a literary research, the legal matters are analyzed qualitatively using normatif and juridical approach. From research can concludes, implementation from good conviction Memory of Understanding in the joint venture agreement are command of regulation with there are measure and explisit sanction to they who break a promise. Tulisan ini bertujuan untuk mengkaji perspektif hukum perdata terhadap pelaksanaan itikad baik dan akibat hukum pelaksanaan Memory of Understandingdalam perjanjian joint venturePerusahaan Modal Asing dalam Putusan Mahkamah Agung. Penelitian yang dilakukan adalah penelitian kepustakaan, bahanbahan hukum yang dianalisis secara kualitatif dengan pendekatan yuridis normatif dan komparatif. Dari penelitian yang dilakukan dapat disimpulkan bahwa: pelaksanaan itikad baik Memory of Understandingdalam perjanjian joint venturePerusahaan Modal Asing merupakan perintah Undang-Undang serta ada tindakan dan sanksi tegas bagi mereka yang telah melakukan wanprestasi (beritikad tidak baik.

Influências nutricionais na psoríase Nutritional influences in psoriasis

Directory of Open Access Journals (Sweden)

Maria Lúcia Diniz Araujo

2009-02-01

Full Text Available A psoríase é uma doença inflamatória de pele, mediada por células T, hereditária, que sofre influência ambiental. Ingestão elevada de ômega-3, jejum, dietas hipocalóricas e vegetarianas mostram efeitos benéficos. Alguns pacientes que apresentam anticorpos antigliadina IgA/IgG, com sensibilidade ao glúten, melhoram após a retirada deste. O calcitriol é usado no tratamento tópico. Ingestão de álcool pode exacerbar a doença. Neste trabalho, analisam-se fatores dietéticos e descrevem-se seus benefícios na psoríase.Psoriasis is an inherited inflammatory skin disease mediated by T-cells and influenced by environmental factors. High intake of omega-3, fasting, low-calorie and vegetarian diets show beneficial effects. Some patients presenting IgA/IgG antigliadin antibodies and who are gluten-sensitive improve after a gluten-free diet. Calcitriol is used in topical treatment. The use of alcohol may exacerbate the disease. In this report, diet factorsare analyzed and their benefits in psoriasis are described.

Detecção de casos novos de hanseníase no município de Prudentópolis, PR: uma análise de 1998 a 2005

OpenAIRE

Sanches,Lucas Augusto Thomé; Pittner,Elaine; Sanches,Hermes Francisco; Monteiro,Marta Chagas

2007-01-01

Este trabalho teve como objetivo detectar os casos novos de hanseníase do período de 1998 a 2005 no município de Prudentópolis, PR. Assim como, verificar a faixa etária e a forma clínica predominante entre os casos de hanseníase. Os dados foram obtidos através das fichas clínico-epidemiológicas de casos com diagnóstico definitivo de hanseníase notificado no Sistema de Informação sobre Agravos de Notificação, de 1998 a 2005. Neste período, foram relatados 222 casos de hanseníase, dos quais 63%...

Research reports: 1990 NASA/ASEE Summer faculty fellowship program

International Nuclear Information System (INIS)

Freeman, L.M.; Chappell, C.R.; Six, F.; Karr, G.R.

1990-10-01

Reports on the research projects performed under the NASA/ASEE Summer faculty fellowship program are presented. The program was conducted by The University of Alabama and MSFC during the period from June 4, 1990 through August 10, 1990. Some of the topics covered include: (1) Space Shuttles; (2) Space Station Freedom; (3) information systems; (4) materials and processes; (4) Space Shuttle main engine; (5) aerospace sciences; (6) mathematical models; (7) mission operations; (8) systems analysis and integration; (9) systems control; (10) structures and dynamics; (11) aerospace safety; and (12) remote sensing

PERBANDINGAN KOMUNIKASI NONVERBAL PENUTUR ASLI DAN PENUTUR ASING BAHASA INGGRIS DALAM PUBLIC SPEAKING

Directory of Open Access Journals (Sweden)

I Made Suta Paramarta

2016-08-01

Full Text Available Abstrak Tujuan penelitian ini adalah untuk membandingkan fitur-fitur nonverbal penutur asli dan penutur asing dalam public speaking. Perbedaan budaya antara kedua kelompok penutur tersebut menimbulkan perbedaan penggunaan fitur nonverbal dalam public speaking. Desain penelitian ini adalah desain deskriptif kualitatif dengan 10 subjek. 5 subjek adalah video penutur asli Bahasa Inggris dan 5 video subjek yang lain adalah video mahasiswa Jurusan D III Bahasa Inggris Universitas Pendidikan Ganesha. Penutur asli menunjukkan gerakan nonverbal yang jauh lebih variatif dari penutur asing Bahasa Inggris. Penutur asli memiliki gerakan-gerakan spesifik yang mengacu pada makna yang spesifik juga. Di lain pihak, penutur asing menunjukkan gerakan nonverbal yang bersifat umum tanpa rujukan pasti pada maksud yang spesifik. Fitur nonverbal yang dicermati dikelompokkan pada gerakan kepala, gerakan badan, dan kontak mata. Kata kunci: perbandingan, nonverbal, public speaking Abstract The purpose of this research is to compare the nonverbal features of the native speakers and the non-native speakers of English in public speaking. Cultural differences between the two groups make significant differences on using the nonverbal features in public speaking. The design of this research was a descriptive-qualitative design with 10 subjects. 5 subjects were videos of 5 English native speakers and the other 5 subjects were the videos of 5 students of Diploma III English Department Universitas Pendidikan Ganesha. The native speakers showed more variative nonverbal movements compared to the non-native speakers. The native speakers made specific gestures which refered to certain specific meanings. On the other hand, the non-native speakers applied general nonverbal movements without specific referents. The investigated nonverbal features were grouped into head movements, body movements, and eye contacts. Keywords: comparison, nonverbal, public speaking

Rinolitíase como causa de fístula oronasal Rhinolithiasis as cause of oronasal fistula

Directory of Open Access Journals (Sweden)

Gabriel Cesar Dib

2005-02-01

Full Text Available A Rinolitíase é uma doença na qual ocorre a deposição de compostos orgânicos e inorgânicos em torno de um núcleo na cavidade nasal, causando rinorréia, obstrução nasal unilateral, odor fétido, epistaxe, podendo haver complicações. Os autores apresentam um caso de rinolitíase com fístula oronasal e revisão de literatura.Rhinolithiasis is a disease caused by deposition of organic and inorganic compounds in the nasal cavity, leading to unilateral nasal obstruction, fetid rhinorrhea, epistaxis, and it may cause complications. The authors present a case of rhinolithiasis with oronasal fistula and literature review.

Imunopatogênese da psoríase: revisando conceitos Reviewing concepts in the immunopathogenesis of psoriasis

Directory of Open Access Journals (Sweden)

Emerson de Andrade Lima

2011-12-01

Full Text Available O conhecimento sobre a fisiopatogenia da psoríase possibilitou o desenvolvimento de ferramentas terapêuticas que visam ao bloqueio do seu gatilho imunológico. Paralelamente, citocinas como o TNF têm sido reconhecidas como integrantes da etiopatogenia da psoríase e comorbidades a ela relacionadas. Estudos genéticos e epidemiológicos contribuíram efetivamente para as conclusões a que se tem chegado atualmente sobre esta complexa patologia.Insights into the pathogenesis of psoriasis led to the development of therapeutic tools aimed at blocking its immunological trigger. In parallel, cytokines such as the tumor necrosis factor (TNF have been recognized as playing a crucial role in the pathogenesis of psoriasis and its associated comorbidities. Genetic and immunological studies have contributed effectively towards establishing the currently held concepts regarding this complex disease.

Peran Sistem Informasi Dalam Meningkatkan Investasi Asing Pada Sektor Properti Di Indonesia Di Era Pasar Bebas

Directory of Open Access Journals (Sweden)

Yosi Agustiawan

2015-01-01

Full Text Available Abstrak Pasar bebas adalah hasil dari proses globalisasi yang telah menciptakan integrasi ekonomi antar negara. Artikel ini mengkaji dampak globalisasi di pasar properti global dan peran sistem informasi untuk meningkatkan investasi asing di Indonesia. Meningkatnya investasi asing langsung (Foreign Direct Investmen/FDI yang mengalir ke negara berkembang termasuk Indonesia di berbagai sektor termasuk properti telah memberikan banyak manfaat untuk meningkatkan ekonomi. Buruknya peraturan kepemilikan tanah dan infrastruktur adalah masalah utama yang harus diatasi untuk menjaga agar investor asing masih berniat untuk menanamkan modalnya dalam pasar properti global. Sistem informasi dapat digunakan sebagai alat yang efektif untuk mengatasi masalah-masalah tersebut melalui penggunaan e-government dan perencanaan strategis implementasi sistem informasi dalam proyek infrastruktur. Abstract Cross-border relationships do not only affect many aspects but it also creates economic integration among countries. This essay examines the impact of globalization on the property market and the role of information system to promote foreign direct investment (FDI in Indonesia. Allowing foreign direct investment (FDI flows to those developing in various industries including property has clearly provided positive opportunities to improve their economic. Poor land regulations and infrastructure are the main issues that must be overcome to maintain foreign investor still intend to capitalize on the global property market. Information system can be used as effective tool to resolve those issues through e-government and strategic implementation in projects infrastructure.

PERLINDUNGAN HUKUM TERHADAP INVESTOR ASING PERUSAHAAN JOINT VENTURE SEKTOR AIR BERSIH DI KABUPATEN DELI SERDANG (Studi Pada PT. Tirta Lyonnaise Medan

Directory of Open Access Journals (Sweden)

Sjahril Effendy

2017-08-01

Full Text Available Penanaman modal asing memegang peranan penting dalam perekonomian. Keberhasilan suatu pembangunan nasional tidak dapat dipisahkan dari penanaman modal asing sebagai faktor penunjang dan turut menentukan pembangunan ekonomi, antara lain dapat menciptakan pekerjaan, terjadinya alih teknologi, memberikan masukan dari segi perpajakan dan pendapatan negara dan daerah. Menciptakan kepastian hukum terhadap investor asing perusahaan joint venture sebagai bentuk perlindungan hukum. Pemerintah  Kabupaten Deli Serdang dalam pembangunan sektor air bersih juga memberlakukan Undang-Undang No.25 Tahun 2007 tentang Penanaman Modal walaupun belum sepenuhnya diterapkan. Hambatan-hambatan yang dihadapi antara lain berupa perjanjian kerjasama dengan PDAM Tirtanadi tidak sepenuhnya dilaksanakan, penyerahan air bersih merupakan objek PPN padahal menurut ketentuan merupakan objek yang bebas dari PPN, dan UU No.13 Tahun 2003 tentang Ketenagakerjaan telah disalahgunakan oleh oknum serikat pekerja perusahaan. Penyelesaian sengketa berpedoman kepada  perjanjian kerjasama  antara PT. Tirta Lyonnaise Medan dengan PDAM Tirtanadi Provinsi Sumatera Utara.

Estudo da ocorrência de litíase renal e ureteral em gatos com doença renal crônica

Directory of Open Access Journals (Sweden)

Marcela Malvini Pimenta

2014-06-01

Full Text Available Investigou-se a ocorrência de nefrolitíase e/ou ureterolitíase em 72 gatos portadores de doença renal crônica (DRC, classificados predominantemente no estágio II, segundo os critérios designados pela IRIS - International Renal Interest Society. Destes pacientes, 47 (65,27% apresentaram litíase renal e ou ureteral. Não houve diferença estatística entre o grupo de estudo (DRC com cálculo e o grupo controle (DRC sem cálculo em relação à idade (p=0,274. Apesar disso, os pacientes portadores de nefrolitíase e/ou ureterolitíase apresentaram maiores indícios de lesão renal, caracterizados por diferenças estatisticamente relevantes da densidade urinária (p=0,013 e pelo menor tamanho dos rins direito (p=0,009 e esquerdo (p=0,048. Encontrou-se similaridade entre os grupos em relação a outros parâmetros, tais como as concentrações plasmáticas de cálcio total, cálcio ionizado, fósforo, sódio, potássio e paratormônio intacto (PTHi. Os valores das concentrações séricas de ureia e bicarbonato diferiram entre os grupos, com valores de p=0,039 e p=0,037, respectivamente. Além disso, foi mensurada a pressão arterial, que se manteve inalterada na comparação entre o grupo de estudo e o grupo controle. Os resultados obtidos reforçam a necessidade de acompanhamento ultrassonográfico de todos os pacientes portadores de DRC, mesmo daqueles assintomáticos ou em estágios iniciais da doença.

Ivermectina no tratamento de miíase orbitária: relato de caso Ivermectine in the treatment of orbital myiasis: case report

Directory of Open Access Journals (Sweden)

Mario Enrique Lovatón Rodriguez

2003-08-01

Full Text Available OBJETIVO: Relatar um caso de miíase associada a carcinoma basocelular de órbita, tratada com ivermectina previamente ao ato cirúrgico. MÉTODOS: Apresentamos um caso e enfatizamos a eficácia da ivermectina no tratamento da miíase como terapêutica alternativa. RESULTADO: Após o tratamento com ivermectina via oral em dose única, observou-se a resolução completa do quadro de miíase num período de 48 horas. CONCLUSÃO: A ivermectina pode ser utilizada com eficácia no tratamento da miíase orbitária, tornado desnecessária a remoção mecânica das larvas.OBJECTIVE: We report a case of myiasis in a patient with basocellular carcinoma of the orbit, treated with ivermectine prior to surgery. METHODS: We report a case and emphasize the efficacy of ivermectine in the treatment of myiasis, as alternative therapy. RESULTS: After oral administration of a single dose of ivermectine we saw a complete resolution of the myiasis in a 48-hour period. CONCLUSION: Ivermectine can be used successfully in the treatment of orbital myiasis, turning the mechanical removal of larvae an unnecessary procedure.

Corporate Governance for A.S.E. Listed Firms

Directory of Open Access Journals (Sweden)

Tellidou Theognosia

2016-03-01

Full Text Available The present paper focuses on the level of compliance and application of corporate governance from the corporations listed in the Athens Stock Exchange (A.S.E. and attempts to highlight improvements from the adoption of best practices suggested by corporate governance recent trends worldwide. In order for the research to be conducted, a series of qualitative and quantitative variables were used, as derived from the financial statements of 162 public companies. A more extensive analysis regarding the level of compliance with corporate governance was conducted in 25 companies with the highest and 25 corporations with the lowest score, whose classification in these positions was the result of a rating system that was created for this purpose.

Miíase vulvar: relato de caso Vulvar myiasis: a case report

Directory of Open Access Journals (Sweden)

Carlos Augusto Real Martinez

2003-05-01

Full Text Available A miíase de localização vulvar é doença rara. O objetivo do presente relato é descrever um caso de miíase vulvar por larvas de Cochliomyia hominivorax em mulher de 77 anos, com precários hábitos higiênicos, apresentando dor, prurido e secreção de odor fétido na região genital há 10 dias. O exame ginecológico demonstrou lesão ulcerada no grande lábio vulvar, com seis centímetros, que se estendia ao monte do pube, preenchida por larvas. A doente evoluiu favoravelmente após remoção das larvas, desbridamento cirúrgico e curativos diários, sendo realizada, quatorze dias após o desbridamento, rotação de retalho cutâneo. Apresentou evolução satisfatória, estando assintomática dois meses após a intervenção. A miíase vulvar deve ser considerada no diagnóstico diferencial das doenças infecciosas vulvares de doentes com hábitos de higiene precários.Myiasis located in the vulva is a rarely described disease. The objective of the present report is to describe a case of vulvar myiasis due to larvae of Cochliomyia hominivorax. A 77-year-old woman with precarious hygienic habits presented pain, pruritus and secretions with a fetid smell in the genital region for 10 days. Gynecological examination demonstrated an ulcerated lesion in the labium majus of the vulva measuring six centimeters that extended to the mons pubis and was found to be filled with larvae. The patient progressed favorably after removal of the larvae, surgical debridement and daily dressings. Fourteen days after the debridement, she was submitted to skin flap rotation, with good local scar formation. Two months after the intervention, she remained asymptomatic. Vulvar myiasis must be considered in the differential diagnosis of infectious diseases of the vulva in patients with precarious hygienic habits.

Predicting adherence to prophylactic medication in adolescents with asthma: an application of the ASE-model

NARCIS (Netherlands)

van Es, S.M.; Kaptein, A.A.; Bezemer, P.D.; Nagelkerke, A.F.; Colland, V.T.; Bouter, L.M.

2002-01-01

An explanatory framework, referred to as the attitude/social influence/self-efficacy-model (ASE-model), was utilised to explain future self-reported adherence of adolescents to daily inhaled prophylactic asthma medication. The objective was to investigate the long-term influence of these earlier

Predicting adherence to prophylactic medication in adolescents with asthma : an application of the ASE-model

NARCIS (Netherlands)

van Es, Saskia M; Kaptein, Adrian A; Bezemer, P Dick; Nagelkerke, Ad F; Colland, Vivian T; Bouter, Lex M

An explanatory framework, referred to as the attitude/social influence/self-efficacy-model (ASE-model), was utilised to explain future self-reported adherence of adolescents to daily inhaled prophylactic asthma medication. The objective was to investigate the long-term influence of these earlier

The 1989 NASA-ASEE Summer Faculty Fellowship Program in Aeronautics and Research

Science.gov (United States)

Boroson, Harold R.; Soffen, Gerald A.; Fan, Dah-Nien

1989-01-01

The 1989 NASA-ASEE Summer Faculty Fellowship Program at the Goddard Space Flight Center was conducted during 5 Jun. 1989 to 11 Aug. 1989. The research projects were previously assigned. Work summaries are presented for the following topics: optical properties data base; particle acceleration; satellite imagery; telemetry workstation; spectroscopy; image processing; stellar spectra; optical radar; robotics; atmospheric composition; semiconductors computer networks; remote sensing; software engineering; solar flares; and glaciers.

The Rate of Success of the Accelerated Solvent Extraction (Ase of Fat and Organochlorine Pesticides from Dried Fish Meat Samples

Directory of Open Access Journals (Sweden)

Ana Andreea CIOCA

2017-05-01

Full Text Available The replacement of conventional sample preparation techniques with newer techniques which are automated, faster and more eco-friendly, is nowadays desired in every analytical laboratory. One of the techniques with the attributes mentioned above is the Accelerated Solvent Extraction. In order to evaluate how successful this method is for the extraction of fat and organochlorine pesticides (OCPs from dried fish meat samples, we have tested two series of diverse fish using Dionex™ 350 ASE provided by Thermo Scientific™ (Germany. For a more interesting approach, we added to our investigation 7 polychlorinated biphenyl (PCBs, 3 thricholorobenzenes, 2 tetrachlorobenzenes, 1 pentachlorobenzenes and 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD. The study focused on comparing the recoveries of these analytes from different fish samples, after replacing the conventional reference method of the laboratory with ASE. The ASE parameters tested were previously used for the extraction of fat and polybrominated diphenyl ethers (PBDE from fish samples: temperature: 120 ° C; static time: 5 min; number of cycles: 3; flushing volume: 25%; rinse with nitrogen: 90 s; solvent: cyclohexane/ethyl acetate (ratio 1:1. The ASE method provided similar and in some cases better results when compared to the standard reference method, more rapidly, eco-friendly and safer. Any high or low recoveries of the analytes taken into study are attributed to random or systematic errors during the Clean-up step of the extracts and the quantification with Gas Chromatography coupled with Tandem Mass-Spectrometry (GC MS/MS.

Research reports: 1989 NASA/ASEE Summer faculty fellowship program

International Nuclear Information System (INIS)

Karr, G.R.; Six, R.; Freeman, L.M.

1989-12-01

For the twenty-fifth consecutive year, a NASA/ASEE Summer Faculty Fellowship Program was conducted at the Marshall Space Flight Center (MSFC). The basic objectives of the programs are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of the participants' institutions; and (4) to contribute to the research objectives of the NASA Centers. The Faculty Fellows spent ten weeks at MSFC engaged in a research project compatible with their interests and background and worked in collaboration with a NASA/MSFC colleague

Prevenção de incapacidade na hanseníase com apoio em um manual de autocuidado para pacientes

OpenAIRE

Rodini,Fernanda Carvalho Batista; Gonçalves,Mayara; Barros,Ana Regina de Souza Bavaresco; Mazzer,Nilton; Elui,Valéria Meirelles Carril; Fonseca,Marisa de Cássia Registro

2010-01-01

A hanseníase é uma doença infectocontagiosa, de evolução lenta, que se manifesta por sinais e sintomas dermatoneurológicos, com lesões na pele e nos nervos periféricos. O objetivo deste estudo foi avaliar o status físico e funcional de olhos, mãos e pés de pacientes com hanseníase, em relação ao aparecimento e evolução de deficiências sensitivo-motoras, grau de incapacidade e qualidade de vida, tendo os pacientes recebido e utilizado durante um ano um manual especialmente elaborado, com orien...

Avaliação da dor em portadores de hanseníase submetidos à mobilização neural

OpenAIRE

Véras,Larissa Sales Téles; Vale,Rodrigo Gomes de Souza; Mello,Danielli Braga de; Castro,José Adail Fonseca de; Dantas,Estélio Henrique Martin

2011-01-01

Este estudo tem como objetivo avaliar o efeito da técnica de mobilização neural sobre a percepção da dor em portadores de hanseníase. A amostra de 56 indivíduos portadores de hanseníase foi randomizada em: grupo experimental (GMN) composto por 29 indivíduos submetidos ao tratamento com mobilização neural e grupo controle (GC) composto por 27 indivíduos que foram submetidos ao tratamento convencional. A percepção da dor foi avaliada através da Escala Visual Analógica, indicando-se em uma extre...

Vivências compartilhadas de filhos separados pela hanseníase no RN a luz da história oral de vida

OpenAIRE

Cabral, Ana Michele de Farias

2013-01-01

Várias epidemias marcaram a vida das pessoas e coletividades, em todos os períodos históricos, sendo um dos principais exemplos a hanseníase, doença infecto-contagiosa, marcada pelo estigma, preconceito e exclusão social. No passado, o isolamento compulsório dos pacientes portadores de hanseníase causou sérios problemas sociais e psicológicos, resultando no afastamento e na ruptura total ou parcial do vínculo familiar. Os filhos privados desse convívio, retirados muitas vezes de forma desuman...

National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1987, volume 2

Science.gov (United States)

Jones, William B., Jr. (Editor); Goldstein, Stanley H. (Editor)

1987-01-01

The 1987 Johnson Space Center (JCS) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship program was conducted by Texas A and M University and JSC. The 10-week program was operated under the auspices of ASEE. The basic objectives of the program are: to further the professional knowledge of qualified engineering and science faculty members; to stimulate an exchange of ideas between participants and NASA; to enrich and refresh the research and teaching activities of participants' institutions; and to contribute to the research objective of the NASA Centers. This document is a compilation of the final reports on the research projects done by the faculty fellows during the summer of 1987.

Patient self-report section of the ASES questionnaire: a Spanish validation study using classical test theory and the Rasch model.

Science.gov (United States)

Vrotsou, Kalliopi; Cuéllar, Ricardo; Silió, Félix; Rodriguez, Miguel Ángel; Garay, Daniel; Busto, Gorka; Trancho, Ziortza; Escobar, Antonio

2016-10-18

The aim of the current study was to validate the self-report section of the American Shoulder and Elbow Surgeons questionnaire (ASES-p) into Spanish. Shoulder pathology patients were recruited and followed up to 6 months post treatment. The ASES-p, Constant, SF-36 and Barthel scales were filled-in pre and post treatment. Reliability was tested with Cronbach's alpha, convergent validity with Spearman's correlations coefficients. Confirmatory factor analysis (CFA) and the Rasch model were implemented for assessing structural validity and unidimensionality of the scale. Models with and without the pain item were considered. Responsiveness to change was explored via standardised effect sizes. Results were acceptable for both tested models. Cronbach's alpha was 0.91, total scale correlations with Constant and physical SF-36 dimensions were >0.50. Factor loadings for CFA were >0.40. The Rasch model confirmed unidimensionality of the scale, even though item 10 "do usual sport" was suggested as non-informative. Finally, patients with improved post treatment shoulder function and those receiving surgery had higher standardised effect sizes. The adapted Spanish ASES-p version is a valid and reliable tool for shoulder evaluation and its unidimensionality is supported by the data.

Fatores de risco clínicos e ultra-sonográficos relacionados à litíase vesicular assintomática em mulheres

Directory of Open Access Journals (Sweden)

Ferreira Adilson Cunha

2004-01-01

Full Text Available OBJETIVO: Analisar variáveis clínicas e ultra-sonográficas, como presença ou ausência de barro biliar, espessura da parede e medida transversal da vesícula biliar, idade, paridade, presença ou ausência de diabetes mellitus associadas a litíase vesicular assintomática, bem como determinar a sua prevalência em pacientes submetidas ao exame ultra-sonográfico. MATERAIS E MÉTODOS: Foram analisadas, em estudo prospectivo, 265 pacientes do sexo feminino, atendidas na Escola de Ultra-sonografia e Reciclagem Médica de Ribeirão Preto, durante o período de janeiro a setembro de 2001. RESULTADOS: Evidenciou-se diferença estatisticamente significativa relacionada à litíase da vesícula biliar e espessura da parede da vesícula biliar, barro biliar, diâmetro transverso da vesícula biliar, faixa etária, paridade, passando de 4,1% nas nulíparas para 39,1% nas multíparas e diabéticas. A prevalência de litíase na vesícula biliar em pacientes assintomáticas foi de 14,7%. CONCLUSÃO: A litíase vesicular assintomática em mulheres ocorre principalmente com o decorrer da idade e da paridade. Os achados ultra-sonográficos mais freqüentemente encontrados foram presença de barro biliar e de espessamento da parede da vesícula biliar.

Fatores associados à candidíase vulvovaginal: estudo exploratório

Directory of Open Access Journals (Sweden)

Rosa Maria Inês da

2004-01-01

Full Text Available OBJETIVO: avaliar fatores de risco para candidíase vulvovaginal identificados ao exame e anamnese ginecológica, em amostra de conveniência. MÉTODO: estudo transversal, com amostra de conveniência, envolvendo todas as trabalhadoras (135 de uma indústria de confecção em Criciúma (SC, sintomáticas e assintomáticas, no período de julho a setembro de 2002. Foi utilizada, como técnica de coleta dos dados, entrevista roteirizada investigando-se possíveis fatores de risco. O exame ginecológico detectou a presença ou não de sinais clínicos de vulvovaginites. Realizou-se cultura de secreção vaginal em meio de ágar Sabouraud para isolamento de Candida sp. Os dados foram processados e analisados no programa Epi-Info, versão 6.0. A medida de intensidade de associação usada foi a razão de prevalência. O intervalo de confiança adotado para inferência estatística foi de 95%. A análise multivariada dos dados foi realizada pelo programa SPSS versão 10.0, empregando-se modelo de regressão logística. RESULTADOS: os resultados mostraram que a prevalência da candidíase vulvovaginal foi de 19,3%. A freqüência de vulvovaginite diagnosticada pelo exame clínico foi de 17%, com sensibilidade de 38% e especificidade de 88%. O fator de risco significante para vulvovaginite por Candida nessa população foi a presença de ciclos menstruais regulares e para vulvovaginite clínica foi o uso de hormônios e idade entre 25 e 34 anos. CONCLUSÃO: a prevalência de candidíase vulvovaginal é alta entre mulheres consideradas hígidas e o fator de risco encontrado com significância estatística foi a presença de ciclos menstruais regulares, reforçando a importância de possível relação entre ciclo hormonal e esta infecção. Devido à limitação do presente estudo, esta possível associação, juntamente com outras, devem ser estudadas num futuro desenho de coorte com amostra de tamanho apropriado e medidas de níveis hormonais ao longo

Aspectos epidemiológicos dateníase-cisticercose na área endêmica de Lagamar, MG

Directory of Open Access Journals (Sweden)

Mario León Silva-Vergara

1995-12-01

Full Text Available Um inquérito epidemiológico sobre teníase-cisticercose foi realizado em Lagamar- MG em 1992. Cadastradas 1109 casas com 3344 habitantes. O inquérito abrangeu 875 (86% famílias e foi respondido por um informante que, em 80% dos casos, foi o pai. Na cidade havia 100 chiqueiros em 100 (11,4% casas que albergavam 406 suínos, em condições extremamente precárias. Em 300 (34,2% casas havia o antecedente de teníase em algum membro da família. O antecedente de convulsão foi relatado por 125 (14,2% famílias. O início das convulsões na idade adulta foi caracterizado em 39 (3 7,8% famílias e o antecedente de doenças mentais foi relatado em 53 (6% casas. Os exames parasitológicos de fezes mostraram ovos de Taenia spp em 24 (1,3% das 1850 amostras examinadas.

Amiloidose e insuficiência renal crônica terminal associada à hanseníase Amyloidosis and end-stage renal disease associated with leprosy

Directory of Open Access Journals (Sweden)

Geraldo Bezerra da Silva Júnior

2010-08-01

Full Text Available O envolvimento renal na hanseníase é diverso, incluindo glomerulonefrites, amiloidose e nefrite túbulo-intersticial. Um homem de 58 anos foi admitido com edema de membros inferiores e dispnéia. Na admissão, havia retenção de escórias nitrogenadas, anemia, hipercalemia e acidose metabólica, com necessidade de hemodiálise. Referia história de hanseníase virchoviana. Foi realizada biopsia renal, compatível com amiloidose. O paciente evoluiu estável, sem recuperação da função renal, permanecendo em tratamento hemodialítico. A hanseníase deve ser investigada em todo paciente com perda de função renal, sobretudo naqueles que apresentam lesões cutâneas ou outras manifestações sugestivas de hanseníase.Renal involvement in leprosy includes glomerulonephritis, amyloidosis and tubulointerstitial nephritis. A 58-year-old man was admitted with complaints of lower limb edema and dyspnea. At admission, nitrogen retention, anemia, hyperkalemia and metabolic acidosis were observed, requiring hemodialysis. The patient had a history of lepromatous leprosy. A renal biopsy was performed that was compatible with amyloidosis. The patient had a stable outcome, but without renal function recovery and remained on regular hemodialysis. Leprosy should be investigated in every patient with renal function loss, particularly in those with cutaneous lesions or other manifestations suggestive of leprosy.

Lead-free solder technology transfer from ASE Americas

Energy Technology Data Exchange (ETDEWEB)

FTHENAKIS,V.

1999-10-19

To safeguard the environmental friendliness of photovoltaics, the PV industry follows a proactive, long-term environmental strategy involving a life-of-cycle approach to prevent environmental damage by its processes and products from cradle to grave. Part of this strategy is to examine substituting lead-based solder on PV modules with other solder alloys. Lead is a toxic metal that, if ingested, can damage the brain, nervous system, liver and kidneys. Lead from solder in electronic products has been found to leach out from municipal waste landfills and municipal incinerator ash was found to be high in lead also because of disposed consumer electronics and batteries. Consequently, there is a movement in Europe and Japan to ban lead altogether from use in electronic products and to restrict the movement across geographical boundaries of waste containing lead. Photovoltaic modules may contain small amounts of regulated materials, which vary from one technology to another. Environmental regulations impact the cost and complexity of dealing with end-of-life PV modules. If they were classified as hazardous according to Federal or State criteria, then special requirements for material handling, disposal, record-keeping and reporting would escalate the cost of decommissioning the modules. Fthenakis showed that several of today's x-Si modules failed the US-EPA Toxicity Characteristic Leaching Procedure (TCLP) for potential leaching of Pb in landfills and also California's standard on Total Threshold Limit Concentration (TTLC) for Pb. Consequently, such modules may be classified as hazardous waste. He highlighted potential legislation in Europe and Japan which could ban or restrict the use of lead and the efforts of the printed-circuit industries in developing Pb-free solder technologies in response to such expected legislation. Japanese firms already have introduced electronic products with Pb-free solder, and one PV manufacturer in the US, ASE Americas has used a

Edema na hanseníase: aspectos clínicos e terapêuticos

OpenAIRE

Valentini,Attilio; Nery,José A.C.; Salles,Ana Maria; Vieira,Leila M.M.; Sarno,Euzenir N.

1999-01-01

Durante o curso da hanseníase, o edema comumente descrito como um sintoma de estados reacionais, pode ocorrer. Tanto o diagnóstico como a terapêutica adequada são, freqüentemente, difíceis de conseguir e assim podem acarretar permanente dano aos membros inferiores. Em um ano de acompanhamento, pacientes hansenianos - 10 multibacilares e 1 paucibacilar -, que foram submetidos a um protocolo clínico para o diagnóstico e classificação histopatológica, apresentaram clinicamente edema, localizado ...

National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1989, volume 2

Science.gov (United States)

Jones, William B., Jr. (Editor); Goldstein, Stanley H. (Editor)

1989-01-01

The 1989 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by Texas A and M University and JSC. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objective of the NASA Centers.

National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program 1988, volume 2

Science.gov (United States)

Bannerot, Richard B.; Goldstein, Stanley H.

1989-01-01

The 1988 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JCS. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began in 1965 at JSC and in 1964 nationally, are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objectives of the NASA Centers.

National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1998. Volume 1

Science.gov (United States)

Bannerot, Richard B. (Editor); Sickorez, Donn G. (Editor)

1999-01-01

JSC NASA/ASEE Summer Faculty Fellowship Program was conducted by the University of Houston and JSC, under ASEE. The objectives of the program are to further the professional knowledge of qualified engineering and science members; stimulate an exchange of ideas between participants and NASA; enrich and refresh the research and teaching activities of participants; and contribute to the research objectives of the NASA Centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project commensurate with his/her interests and background and worked in collaboration with a NASA/JSC colleague. This document is a compilation of the final reports on the fellows' research projects performed during the summer of 1998. Volume 1, current volume, contains the first reports, and volume 2 contains the remaining reports.

National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1989, volume 1

Science.gov (United States)

Jones, William B., Jr. (Editor); Goldstein, Stanley H. (Editor)

1989-01-01

The 1989 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by Texas A and M University and JSC. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objective of the NASA Centers.

National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program 1988, volume 1

Science.gov (United States)

Bannerot, Richard B. (Editor); Goldstein, Stanley H. (Editor)

1989-01-01

The 1988 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began in 1965 at JSC and in 1964 nationally, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objectives of the NASA Centers.

Edema na hanseníase: aspectos clínicos e terapêuticos

Directory of Open Access Journals (Sweden)

Valentini Attilio

1999-01-01

Full Text Available Durante o curso da hanseníase, o edema comumente descrito como um sintoma de estados reacionais, pode ocorrer. Tanto o diagnóstico como a terapêutica adequada são, freqüentemente, difíceis de conseguir e assim podem acarretar permanente dano aos membros inferiores. Em um ano de acompanhamento, pacientes hansenianos - 10 multibacilares e 1 paucibacilar -, que foram submetidos a um protocolo clínico para o diagnóstico e classificação histopatológica, apresentaram clinicamente edema, localizado ou sistêmico. Entre estes pacientes, cinco apresentaram simultaneamente outros sintomas de reação, 4 foram classificados como reação Tipo I e um como reação tipo II. Por outro lado, três pacientes não apresentaram reação no momento do diagnóstico, mas desenvolveram alguns aspectos de reação posteriormente (2 tiveram neurite e um teve reação tipo I. Os edemas observados precedendo ou associados a quadros reacionais apresentaram ótima resposta clínica às drogas de ação anti-inflamatória (corticóide, talidomida e pentoxifilina utilizadas para o tratamento dos estados reacionais, na ausência de qualquer outro tratamento normalmente usado para edema. Embora necessitem ser confirmados por estudos controlados, estes dados sugerem fortemente que mecanismos imunológicos estejam envolvidos na fisiopatologia dos edemas na hanseníase.

WE-G-204-05: Relative Object Detectability Evaluation of a New High Resolution A-Se Direct Detection System Compared to Indirect Micro-Angiographic Fluoroscopic (MAF) Detectors

International Nuclear Information System (INIS)

Russ, M; Nagesh, S Setlur; Ionita, C; Bednarek, D; Rudin, S; Scott, C; Karim, K

2015-01-01

Purpose: To evaluate the task specific imaging performance of a new 25µm pixel pitch, 1000µm thick amorphous selenium direct detection system with CMOS readout for typical angiographic exposure parameters using the relative object detectability (ROD) metric. Methods: The ROD metric uses a simulated object function weighted at each spatial frequency by the detectors’ detective quantum efficiency (DQE), which is an intrinsic performance metric. For this study, the simulated objects were aluminum spheres of varying diameter (0.05–0.6mm). The weighted object function is then integrated over the full range of detectable frequencies inherent to each detector, and a ratio is taken of the resulting value for two detectors. The DQE for the 25µm detector was obtained from a simulation of a proposed a-Se detector using an exposure of 200µR for a 50keV x-ray beam. This a-Se detector was compared to two microangiographic fluoroscope (MAF) detectors [the MAF-CCD with pixel size of 35µm and Nyquist frequency of 14.2 cycles/mm and the MAF-CMOS with pixel size of 75µm and Nyquist frequency of 6.6 cycles/mm] and a standard flat-panel detector (FPD with pixel size of 194µm and Nyquist frequency of 2.5cycles/mm). Results: ROD calculations indicated vastly superior performance by the a-Se detector in imaging small aluminum spheres. For the 50µm diameter sphere, the ROD values for the a-Se detector compared to the MAF-CCD, the MAF-CMOS, and the FPD were 7.3, 9.3 and 58, respectively. Detector performance in the low frequency regime was dictated by each detector’s DQE(0) value. Conclusion: The a-Se with CMOS readout is unique and appears to have distinctive advantages of incomparable high resolution, low noise, no readout lag, and expandable design. The a-Se direct detection system will be a powerful imaging tool in angiography, with potential break-through applications in diagnosis and treatment of neuro-vascular disease. Supported by NIH Grant: 2R01EB002873 and an

WE-G-204-05: Relative Object Detectability Evaluation of a New High Resolution A-Se Direct Detection System Compared to Indirect Micro-Angiographic Fluoroscopic (MAF) Detectors

Energy Technology Data Exchange (ETDEWEB)

Russ, M; Nagesh, S Setlur; Ionita, C; Bednarek, D; Rudin, S [Toshiba Stroke and Vascular Research Center, University at Buffalo (SUNY), Buffalo, NY (United States); Scott, C; Karim, K [University of Waterloo, Waterloo, ON (Canada)

2015-06-15

Purpose: To evaluate the task specific imaging performance of a new 25µm pixel pitch, 1000µm thick amorphous selenium direct detection system with CMOS readout for typical angiographic exposure parameters using the relative object detectability (ROD) metric. Methods: The ROD metric uses a simulated object function weighted at each spatial frequency by the detectors’ detective quantum efficiency (DQE), which is an intrinsic performance metric. For this study, the simulated objects were aluminum spheres of varying diameter (0.05–0.6mm). The weighted object function is then integrated over the full range of detectable frequencies inherent to each detector, and a ratio is taken of the resulting value for two detectors. The DQE for the 25µm detector was obtained from a simulation of a proposed a-Se detector using an exposure of 200µR for a 50keV x-ray beam. This a-Se detector was compared to two microangiographic fluoroscope (MAF) detectors [the MAF-CCD with pixel size of 35µm and Nyquist frequency of 14.2 cycles/mm and the MAF-CMOS with pixel size of 75µm and Nyquist frequency of 6.6 cycles/mm] and a standard flat-panel detector (FPD with pixel size of 194µm and Nyquist frequency of 2.5cycles/mm). Results: ROD calculations indicated vastly superior performance by the a-Se detector in imaging small aluminum spheres. For the 50µm diameter sphere, the ROD values for the a-Se detector compared to the MAF-CCD, the MAF-CMOS, and the FPD were 7.3, 9.3 and 58, respectively. Detector performance in the low frequency regime was dictated by each detector’s DQE(0) value. Conclusion: The a-Se with CMOS readout is unique and appears to have distinctive advantages of incomparable high resolution, low noise, no readout lag, and expandable design. The a-Se direct detection system will be a powerful imaging tool in angiography, with potential break-through applications in diagnosis and treatment of neuro-vascular disease. Supported by NIH Grant: 2R01EB002873 and an

Hiperparatiroidismo primário em idade pediátrica: uma causa rara de litíase renal

Directory of Open Access Journals (Sweden)

Ana Teresa Soares

2017-07-01

Conclusão: O hiperparatiroidismo primário deve ser considerado no diagnóstico diferencial de litíase renal, de forma a permitir uma intervenção precoce determinante na prevenção de lesão de órgão-alvo.

Performance of the 2-D asynchronous OCDMA system with ASE light sources

Science.gov (United States)

Ni, Bin; Lehnert, James S.

2005-09-01

The wavelength-hopping/time-spreading scheme for optical code-division multiple-access (OCDMA), also known as the 2-D scheme, has been studied by many researchers for more than a decade. In all of previous analyses, the light sources were modeled as perfectly incoherent, which requires infinite bandwidth, and chip-synchrony was assumed for mathematical simplicity. Therefore, it is important to study how the system actually performs with true asynchrony and practical light sources. The amplified spontaneous emission (ASE) source is a desirable source for the incoherent OCDMA system because of its broad bandwidth, large power, and low cost. In this paper, each chip generated by the transmitter is a rectangular ASE pulse with a Gaussian-distributed electrical field. The coherence time is much smaller than the chip duration, but non-zero. Because of this partial coherence of the light source, beat noise will occur when multiple pulses are combined. In addition, interfering pulses may only partially overlap with the pulses from the desired user due to the asynchrony, which introduces more randomness into the decision statistic. Both factors are taken into account when the distribution of the decision statistic is derived mathematically. Simulations of the bit-error rate (BER) are performed, and the results show that the coherence time may be the major limiting factor on the system performance. For example, when the coherence time is only 1/100 of the chip duration, the BER is 1-4 orders of magnitude worse than that of the ideal case.

Intra-cavity upconversion to 631 nm of images illuminated by an eye-safe ASE source at 1550 nm.

Science.gov (United States)

Torregrosa, A J; Maestre, H; Capmany, J

2015-11-15

We report an image wavelength upconversion system. The system mixes an incoming image at around 1550 nm (eye-safe region) illuminated by an amplified spontaneous emission (ASE) fiber source with a Gaussian beam at 1064 nm generated in a continuous-wave diode-pumped Nd(3+):GdVO(4) laser. Mixing takes place in a periodically poled lithium niobate (PPLN) crystal placed intra-cavity. The upconverted image obtained by sum-frequency mixing falls around the 631 nm red spectral region, well within the spectral response of standard silicon focal plane array bi-dimensional sensors, commonly used in charge-coupled device (CCD) or complementary metal-oxide-semiconductor (CMOS) video cameras, and of most image intensifiers. The use of ASE illumination benefits from a noticeable increase in the field of view (FOV) that can be upconverted with regard to using coherent laser illumination. The upconverted power allows us to capture real-time video in a standard nonintensified CCD camera.

National Aeronautics and Space Administration (NASA)/American Society of Engineering Education (ASEE) Summer Faculty Fellowship Program - 2000

Science.gov (United States)

Bannerot, Richard B. (Editor); Sickorez, Donn G. (Editor)

2003-01-01

The 2000 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began in 1965 at JSC and 1964 nationally, are to (1) further the professional knowledge of qualified engineering and science faculty, (2) stimulate an exchange of ideas between participants and NASA, (3) enrich and refresh the research and teaching activities of participants' institutions, and (4) contribute to the research objectives of the NASA Centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project commensurate with her/his interests and background, and worked in collabroation with a NASA/JSC colleague. This document is a compilation of the final reports on the research projects done by the faculty fellows during the summer of 2000.

Candidíase em pacientes aidéticos

Directory of Open Access Journals (Sweden)

C.E.O.P. Campos

1992-09-01

Full Text Available Trinta e cinco aidéticos entre 19 e 55 anos admitidos e tratados de candidíase no Hospital Emílio Ribas, SP, com ELISA positivo para HIV e confirmado pelo Western Blot. Tuberculose em 9 sendo 2 com pericardite; neurotoxoplasmose em 6; neurocriptococose em 5; herpes labial em 4; pneumocistose em 3 e sarcoma de Kaposi em 2, achavam-se associadas. A concentração inibitória mínima 50% (MIC 50% para os azoles foi: ketoconazol= 2,2 µg/ml; itraconazol- 21,0 µg/ml; fluconazol = 19,0 µg/ml. O MIC 50% para ospolienos: nistatina- 50,0 µg/ml; anfotericina B= 0,12 µg/ml e para 5 fluorcitosina= 1,6 µg/ml nas 35 amostras de Candida isoladas. Testes não paramétricos de Siegel revelaram significante identificação (80% das Candida albicans na candidíase, e que a dose de AMB não modificou o número de óbitos, precoce e tardio, ocorridos nesses aidéticos. O uso prévio dos azoles e da nistatina explicaria, talvez, o elevado MIC 50% observado nas amostras de Candida isoladas.A total of 35 in patients admitted at Emilio Ribas Hospital - São Paulo, Brazil, with digestive candidiasis and AIDS clinical diagnostic were evaluated 10 month later, being 29 male and 6 female; white outnumbering black with age ranged from 30 to 50 years old. Agar Sabouraud culture and tube germinative tests identified 28 (80% Candida albicans out 35 strains. Minimum inhibitory concentration (MIC 50% was against azoles (ketoconazole= 2.2 µg/ml; itraconazole = 21.0 µg/ml and fluconazole- 19.0 µg/ml; polyenes (ny statine - 50.0 µg/ml and amphotericin B= 0.12 µg/ml and 5 fluorcytosine= 1.6µg/ml. Siegeltests showed significant Candida albicans proportions in strains isolated from 35 AIDS patients. There was no significant relation between AMB dosis and early or late death. Conclusions: candidiasis in AIDS patients showed high MIC 50% to azoles and nystatine and significant Candida albicans proportion in all strains isolated from AIDS patients. Previous amphotericin B

KETIDAKSEIMBANGAN HAK DAN KEWAJIBAN ANTARA INVESTOR ASING DENGAN PEKERJA INDONESIA DALAM PENGATURAN PENANAMAN MODAL DAN KETENAGAKERJAAN

Directory of Open Access Journals (Sweden)

Mrs. Sulistyowati

2015-10-01

Full Text Available This research purports to identify and find the form of imparity on the rights and obligations of the foreign investors and Indonesian workers in Indonesian regulations of investment law. The imparity is shown in: (idiscrepancies in minimum wage among employee working in foreign investment and domestic investment;(ii rights and obligations; as well as (iii legal culture which perceives Indonesian employee as one ofthe production factors. Such imparity, however, are not without purpose. It is aimed to complete verticalharmonization to avoid overlapping regulations. Nonetheless, the author finds this imparity still bringmore favour to the foreign investors. Penelitian ini ditujukan untuk mengidentifikasi dan menemukan bentuk-bentuk ketidakseimbangan hak dan kewajiban antara penanam modal asing dan pekerja Indonesia dalam peraturan perundang-undanganmengenai penanaman modal. Ketidakseimbangan tampak pada: (i upah minimum yang sama terhadappekerja Indonesia baik yang bekerja di PMA maupun PMDN; (ii hak dan kewajiban; serta (iii budayahukum yang menganggap pekerja Indonesia sebagai salah satu faktor produksi yang sama halnya denganfaktor produksi lainnya. Ketidakseimbangan ini bukanlah tanpa tujuan. Ketidakseimbangan yang adaditujukan untuk menciptakan harmonisasi vertikal dalam rangka menghindari kebijakan yang tumpangtindih. Hanya saja, penulis berpendapat bahwa ketidakseimbangan ini masih lebih menguntungkanpenanam modal asing.

Perfil clínico-epidemiológico da hanseníase em menores de 15 anos no município de Juazeiro-BA

Directory of Open Access Journals (Sweden)

Igara Cavalcanti Feitosa Luna

2013-06-01

Full Text Available Objetivo: Descrever o perfil epidemiológico e clínico dos casos novos de hanseníase em menores de 15 anos notificados à Secretaria Municipal de Saúde (SMS de Juazeiro-BA, no período de 2001 a 2010. Métodos: Trata-se de um estudo quantitativo, de natureza exploratória e descritiva, realizado a partir da análise dos dados contidos no Sistema de Informação de Agravos de Notificação (SINAN municipal. Resultados: Os resultados mostraram que145 (7,94% casos novos de hanseníase ocorreram em menores de 15 anos. Verificaram-se taxas de detecção altas para essa faixa etária, com predominância no sexo feminino (n=81; 55,86% e maior acometimento na faixa etária entre 10 e 14 anos (n=85; 58,62%. As formas paucibacilares (n=107; 74,48% da doença predominaram sobre as formas multibacilares (n=37; 25,52%, sendo a forma clínica tuberculoide (n=80; 55,17% a mais prevalente. As incapacidades atingiram 18 (12,41% dos pacientes avaliados no diagnóstico e 15 (10,34% na alta. Uma grande parte de casos (n=58; 40,07% deixou de ser avaliada ou foi ignorada. Conclusão: O perfil epidemiológico e clínico da ocorrência de casos novos de hanseníase no município de Juazeiro-BA evidenciou que os coeficientes de detecção geral de hanseníase e em menores de 15 anos se mantiveram em nível hiperendêmico no período avaliado.

Hanseníase e vulnerabilidade social: uma análise do perfil socioeconômico de usuários em tratamento irregular

Directory of Open Access Journals (Sweden)

Viviane Aparecida Siqueira Lopes

Full Text Available Este artigo analisa a determinação social da hanseníase, a partir do reconhecimento da vulnerabilidade social dos usuários em tratamento irregular, no Programa de Controle da Hanseníase do município de Campos dos Goytacazes (RJ. Para isso, apresenta uma pesquisa documental, com base nas Fichas de Cadastro Social dos usuários mencionados, destacando aspectos como trabalho, renda, formação familiar e acesso a políticas públicas. Seus resultados registram significativa presença de trabalho precarizado associado a baixos níveis de renda e de escolaridade, sendo a maioria considerada pobre ou indigente (51,5% e não usuária de benefícios assistenciais (66,7%.

Hanseníase: a realidade do ser adolescente Lepra: la realidad para el adolescente Leprosy: the reality for the adolescent

Directory of Open Access Journals (Sweden)

Keila Maria de Azevedo Ponte

2005-06-01

Full Text Available A hanseníase é uma doença contagiosa, estigmatizante, de grande potencial incapacitante, e os adolescentes por estarem numa fase de mudanças e de adaptação, esta doença pode interferir na construção de sua vida. O estudo objetiva caracterizar os adolescentes portadores de hanseníase segundo aspectos sócio-demograficos; realizar análise epidemiológico-operacional da hanseníase; verificar o conhecimento dos adolescentes sobre a hanseníase e as reações manifestadas pelos mesmos após sua descoberta; Identificar as mudanças ocorridas após a doença na vida do adolescente e as dificuldades vivenciadas pelo mesmo após a da doença. Trata-se de uma pesquisa exploratória e descritiva, constituída de 31 adolescentes portadores de hanseníase, assistido pela Estratégia Saúde da Família no Município de Sobral- Ceará. Os resultados sinalizam a necessidade de uma assistência integral e continuada ao adolescente portador de hanseníase, evitando que essa doença provoque mudanças significativas em sua vida, dificultando na construção de sua nova identidade.La lepra es una enfermedad contagiosa, de un gran potencial incapacitante y los adolescentes por estaren viviendo en una fase de cambios e adaptación esta enfermedad puede interferir en la construcción de sus vidas. Esta investigación apunta caracterizar los adolescentes portadores de lepra según aspectos sociales-demográficos; hacer un análisis epidémico-operacional de la enfermedad lepra; verificar el conocimiento de los adolescentes sobre la lepra y las relaciones manifestadas por los mismos después de su descubierta; identificar los cambios ocurridos en la vida del adolescente después de la descubierta de la enfermedad. Tratase de una investigación exploratoria y descriptiva donde participarón 31 adolescentes portadores de lepra ayudados por la Estrategia Salud de la Familia en el municipio de Sobral - Ceará. Los resultados señalan la necesidad de una

Ensaio terapêutico com «mebendazole suspensão» nas helmintíases intestinais em crianças

Directory of Open Access Journals (Sweden)

Donald Huggins

1975-06-01

Full Text Available O Autor medicou 24 crianças portadoras de poliverminoses, com idades entre 8 a 14 anos, todas do sexo feminino, com Mebendazole (suspensão, na dose de 5 ml (100 mg duas vezes por dia e durante três dias consecutives. O diagnóstico e o controle de cura parasitológica foram realizados pelas técnicas de Lutz, Willis, Baerman-Moraes e Graham, antes e no 7.°, 14.° e 21.° dias após o tratamento para as três primeiras, enquanto a última foi executada durante sete dias consecutivos a partir do sétimo dia de encerrada a terapêutica. Verificou cura parasitológica em 100% dos casos para ascariase e enterobiase, 69,2% para tricocefalíase, 36,36% para ancilostomíase e 0% para estrongiloidiase. Nenhuma manifestação colateral foi relatada pelos doentes.

DR (a-Se) versus CR (DLR) - is an improvement of the accuracy possible? A retrospective histologic analysis (n=100)

International Nuclear Information System (INIS)

Schulz-Wendtland, R.; Lell, M.; Wenkel, E.; Boehner, C.; Dassel, M.S.; Bautz, W.

2007-01-01

Purpose: A retrospective clinical-histological study to determine the diagnostic accuracy using high-resolution digital phosphor storage plates (CR) (hardcopy) and full-field digital mammography (DR) (hardcopy) for microcalcifications and focal lesions (BI-RADS category 4 or 5) (n=100). Materials and Methods: From 01/2004 to 06/2004, 100 patients underwent digital storage plate mammography (CR) and, after diagnosis and preoperative wire localization, full-field digital mammography (a-Se) (DR) with the same exposure parameters. Five investigators retrospectively determined the diagnosis after the operation from randomly distributed mediolateral views (hardcopy reading). These results were correlated with the final histology. Results: The accuracy of digital storage plate mammography (CR) and full-field digital mammography (DR) was 73% and 76% for all findings (n=100), 74%, 78% for microcalcifications (n=50) and 72%, 74% for focal lesions (n=50). The overall results showed no difference. Conclusion: Our findings indicate equivalence of high-resolution digital phosphor storage plate mammography (CR) and full-field digital mammography (a-Se) (DR). (orig.)

Estudo da microcirculação na hanseníase virchowiana com o uso da microscopia de luz ortogonal polarizada e com laser-doppler fluxometria

OpenAIRE

Curt Mafra Treu

2010-01-01

A hanseníase é uma doença infecciosa com características únicas, dentre elas o fato de atingir intensamente a inervação da pele e seus anexos. Entremeando estes anexos, está a microcirculação cutânea, que a principio também tem sua inervação comprometida. Vários artigos apontam para alterações de disautonomia microcirculatória, citando como exemplo as alterações no reflexo vasomotor. O presente estudo se propõe a avaliar a microcirculação cutânea na hanseníase virchowiana, tanto em sua morfol...

Mensuração do ângulo articular do cotovelo no teste de tensão neural em indivíduos com hanseníase

OpenAIRE

Scheibe,Débora; Oliveira,Jaqueline Francieli Pacheco de; Gonçalves,Sibelly Blum; Gomes,Anna Raquel Silveira; Macedo,Ana Carolina Brandt de

2012-01-01

A hanseníase é uma patologia crônica e granulomatosa, que atinge a pele e o sistema nervoso periférico pela invasão no sistema imune do Mycobacterium leprae. O objetivo deste estudo foi mensurar o ângulo articular do cotovelo com a aplicação do teste de tensão neural do nervo ulnar em pacientes com hanseníase. Na aplicação do teste de tensão neural, foram utilizadas a goniometria e a fotometria para a mensuração do ângulo articular do cotovelo, sendo que para a realização da fotometria foi ut...

O papel da ictioterapia no tratamento da psoríase: relato de caso

OpenAIRE

Cabral, Helena; Carneiro, Joana

2014-01-01

Introdução: A psoríase é uma das dermatoses mais frequentes, afetando entre 1 a 3% da população portuguesa. Apresenta uma evolução crónica, com lesões que podem atingir grande parte da superfície corporal. Devido à frequente exuberância das lesões, a doença é muitas vezes percebida como estigmatizante pelo indivíduo que se sente envergonhado e rejeitado pelo outro. Pode apresentar impacto significativo nas relações sociais, na autoimagem e na autoestima. Atualmente, o tratamento consiste em r...

Crystallization kinetics of a-Se, part 4: thin films

Science.gov (United States)

Svoboda, Roman; Gutwirth, Jan; Málek, Jiří

2014-09-01

Differential scanning calorimetry was used to study the crystallization behaviour of selenium thin films in dependence on film thickness and deposition rate. In the current work, which is the fourth in a sequence of articles dealing with crystallization kinetics of a-Se, the non-isothermal crystallization kinetics was described in terms of the Johnson-Mehl-Avrami nucleation-growth model. Two-dimensional crystallite growth, consistent with the idea of sterically restricted crystallization in a thin layer, was confirmed for all data. It was found that neither the film thickness (tested within the 100-2350 nm range) nor the deposition rate appears to have any significant influence on the crystallization kinetics. However, the higher amount of intrinsic defects possibly produced by a higher deposition rate seems to accelerate the crystallization, shifting it towards lower temperatures. Very good correlation between the results obtained for thin films and those for fine powders was found. Based on the obtained results, interpretations of relevant literature data were made.

Maternidade e hanseníase: as vivências de separação devido ao isolamento compulsório Being a mother with leprosy: the experiences of separation due to compulsory isolation

Directory of Open Access Journals (Sweden)

Suellen Santos Lima de Almeida

2012-08-01

Full Text Available As mulheres portadoras de hanseníase, durante grande parte do século XX, não puderam exercer a maternidade devido à política de isolamento compulsório dos doentes adotada para controlar a doença. Os filhos ao nascerem eram levados para os preventórios e o contato com estes era realizado pelo olhar. Visando compreender a experiência da maternidade no hospital colônia foi realizada pesquisa narrativa com três mães que viveram o período de internação compulsória. Os discursos revelam dois momentos distintos da vivência de maternidade: a separação dos filhos com sua posterior volta para casa e a adoção de crianças para realizar a maternidade. Considera-se que a adoção promoveu o encontro com o sentido da existência que havia sido rompido e possibilitou a experiência de ser-mãe.In the twentieth century, women with leprosy could not carry on their maternity because of the statement of compulsory isolation of patients, adopted to control the disease. Their children were taken at birth to prevention centers and the contact of mothers with their babies was only visual. In order to understand the experience of maternity in the leprosaria it was carried out an investigated narrative research with three mothers who lived through the period of compulsory internment. The speeches reveal two distinct moments in the experience of motherhood: the separation of the children with their subsequent return to home and the adoption of other children to achieve motherhood. It is considered that the adoption has promoted the meeting with the meaning of existence that had been broken and allowed the experience of being a parent.

Ulceração das placas psoriáticas - efeito cutâneo adverso do metotrexato em altas doses no tratamento da psoríase: relato de três casos

Directory of Open Access Journals (Sweden)

Ataíde Deborah Skusa de Torre

2003-01-01

Full Text Available Os autores relatam três casos de pacientes portadores de psoríase que utilizaram inadvertidamente doses elevadas de metotrexato e apresentaram ulceração das lesões cutâneas de psoríase. Os efeitos adversos cutâneos do metotrexato são raros, algumas vezes dose-dependentes, outras idiossincrásicos ou relacionados com alteração de metabolização da droga, ou, ainda, interações medicamentosas

Psoríase em paciente HIV positivo

Directory of Open Access Journals (Sweden)

Mario León Silva-Vergara

1996-12-01

Full Text Available Dois pacientes com síndrome de imunodeficiência adquirida (SIDA desenvolveram psoríase, um com quadro mais grave e outro com apresentação mais benigna, sendo tratados com zidovudine na dose oral de 200mg a cada oito horas. No primeiro caso, a resposta terapêutica foi completa e, após nove meses em esquema de manutenção, o paciente se apresenta sem nenhuma lesão. No segundo, a despeito de resposta evidente, após seis meses de tratamento, o paciente ainda apresenta descamação furfurãcea a nível dos membros inferiores, mesmo em uso de medicação.Two patients with the acquired immunodeficiency syndrome (AIDS developed psoriasis, one of them presenting the more severe form and the other one the milder form of the disease, were treated with zidovudine per oral via, 200mg 3 times a day. In the first case the therapeutical response was complete. No lesion was verified in the patient after 9 months under maintenance schedule. In the second case, despite the response being clear, after 6 months of treatment, the patient still presented furfuraceous scalings at limbs even under the medication schedule.

A ação educativa do enfermeiro educador na estratégia Saúde da Família ao portador de hanseníase

OpenAIRE

Alberici, Priscila de Souza; UNIABEU; Jóia, Thalita; UNIABEU; Moreira, Leandro Arantes; UNIABEU

2011-01-01

Introdução: O enfermeiro na Estratégia Saúde da Família como educador, objetivando a promoção da saúde e a prevenção da doença. Problemática: Seria a falta de conhecimento/comprometimento do profissional de saúde em relação à gravidade da doença o motivo pelo qual o Brasil não erradicar a hanseníase? Objetivo: Refletir sobre a ação educativa do enfermeiro na ESF ao portador de hanseníase. Metodologia: Estudo descritivo e exploratório, método de abordagem qualitativa. A revisão bibliográfica s...

Avaliação da frequência do polimorfismo nos genes que codificam a lecitina ligadora da manose (MBL) e o antagonista do receptor da interleucina-1 (IL1-Ra) em mulheres portadoras de candidíase vulvovaginal recorrente

OpenAIRE

Maria Dulce Caoro Horie Wojitani

2011-01-01

A candidíase vulvovaginal corresponde a uma das mais frequentes infecções do trato reprodutivo. Estima-se que 75% das mulheres na idade reprodutiva experimentarão pelo menos um episódio de candidíase vulvovaginal durante suas vidas, a maioria evoluirá com episódios infrequentes, entretanto, 5% sofrerão recorrência, ou seja, quatro ou mais episódios de candidíase vulvovaginal comprovadas clínica e laboratorialmente no período de 1ano. Os mecanismos pelos quais as recorrências ocorrem ainda são...

ASE extraction method for simultaneous carbon and nitrogen stable isotope analysis in soft tissues of aquatic organisms

International Nuclear Information System (INIS)

Bodin, Nathalie; Budzinski, Helene; Le Menach, Karyn; Tapie, Nathalie

2009-01-01

Since lipids are depleted in 13 C relative to proteins and carbohydrates, variations in lipid composition among species and within individuals significantly influence δ 13 C and may result in misleading ecological interpretations. Whereas lipid extraction before IRMS analysis constitutes a way of stable isotope result lipid-normalisation, such a procedure was given up because of the un-controlled effects of the methods used (i.e., 'Bligh and Dyer', Soxhlet, etc.) on δ 15 N. The aim of this work was to develop a simple, rapid and efficient lipid extraction method allowing for simultaneous C and N stable isotope analysis in the biological soft tissues of aquatic organisms. The goal was to be free from the lipid influence on δ 13 C values without interfering with δ 15 N values. For that purpose, the modern automated pressurized liquid extraction technique ASE (accelerated solvent extraction) was selected. Eel muscles representative of a broad range of fat contents were extracted via ASE by using different semi-polar solvents (100% dichloromethane and 80% n-hexane/20% acetone) and by operating at different temperature (ambient temperature and 100 deg. C) and pressure (750 and 1900 psi) conditions. The results were discussed in terms of lipid extraction efficiency as well as δ 13 C and δ 15 N variability.

Sorologia da hanseníase utilizando PGL-I: revisão sistemática

OpenAIRE

Moura,Rodrigo Scaliante de; Calado,Karla Lucena; Oliveira,Maria Leide W.; Bührer-Sékula,Samira

2008-01-01

A sorologia utilizando o antígeno espécie-específico do Mycobacterium leprae, PGL-I, pode ser um marcador de carga bacteriana em pacientes com hanseníase. Estudos identificaram potencial de uso da sorologia na classificação de pacientes para fins de tratamento, monitoramento de terapia, risco de recidiva e na seleção dos contatos com maior risco de adoecer. Foi realizada uma revisão sistemática e 26 artigos foram incluídos na análise comparativa. Avaliamos os resultados do uso da sorologia PG...

A haplotype of polymorphisms in ASE-1, RAI and ERCC1 and the effects of tobacco smoking and alcohol consumption on risk of colorectal cancer: a Danish prospective case-cohort study

DEFF Research Database (Denmark)

Hansen, Rikke D; Sørensen, Mette; Tjønneland, Anne

2008-01-01

BACKGROUND: Single nucleotide polymorphisms (SNPs) are the most frequent type of genetic variation in the human genome, and are of interest for the study of susceptibility to and protection from diseases. The haplotype at chromosome 19q13.2-3 encompassing the three SNPs ASE-1 G-21A, RAI IVS1 A4364G...... and ERCC1 Asn118Asn have been associated with risk of breast cancer and lung cancer. Haplotype carriers are defined as the homozygous carriers of RAI IVS1 A4364GA, ERCC1 Asn118AsnT and ASE-1 G-21AG. We aimed to evaluate whether the three polymorphisms and the haplotype are associated to risk of colorectal...... of colorectal cancer were found. No statistically significant interactions between the genotypes and the lifestyle exposures smoking or alcohol consumption were observed. CONCLUSION: Our results suggest that the ASE-1 G-21A, RAI IVS1 A4364G and ERCC1 Asn118Asn polymorphisms and the previously identified...

Estratégias de coping e níveis de estresse em pacientes portadores de psoríase Coping strategies and stress levels in patients with psoriasis

Directory of Open Access Journals (Sweden)

Juliana Dors Tigre da Silva

2006-03-01

Full Text Available FUNDAMENTOS: Pesquisas atuais estão direcionando seu foco aos aspectos psicossociais envolvidos nas dermatoses crônicas. Esses fatores podem contribuir para a exacerbação da psoríase entre 40 e 80% dos casos, causando grande impacto na qualidade de vida desses pacientes. OBJETIVOS: Verificar estratégias de coping e identificar níveis de estresse do portador de psoríase. MÉTODOS: Estudo transversal, com amostra de 115 pacientes, divididos em 61 com psoríase e 54 do grupo controle com dermatoses crônicas. Instrumentos: Inventário de Estratégias de coping e Inventário de Sintomas de Estresse para Adultos de Lipp. RESULTADOS: Destacam-se as estratégias de coping autocontrole (p=0,027 e fuga e esquiva (p=0,014 utilizadas mais pelo grupo com psoríase e níveis de estresse altos para os dois grupos (p=0,838. CONCLUSÃO: Pacientes com psoríase utilizam estratégias de coping específicas para o enfrentamento da doença de pele, quando comparados a outros pacientes com doenças crônicas de pele demonstrando relevante nível de estresse. A integração dos resultados possibilita o entendimento do estado específico que portadores de psoríase vivenciam e que denuncia a premência de intervenções mais abrangentes que envolvam também as dimensões psíquica e social.ABSTRACT BACKGROUND: Psychosocial aspects are the current focus of research on chronic dermatoses. These aspects may contribute to exacerbation of psoriasis in 40 to 80% of cases, thus having great impact on patients’ quality of life. OBJECTIVES: This study aims to assess coping strategies and to identify stress levels of patients with psoriasis. METHODS: This is a cross-sectional study of a sample of 115 patients, which included 61 patients with psoriasis and 54 patients with other chronic dermatoses as controls. Instruments: The Ways of Coping Questionnaire and the Lipp Stress Symptoms Inventory for Adults. RESULTS: The coping strategies of self-control (p=0.027 and

Acervo de materiais educativos sobre hanseníase: um dispositivo da memória e das práticas comunicativas

Directory of Open Access Journals (Sweden)

Adriana Kelly-Santos

Full Text Available Neste trabalho objetiva-se: descrever o processo de elaboração de um banco de 276 materiais sobre hanseníase produzidos por instituições públicas e não-governamentais, entre 1972-2008; analisar o tipo, o público e os objetivos. O banco foi elaborado numa base eletrônica de dados, contendo a análise descritiva e temática e um link para o documento completo dos materiais. Os materiais destinam-se ao público em geral (75%, profissionais de saúde (12%, público infanto-juvenil (6%, portadores de hanseníase (3% e outros (4%. Predominam panfletos (26%, folhetos (24%, cartazes (23%, seguidos de cartilhas (15%, álbuns seriados (3% e outros (9%. Objetivam aumentar a autossuspeição, detecção de casos e divulgar os serviços de saúde. Predomina o discurso biomédico, a linguagem técnica-prescritiva e as relações hierarquizadas entre enunciador-destinatário.

Acervo de materiais educativos sobre hanseníase: um dispositivo da memória e das práticas comunicativas

Directory of Open Access Journals (Sweden)

Adriana Kelly-Santos

2010-03-01

Full Text Available Neste trabalho objetiva-se: descrever o processo de elaboração de um banco de 276 materiais sobre hanseníase produzidos por instituições públicas e não-governamentais, entre 1972-2008; analisar o tipo, o público e os objetivos. O banco foi elaborado numa base eletrônica de dados, contendo a análise descritiva e temática e um link para o documento completo dos materiais. Os materiais destinam-se ao público em geral (75%, profissionais de saúde (12%, público infanto-juvenil (6%, portadores de hanseníase (3% e outros (4%. Predominam panfletos (26%, folhetos (24%, cartazes (23%, seguidos de cartilhas (15%, álbuns seriados (3% e outros (9%. Objetivam aumentar a autossuspeição, detecção de casos e divulgar os serviços de saúde. Predomina o discurso biomédico, a linguagem técnica-prescritiva e as relações hierarquizadas entre enunciador-destinatário.

Necrose de canto medial associado a hanseníase virchowiana: relato de caso

Directory of Open Access Journals (Sweden)

Leiser Franco

2010-12-01

Full Text Available O caso em relato aborda uma etiologia rara para necrose de canto medial da pálpebra com comprometimento do sistema canalicular em uma paciente em tratamento para hanseníase virchowiana. O exame histopatológico da lesão necrótica evidenciou reação inflamatória granulomatosa com acúmulo de histiócitos e presença de bacilos álcool-ácido resistentes. Após tratamento medicamentoso a paciente apresentou uma evolução favorável com recuperação espontânea da arquitetura do canto medial, porém com destruição total do sistema canalicular.

Colelitíase no paciente pediátrico portador de doença falciforme Cholelithiasis in children with sickle cell disease

Directory of Open Access Journals (Sweden)

Ana Paula S. Gumiero

2007-12-01

Full Text Available OBJETIVO: Considerando a alta freqüência da colelitíase no paciente pediátrico com doença falciforme e a controvérsia na literatura sobre a abordagem da condição, o presente texto objetiva revisar a literatura disponível. FONTE DE DADOS: Revisão dos estudos sobre colelitíase no paciente falciforme, publicados no período entre 1980 e 2007, em língua inglesa e portuguesa, envolvendo pacientes na faixa etária de zero a 18 anos e utilizando os bancos de dados Medline e Lilacs. SÍNTESE DOS DADOS: A colelitíase é a complicação digestiva mais comum no paciente falciforme e sua incidência aumenta com a faixa etária. Os mecanismos fisiopatológicos são conhecidos, assim como os métodos diagnósticos. A conduta terapêutica consensual na colelitíase sintomática é a colecistectomia, preferencialmente por via laparoscópica. Nos casos assintomáticos, a maioria dos autores recomenda a conduta cirúrgica, para evitar complicações, confusão no diagnóstico diferencial de dor abdominal futura e menor risco cirúrgico. Contudo, não existe consenso na literatura, havendo base para a adoção de conduta expectante. CONCLUSÕES: A doença falciforme tem grandes variações em sua apresentação clinica, história natural e gravidade da hemólise. Algumas populações podem apresentar menor freqüência de colelitíase e menor número de pacientes sintomáticos, possivelmente em razão de variações de haplótipos, fatores ambientais e diferentes manejos clínicos. Ainda não existem dados suficientes na literatura ou estudos randomizados e controlados que possibilitem definir o momento ideal para a colecistectomia no paciente falciforme com litíase assintomática. Dessa maneira, dependendo de características individuais e da população, podem ser aceitos o seguimento clínico ou a indicação precoce de colecistectomia.OBJECTIVE: Given the high frequency of cholelithiasis in children with sickle cell disease and the controversies

Associação timoma e estrongiloidíase intestinal grave Thymoma and severe intestinal strongyloidiasis association

OpenAIRE

Pérsio Godoy; Christian Marcellus Camargos Campos; Guilherme Costa; Lúcia Porto Fonseca de Castro

1998-01-01

Os autores relatam o caso de um homem de 59 anos de idade com timoma e estrongiloidíase intestinal grave. São revistos aspectos da resposta imunitária relacionados ao tumor e, possivelmente, implicados no desenvolvimento da hiperinfecção pelo Strongyloides stercoralis.A 59-years-old man with thymoma and severe intestinal strongyloidiasis is reported. The authors pointed out a possible influence of immunological response related with thymoma in the development of hyperinfection by Strongyloide...

INVESTASI ASING LANGSUNG DI INDONESIA DAN FAKTOR YANG MEMPENGARUHINYA

Directory of Open Access Journals (Sweden)

Sarwedi Sarwedi

2002-01-01

Full Text Available There have been many studies on the determinants of foreign direct investment or FDI. Howerer, they are different both in the methodologies and the results. Although the influence of many factors that are assumed to be fixed (ceteris paribus are very strong-such as macroeconomic variables GDP, economic growth and inflation, they left various conclusions and debates. FDI can be one of the important sources of capital in developing countries, and contribute, the national development by transfer of asset, management, and technology to stimulate the economy of the country. The research model uses some domestic characteristics, that will be combined in a short and long run period by using OLS. The Error Correction Model (ECM and Granger Causality Test, are applied to the determine the factors that influence the foreign direct investment (FDI in Indonesia within 1978 -2001. The result shows that economic variables such as GDP, growth, wage and export have positive effect to FDI. While non-economic variables such as Political Stability (SP shows a negative effect. This conclusion is in a harmony with the empirical study done by Schneider and Frey (1986 that politicaal stability has a negative relations ship with FDI. Abstract in Bahasa Indonesia : Saat ini sudah terdapat banyak studi tentang faktor-faktor yang mempengaruhi investasi asing langsung (foreign direct investment atau FDI. Namun demikian metodologi yang digunakan dan hasil studi masih sangat bervariasi. Meskipun faktor-faktor yang dianggap tetap (ceteris paribus pengaruhnya sangat kuat, seperti variabel makro ekonomi yaitu pendapatan nasional, pertumbuhan ekonomi dan inflasi, tetapi masih juga terdapat kesimpulan yang berbeda dan menimbulkan berbagai perdebatan. FDI menjadi salah satu sumber pembiayaan (modal yang penting bagi negara berkembang, dan mampu memberikan kontribusi yang cukup besar bagi pembangunan melalui transfer asset dan manajemen, serta transfer teknologi guna mendorong

Espaços vigiados: um estudo do isolamento compulsório dos portadores de hanseníase no asilo-colônia Santo Ângelo (1890/1960)

OpenAIRE

Vânia Regina Miranda Postigo

2008-01-01

Esta pesquisa procura analisar o isolamento compulsório dos portadores de hanseníase no Asilo-colônia Santo Ângelo localizado em Mogi das Cruzes, São Paulo, tendo como ponto de partida os anos 1890, época em que as primeiras medidas de controle da hanseníase e de outras doenças foram adotadas pelo poder público paulista. A criação de várias instituições e do primeiro código sanitário marcaram o início da construção de uma forte estrutura para o desenvolvimento de políticas públicas de saúde n...

Perfil fenotípico, diferenciação molecular, produção de enzimas e sensibilidade aos antifúngicos de amostras de leveduras isoladas em três grupos amostrais: mulheres assintomáticas, com candidíase vulvovaginal primária e recorrente.

OpenAIRE

Debora Moreira

2012-01-01

O presente estudo foi realizado com 258 mulheres, com e sem sintomas de candidíase vulvovaginal, atendidas no Centro de Saúde Geraldo Paula Souza, da Faculdade de Saúde Pública da USP. Leveduras foram isoladas em 162 mulheres, sendo que 34% foram de mulheres assintomáticas, 34% com sintomas de candidíase vulvovaginal primária (CVV) e 32% com candidíase vulvovaginal recorrente (CVVR). As espécies mais isoladas foram C . albicans, C. parapsilosis, C. glabrata e C. tropicalis. Espécies como C. m...

Estudo da microcirculação na hanseníase usando videomicroscopia (Microscan) e laser-Doppler associado à iontoforese: um modelo de disautonomia vascular por denervação

OpenAIRE

Livia Cristina de Melo Pino Machado

2013-01-01

A hanseníase é uma doença infecciosa com características únicas, dentre elas o fato de atingir intensamente a inervação da pele e seus anexos. Entremeando estes anexos, está a microcirculação cutânea, que a principio também tem sua inervação comprometida. Vários artigos apontam para alterações de disautonomiamicrocirculatória. O presente estudo se propõe a avaliar a microcirculação cutânea na hanseníase tuberculóide. Utilizamos a videomicroscopia de campo escuro (Microscan), a análise de Four...

Candidíase oral como marcador de prognóstico em pacientes portadores do HIV Oral candidiasis as prognostic marker of HIV-infected patients

Directory of Open Access Journals (Sweden)

Valdinês Gonçalves dos Santos Cavassani

2002-10-01

Full Text Available Introdução: A candidíase oral é uma das doenças oportunistas mais fortemente associadas à infecção pelo Vírus da Imunodeficiência Humana (HIV. Vários relatos epidemiológicos enfatizam a prevalência da candidíase em pacientes HIV positivos e ressaltam a sua importância como marcador da progressão da doença e preditivo para o aumento da imunodepressão. Objetivo: Verificar as alterações estomatológicas em pacientes portadores do HIV tratados no Hospital Heliópolis - São Paulo, Brasil e comparar com a literatura. Forma de Estudo: Retrospectivo clínico não-randomizado. Casuística e Método: Foram analisados 431 pacientes HIV+/AIDS (298 homens e 133 mulheres no Hospital Heliópolis - São Paulo, Brasil, no período de 1995 a 2001. Resultados: A idade média mais comum foi dos 31 aos 40 anos (47,10%; a via de contágio mais comum foi a sexual (71,26%. Dentre as patologias, a candidíase apresentou maior prevalência (29,69%, seguida pela gengivite (16,70% e queilite angular (14,15%. Conclusões: Concluímos que o exame oral e o diagnóstico precoce da candidíase em pacientes infectados pelo HIV são fundamentais para o tratamento imediato, melhorando a sua qualidade de vida, uma vez que a candidíase é uma lesão bucal muito freqüente nesta população.Introduction: Strongly associated with Human Immunodeficiency Virus(HIV, oral candidiasis is one of the most common opportunistic infections. Various epedemiological data now emphasize the prevalence of candidiasis in HIV-infected patients and its importance as useful marker for disease progression and prediction for increasing immunossupression. Aim: The purposes of this study were to assess a group of HIV positive patients treated in Heliopólis Hospital, Hosphel - São Paulo, Brazil and refer the oral changing related to the syndrom and compared the results to the literature. Study design: Retrospective clinical no randomized. Casuistic and method: Four hundred thirty one

Taeniasis and cysticercosis prevalence in a small village from Northeastern Brazil Prevalência de teníase e sorologia positiva para cisticercose em Mulungu do Morro, Bahia

Directory of Open Access Journals (Sweden)

Irenio Gomes

2002-06-01

Full Text Available Although not considered as an endemic region, the Northeast of Brazil has the necessary conditions for the development of taeniasis-cysticercosis complex. In a previous paper, we demonstrated that Mulungu do Morro municipality, in the State of Bahia, has a high seroprevalence to cysticercosis in epileptic patients. OBJECTIVE: to determine the prevalence of taeniasis and positive cysticercosis serology in the population of Mulungu do Morro. METHOD: blood and stool samples were collected from a random sampling of the population, by family. The identification of antibodies against T. solium cysticerci was made by EITB and T. solium antigens were identified using a polyclonal antibody-capture ELISA. RESULTS: the cysticercosis seroprevalence was 1.6% (C.I. = 0.8 to 2.8% and the taeniasis prevalence 4.5% (C.I. = 3.0 to 6.5%. Seropositivity to cysticercosis was higher among those who lived in a house of a person testing positive for coproantigen, p=0.017. CONCLUSION: our results demonstrate that the taeniasis-cysticercosis complex is endemic in Mulungu do Morro. We believe that all areas in the world with the same socio-economic and sanitary characteristics are likely to have high prevalence of this parasite.Embora alguns autores não a considerem uma região endêmica, existem no Nordeste do Brasil as condições necessárias para o desenvolvimento do complexo teníase/ cisticercose. Em uma publicação prévia demosntramos no município de Mulungu do Morro, Bahia, alta soroprevalência para cisticercose em pacientes epilépticos. OBJETIVO: determinar a prevalência de teníase e sorologia positiva para cisticercose na população de Mulungu do Morro. MÉTODO: foram coletadas amostras de sangue e fezes em 175 famílias definidas aleatoriamente. A identificação de anticorpos séricos anti-cisticerco foi feita através do método de EITB e a presença de teníase foi verificada através de ELISA de captura para identificação de antígenos do

Effect of ionizing radiation on catalytic properties of Ca2+-ATP-ase from sarcoplasmic reticulum of skeletal muscle

International Nuclear Information System (INIS)

Bagel', I.M.; Shafranovskaya, E.V.; Gorokh, G.A.; Markova, A.G.

1999-01-01

It was studied kinetic and thermodynamic characteristics of Ca 2+ -ATP-ase of rat skeletal muscle (membranes of sarcoplasmic reticulum) after irradiation in doses 0,5, 4,0 and 8,0 Gy. It was shown that external gamma-irradiation at different doses changed kinetic and thermodynamic characteristics of the enzyme of sarcoplasmic reticulum membranes of skeletal muscle. These alterations probably correlate with disbalance of hormonal regulation of intracellular calcium metabolism and changes in membrane structure and functions

Pure neural leprosy: steroids prevent neuropathy progression Corticosteróides previnem a neuropatia na hanseníase

Directory of Open Access Journals (Sweden)

Márcia R. Jardim

2007-12-01

Full Text Available Multidrug therapy (MDT, with rifampicin, dapsone, and clofazimine, treats leprosy infection but is insufficient in arresting or preventing the nerve damage that causes impairments and disabilities. This case-series study evaluates the benefits of the combined use of steroids and MDT in preventing nerve damage in patients with pure neural leprosy (PNL. In addition to MDT, 24 patients (88% male aged 20-79 years, median=41 received a daily morning dose of 60 mg prednisone (PDN that was gradually reduced by 10 mg during each of the following 5 months. PNL was clinically diagnosed and confirmed by nerve histopathology or PCR. A low prevalence (8.3% of reaction was observed after release from treatment. However, most of the clinical parameters showed significant improvement; and a reduction of nerve conduction block was observed in 42% of the patients. The administration of full-dose PDN improved the clinical and electrophysiological condition of the PNL patients, contributing to the prevention of further neurological damage.A poliquimioterapia (PQT, com rifampicina, dapsona, e clofazimina, trata a infecção na hanseníase, mas é insuficiente para interromper ou prevenir o comprometimento neurológico que causa as incapacidades e desabilidades, nesta enfermidade. Este estudo de série de casos avalia o benefício do uso combinado de prednisona e PQT na prevenção do dano neurológico em pacientes com a forma neural pura da hanseníase (FNP. Além do PQT, 24 pacientes (88% homens, com idade variando entre 20-79, mediana=41 receberam uma dose diária de 60 mg prednisona que foi reduzida gradualmente na dose de 10 mg durante cada um dos 5 meses subseqüentes. FNP foi diagnosticada clinicamente e confirmada através do estudo histopatológico ou PCR. Baixa prevalência de reação (8,3% foi observada apenas após o final do tratamento. A maioria dos parâmetros clínicos mostrou melhora significativa e redução do bloqueio de condução foi observada

Jejunal perforation caused by abdominal angiostrongyliasis Perfuração jejunal causada por angiostrongilíase abdominal

Directory of Open Access Journals (Sweden)

Jaques WAISBERG

1999-09-01

Full Text Available The authors describe a case of abdominal angiostrongyliasis in an adult patient presenting acute abdominal pain caused by jejunal perforation. The case was unusual, as this affliction habitually involves the terminal ileum, appendix, cecum or ascending colon. The disease is caused by the nematode Angiostrongylus costaricensis, whose definitive hosts are forest rodents while snails and slugs are its intermediate hosts. Infection in humans is accidental and occurs via the ingestion of snail or slug mucoid secretions found on vegetables, or by direct contact with the mucus. Abdominal angiostrongyliasis is clinically characterized by prolonged fever, anorexia, abdominal pain in the right-lower quadrant, and peripheral blood eosinophilia. Although usually of a benign nature, its course may evolve to more complicated forms such as intestinal obstruction or perforation likely to require a surgical approach. Currently, no efficient medication for the treatment of abdominal angiostrongyliasis is known to be available. In this study, the authors provide a review on the subject, considering its etiopathogeny, clinical picture, diagnosis and treatment.Os autores descrevem caso de angiostrongilíase abdominal em doente adulto que se manifestou como abdômen agudo devido à perfuração de alça jejunal, evento raro, uma vez que esta afecção geralmente envolve o íleo terminal, apêndice, ceco ou cólon ascendente. A doença é causada pelo nematódeo Angiostrongylus costaricensis cujos hospedeiros definitivos são roedores silvestres e os hospedeiros intermediários são caracóis e caramujos. A infecção em humanos é acidental e ocorre pela ingestão de secreção mucóide destes invertebrados presentes em vegetais ou por contato direto com o muco. A angiostrongilíase abdominal é clinicamente caracterizada pela presença de febre prolongada, anorexia, dor no quadrante inferior direito do abdômen e eosinofilia periférica. Embora a doença seja de

Abscesso cervical gigante provocado por sialolitíase de glândula submandibular

Directory of Open Access Journals (Sweden)

Fernanda Fruet

2016-10-01

Full Text Available Introdução: As infecções cervicais profundas apresentam alta mortalidade, apesar da eficácia da antibioticoterapia atual. Uma das principais complicações é a obstrução das vias aéreas superiores. A principal causa dessas infecções é de origem odontogênica e, raramente, a infecção das glândulas salivares. Objetivo: Apresentar um caso de abscesso cervical profundo, cuja etiologia rara está associada à sialolitíase com origem em glândula submandibular. Metodologia: O caso foi acompanhado no serviço de Cabeça e Pescoço do Conjunto Hospitalar de Sorocaba (CHS e sua descrição embasada na literatura. Relato de Caso: Paciente iniciou quadro de dor localizada em região submandibular posterior direita, acompanhada de disfagia e dispneia contínua. Procurou atendimento médico na cidade de origem, onde recebeu antibioticoterapia. Evoluiu com insuficiência respiratória, necessitando de transferência para o serviço de emergência do CHS aos cuidados da equipe de Cabeça e Pescoço. Ao exame físico, apresentava edema, abaulamento e hiperemia da lateral direita do pescoço. A Tomografia Computadorizada evidenciou abscesso em espaço retro-faríngeo com compressão da parede posterior da orofaringe e hipofaringe, além de glândula submandibular direita aumentada e imagem de cálculo. Foi realizada a traqueostomia e a resolução cirúrgica por meio da drenagem do abscesso através da incisão transversa em colar. Conclusão: O caso apresentado mostra um abscesso cervical profundo causado por etiologia incomum, a sialolitíase, cujo diagnóstico precoce, seguido do tratamento adequado, poderiam ter evitado a evolução grave do paciente. Neste caso, a drenagem cirúrgica precoce mostra sua importância na prevenção de insuficiência respiratória.

A ENFERMAGEM DE SAÚDE PÚBLICA NO CONTROLE DA HANSENÍASE. Análise das atividades realizadas

Directory of Open Access Journals (Sweden)

Elisete Silva Pedrazzani

Full Text Available A presentase um estudo com o objetivo de cotejar as atividades realizadas peto pessoal de enfermagem, com as preconizadas pelo Subprograma de Controle da Hanseníase, nos Centros de Saúde I do Departamento Regional de Saúde de Ribeirão Preto, da Secretaria da Saúde, do Estado de São Paulo. Destacam-se as atividades desenvolvidas pelos enfermeiros, sendo que os mesmos estão vinculados preponderantemente às funções administrativas e de assessoria.

Estudo piloto sobre alimentos que devem ser evitados nos portadores de psoríase Pilot study on which foods should be avoided by patients with psoriasis

Directory of Open Access Journals (Sweden)

Moira Festugato

2011-12-01

Full Text Available FUNDAMENTOS: Psoríase é uma doença inflamatória crônica, sistêmica, mediada por fatores imunológicos. Serão abordados os alimentos que atuam sobre estes fatores, contribuindo para a psoríase. Como doença sistêmica, que compartilha o mesmo substrato fisiopatológico com outras comorbidades, a dieta alimentar também leva à piora das comorbidades. OBJETIVO: Destacar um grupo de alimentos que pode atuar como um fator de manifestação e/ou agravo da psoríase e ao mesmo tempo viabilizar estratégias individuais para alimentos que devam ser introduzidos. MÉTODOS: 43 pacientes foram selecionados, com diversas formas de psoríase (exceto psoríase pustulosa e eritrodérmica, e responderam a um questionário sobre seus hábitos alimentares na primeira consulta, focando a atenção no consumo de café preto, chá preto, chocolate, mate, pimenta, defumados, carne de gado e realçador de sabor (glutamato monossódico. Na sequência, o paciente foi orientado a suspender bebidas com qualquer percentagem alcoólica e o tabagismo. RESULTADO: A carne de gado é o alimento mais consumido pelos pacientes seguida por: realçador de sabor (glutamato monossódico, que existe nos alimentos industrializados, mate e café preto, chocolate, defumados, pimenta e chá preto. 88,37% notaram diminuição das escamas e eritema, surtos mais brandos durante o ano e melhora da qualidade de vida; 11,63% (5 pacientes não notaram repercussões na pele. CONCLUSÃO: Foi observada ingestão dietética precária nos pacientes com psoríase. Além de uma orientação científica adequada, o paciente necessita de uma ação educativa frente aos seus hábitos alimentares para uma melhoria da qualidade de vida e como coadjuvante na terapia medicamentosa empregada.FUNDAMENT: Psoriasis is a chronic inflammatory systemic disease mediated by immune factors. We will explore the foods that act on these factors contributing to psoriasis. As a systemic disease, which shares the

Estudo da incidência de coledocolitíase em pacientes com colecistite calculosa aguda e crônica submetidos à colecistectomia vídeolaparoscópica

Directory of Open Access Journals (Sweden)

Sidney Moreno Gil

Full Text Available OBJETIVO: Avaliar a incidência da coledocolitiase em pacientes submetidos à colecistectomia laparoscópica, portadores de colecistopatia calculosa aguda e crônica. O presente estudo, também, analisa se a era laparoscópica modificou a incidência e a história natural da litíase da via biliar quando compara os dados da literatura com os índices do Grupo estudado. MÉTODO: O estudo foi realizado em um Grupo de 946 pacientes, distribuídos em Grupo A de 214 pacientes de 1991-1995 e Grupo B de 732 pacientes de 1999-2007 colecistectomizados pelo método laparoscópico. O critério diagnóstico de coledocolitíase foi estabelecido por colangiofluoroscopia de rotina em todas as operações. RESULTADOS: A incidência total de coledocolitiase no Grupo A de 9,8% e no B de 5,8% não mostram diferença estatística significativa entre si e com a literatura mundial (p=0,08.Nos pacientes operados por colecistite aguda também não se observou diferença estatística entre o grupo A e B na incidência de litíase da via biliar( p=0,8. A análise dos dados nos pacientes operados por colecistite crônica revela uma taxa de coledocolitíase menor no Grupo B de 3,7% com significância estatística do que no A de 8,4% p=0,03. CONCLUSÃO: O presente estudo revela uma diminuição expressiva na incidência de coledocolitiase no Grupo B em relação ao A e a literatura mundial quando a indicação cirúrgica ocorre na fase não complicada da doença litiásica biliar. O estudo também demonstra um aumento significativo na indicação da colecistectomia laparoscópica eletiva mais precoce no Grupo B como já observado em diversas publicações da literatura médica.

Fatores preditivos de coledocolitíase em doentes com pancreatite aguda biliar Predictors of choledocholithiasis in patients sustaining acute biliary pancreatitis

Directory of Open Access Journals (Sweden)

José Gustavo Parreira

2004-12-01

Full Text Available OBJETIVO: Avaliar o papel da fosfatase alcalina (FA, gama glutamiltransferase (gamaGT e ultra-sonografia (US como fatores preditivos de coledocolitíase em doentes com pancreatite aguda biliar (PAB. MÉTODOS: Os dados foram coletados prospectivamente durante um período de 31 meses. Quarenta doentes foram incluídos, sendo 30 mulheres, com média etária de 49 + 16 anos. Foram registrados os dados de todos os doentes com pancreatite aguda biliar. Aqueles doentes ictéricos e com a forma grave da doença foram excluídos. As dosagens de FA e GGT, assim como a US, eram realizadas na admissão e 48 horas antes da cirurgia. Todos os pacientes foram submetidos à colangiografia intra-operatória (CIO ou à colangiografia retrógrada endoscópica (CPRE pré-operatória, que era definida baseada na probabilidade de coledocolitíase. Com o intuito de identificar os indicadores de coledocolitíase, as variáveis foram comparadas entre os pacientes com ou sem coledocolitíase. Os testes t de Student, Qui-quadrado e Fisher foram empregados para a análise estatística, considerando-se pBACKGROUND: To assess the role of alkaline phosphatase (AP, gamil-glutamyltransferase (gammaGT and abdominal ultrasound (US as predictors of choledocholithiasis in patients sustaining acute biliary pancreatitis. METHODS: Data was prospectively collected during a period of 31 months. Forty patients were included, 30 were female and the mean age was 49 + 16. All patients sustaining acute biliary pancreatitis were enrolled. Patients with clinical jaundice and severe pancreatitis were excluded. Serum content of AP and gGT as well as US were assessed at admission and 48 hours before cholecistectomy. All patients underwent intra-operative cholangiography (IOC or pre-operative endoscopic retrograde cholangiography (ERCP, which was indicated based on the odds of choledocholithiasis. In order to identify the predictors of choledocholithiasis, variables were compared between patients

Dinamika Penanaman Modal Asing (PMA Bidang Pertambangan Umum di Indonesia

Directory of Open Access Journals (Sweden)

Ukar Wijaya Soelistijo

2011-06-01

Full Text Available During 1967 – 1988, seven generations of Contract of Work (COW were in lieu with foreign  capital  investment in the area of non-coal general mining,  followed by three generations of Coal Contract (CCOW in Indonesia.  An analysis toward details of COW showed that the contract requirements were transformed from time to time. At the first phase, tax holiday was offered. Meanwhile, the later generations reduced such facilities as complained by mining companies.  This research suggests the importance of regulation to manage  Indonesia’s income resulted from windfall profit of oil prices increase. Sepanjang periode 1967 – 1988, Indonesia telah menghasilkan  tujuh generasi Kontrak Kerja dalam investasi modal asing untuk bidang pertambangan umum non batubara, diikuti oleh tiga generasi Kontrak Batubara. Analisis terhadap rincian Kontrak Kerja tersebut memperlihatkan perubahan  persyaratan kontrak  dari waktu ke waktu. Pada fase pertama, Kontrak Kerja menawarkan fasilitas bebas pajak (tax holiday. Hal ini tidak berlaku lagi pada Kontrak Kerja selanjutnya, sebagaimana dikeluhkan perusahaan-perusahaan tambang. Riset ini merekomendasikan pentingnya regulasi untuk mengelola pendapatan Indonesia yang bisa diperoleh dari keuntungan tambahan (windfall profit akibat kenaikan harga minyak.

Spatiotemporal Monte Carlo transport methods in x-ray semiconductor detectors: application to pulse-height spectroscopy in a-Se.

Science.gov (United States)

Fang, Yuan; Badal, Andreu; Allec, Nicholas; Karim, Karim S; Badano, Aldo

2012-01-01

The authors describe a detailed Monte Carlo (MC) method for the coupled transport of ionizing particles and charge carriers in amorphous selenium (a-Se) semiconductor x-ray detectors, and model the effect of statistical variations on the detected signal. A detailed transport code was developed for modeling the signal formation process in semiconductor x-ray detectors. The charge transport routines include three-dimensional spatial and temporal models of electron-hole pair transport taking into account recombination and trapping. Many electron-hole pairs are created simultaneously in bursts from energy deposition events. Carrier transport processes include drift due to external field and Coulombic interactions, and diffusion due to Brownian motion. Pulse-height spectra (PHS) have been simulated with different transport conditions for a range of monoenergetic incident x-ray energies and mammography radiation beam qualities. Two methods for calculating Swank factors from simulated PHS are shown, one using the entire PHS distribution, and the other using the photopeak. The latter ignores contributions from Compton scattering and K-fluorescence. Comparisons differ by approximately 2% between experimental measurements and simulations. The a-Se x-ray detector PHS responses simulated in this work include three-dimensional spatial and temporal transport of electron-hole pairs. These PHS were used to calculate the Swank factor and compare it with experimental measurements. The Swank factor was shown to be a function of x-ray energy and applied electric field. Trapping and recombination models are all shown to affect the Swank factor.

PENENTUAN NILAI TUKAR MATA UANG ASING DENGAN MENERAPKAN KONSEP PARITAS DAYA BELI

Directory of Open Access Journals (Sweden)

Ivan Haryanto

2000-01-01

Full Text Available The concept of relative purchasing power parity is applied to evaluate the exchange rates for currencies such as: the German Mark, Japanese Yen, British Poundsterling, French Franc, Swedish Krona, Italian Lira, and the Canadian Dollar against the USA dollar. Another objective of the study is to evaluate the sensitivity of consumer price indices to exchange rates for each country as well as to test for differences between atual exchange rates and their PPP predicted rates. The results show that in the long-run, actual exchange rates continually move toward the purchasing power predicted rates. On the other hand, in the short-run, the actual and parity exchange rates often experience disequilibrium. It was also found that positive changes in society's purchasing power caused positive changes in the actual exchange rates in every country except Japan. Abstract in Bahasa Indonesia : Konsep paritas daya beli relatif diterapkan untuk mengukur nilai tukar mata uang beberapa negara yaitu - Mark Jerman, Yen Jepang, Poundsterling Inggris, Franc Perancis, Krona Swedia, Lira Italia dan Dolar Kanada, terhadap Dolar Amerika. Selain itu, penelitian ini bertujuan melihat sensitivitas perubahan indeks harga konsumen terhadap perubahan nilai tukar mata uang tiap negara terhadap Dolar Amerika serta menguji apakah terdapat perbedaan secara signifikan antara nilai tukar aktual dengan nilai tukar berdasarkan konsep paritas daya belinya. Hasil penelitian ini menunjukkan bahwa dalam jangka panjang, nilai tukar aktual akan bergerak kembali mendekati nilai tukar paritas daya belinya. Sebaliknya dalam jangka pendek, nilai tukar aktual dan nilai tukar paritas daya belinya seringkali mengalami disekuilibrium. Ditemukan juga bahwa setiap perubahan positif daya beli masyarakat menyebabkan adanya perubahan positif nilai tukar aktual mata uang setiap negara, kecuali negara Jepang. Kata kunci: paritas daya beli, mata uang, kurs valuta asing

Avaliação do programa de controle da hanseníase em um município hiperendêmico do Estado do Maranhão, Brasil, 1991-1995

Directory of Open Access Journals (Sweden)

Aquino Dorlene Maria Cardoso de

2003-01-01

Full Text Available Estudo descritivo, objetivando avaliar o programa de controle da hanseníase do Município de Buriticupu, Maranhão. Foram analisados 214 prontuários de pacientes portadores das diversas formas clínicas de hanseníase, atendidos na unidade de saúde da Universidade Federal do Maranhão, localizada no referido município. A população de estudo foi constituída de 110 casos de hanseníase das formas paucibacilares (PB e 104 das formas multibacilares (MB registrados no período de janeiro de 1991 a dezembro de 1995. As informações referentes à forma clínica, número de contatos registrados, examinados e avaliados, grau de incapacidade no início e final do tratamento e situação de registro, foram coletadas num formulário específico. A análise dos resultados foi baseada nos parâmetros dos indicadores operacionais definidos pelo Ministério da Saúde. Houve um discreto predomínio da forma PB da doença. Observou-se baixos percentuais em relação aos pacientes com grau de incapacidade física avaliada no início e final do tratamento, a alta por cura e contatos examinados. O percentual de abandono foi elevado. O programa foi considerado "precário" em todos os indicadores utilizados para o estudo.

Avaliação da limitação das atividades diárias e qualidade de vida de pacientes com hanseníase submetidos à cirurgia de neurólise para tratamento das neurites

OpenAIRE

Reis,Felipe José Jandre dos; Gomes,Maria Kátia; Cunha,Antonio José Ledo Alves da

2013-01-01

A neurólise é indicada para reduzir o ­sofrimento neural e impedir a instalação de sequelas e incapacidades em pacientes com hanseníase. O objetivo deste estudo foi verificar o grau de limitação das atividades e a qualidade de vida de pacientes com hanseníase submetidos a neurólise para tratamento das neurites. Participaram do estudo os pacientes submetidos à neurólise no período de 1998 a 2011. Foram coletadas informações sociodemográficas e clínicas, limitações das atividades (SALSA) e a qu...

Receptores de estrógenos (ER E ER) e proteínas envolvidas no transporte transepitelial de cálcio na litíase epididimária de galos domésticos

OpenAIRE

Andre Gustavo de Oliveira

2012-01-01

A litíase epididimária é uma anomalia caracterizada pela presença de cálculos ricos em cálcio na região epididimária de galos. Esta disfunção causa redução na fertilidade, tendo impacto negativo na avicultura. A causa da litíase não é conhecida, mas sabe-se que a formação de cálculos acomete principalmente os dúctulos eferentes, responsáveis pela reabsorção do fluido testicular e de cálcio. O transporte transepitelial de cálcio ocorre em etapas distintas que envolvem a entrada de cálcio na cé...

Aspectos epidemiológicos dateníase-cisticercose na área endêmica de Lagamar, MG

Directory of Open Access Journals (Sweden)

Mario León Silva-Vergara

1995-12-01

Full Text Available Um inquérito epidemiológico sobre teníase-cisticercose foi realizado em Lagamar- MG em 1992. Cadastradas 1109 casas com 3344 habitantes. O inquérito abrangeu 875 (86% famílias e foi respondido por um informante que, em 80% dos casos, foi o pai. Na cidade havia 100 chiqueiros em 100 (11,4% casas que albergavam 406 suínos, em condições extremamente precárias. Em 300 (34,2% casas havia o antecedente de teníase em algum membro da família. O antecedente de convulsão foi relatado por 125 (14,2% famílias. O início das convulsões na idade adulta foi caracterizado em 39 (3 7,8% famílias e o antecedente de doenças mentais foi relatado em 53 (6% casas. Os exames parasitológicos de fezes mostraram ovos de Taenia spp em 24 (1,3% das 1850 amostras examinadas.An epidemiological inquiry of human- cysticercosis due to Taenia solium was carried out in Lagamar, Minas Gerais State, Brazil, in 1992. A survey of 1109 houses with 3344. inhabitants was made. The inquiry included 875 (86% families and the questionaire was answered by an informer, who was the father in 80% of the cases. One hmidred pigsties, sheltering 406 swines in extremely precarious conditions, were found in 100 (11.4% houses. A history on taeniasis in some member of the family was verified in 300 (34.2% houses. A histoiy of seizures was referred to by 125 (14.2% of families. The outset of convulsion in adult age was characterized in 39 (37.8% families. A history of mental disorder was reported in 53 (6.0% of houses. Stool examinations were positive for Taenia spp in 24 (1.3% of samples examined.

Prevalência e fisiopatologia da litíase biliar em pacientes submetidos a transplante de órgãos

OpenAIRE

Coelho,Júlio Cesar Uili; Contieri,Fabiana Loss de; Matias,Jorge Eduardo Fouto; Parolin,Mônica Beatriz; Godoy,Jose Luiz de

2009-01-01

INTRODUÇÃO: O objetivo do presente estudo é apresentar revisão da prevalência e dos principais mecanismos fisiopatológicos que levam a formação da litíase biliar em pacientes submetidos a transplante de órgãos. MÉTODOS: Revisão da literatura abrangendo 29 publicações obtidas das bases Medline/Pubmed, Scielo e Lilacs com cruzamento dos unitermos "transplante, transplante renal, transplante hepático, cálculo biliar, colecistite.". Vários estudos que utilizaram a ultrassonografia demonstraram au...

Tratamento da amebíase intestinal por meio de pequenas quantidades diárias de etofamida, usadas em esquemas de curta duração

Directory of Open Access Journals (Sweden)

Guido Carlos Levi

1973-12-01

Full Text Available Por meio da etofamida, trataram os autores 40 indivíduos acometidos de amebíase intestinal e representados por crianças e adultos de ambos os sexos. Os esquemas posológicos recomendados para os componentes de dois grupos de 20 elementos foram os seguintes: A 100 mg três vezes em 24 horas, durante cinco dias; B 100 mg, cinco vezes em 24 horas, durante três dias. Foi expressiva a percentagem global de 90% de curas obtidas, mas a administração de maior quantidade diária da droga, durante período mais curto, mostrou-se dotada de melhor efetividade e possibilitou a eliminação da parasitose de todas as pessoas medicadas. O estudo que efetuaram, correspondente à amebíase intestinal assintomática, oligossintomática ou aparente como colite crônica, deixou patente a eficácia do remédio usado, que praticamente não causou distúrbios colaterais e pode ser prescrito segundo planejamentos singelos e executáveis com facilidade.

Hepatobiliary alterations in massive biliary ascariasis: histopathological aspects of an autopsy case Lesões hepatobiliares em ascaridíase biliar maciça: aspectos histopatológicos em um caso de autópsia

Directory of Open Access Journals (Sweden)

Luiz Carlos da Costa Gayotto

1990-04-01

Full Text Available Hepatobiliary alterations found in an autopsy case of massive Biliary Ascariasis, are reported on histological grounds. Severe cholangitis was the main finding, but other changes were also detected, such as pyloric and intestinal metaplasia, hyperplasia of the epithelial lining, with intraductal papillomas and adenomatous proliferation. Remnants of the worm were observed tightly adhered to the epithelium, forming microscopic intrahepatic calculi. Mucopolysaccharides, especially acid, showed to be strongly positive on the luminal border, and in proliferated glands around the ducts. The authors discuss the similarity between such findings and Oriental Cholangiohepatitis, and suggest that inflammation and the presence of the parasitic remnants are responsible for the hyperplastic and metaplastic changes, similarly with what occurs in chlonorchiasis, fascioliasis and schistosomiasis.Os autores apresentam os aspectos histopatológicos encontrados no fígado de um caso de autópsia de Ascaridíase Biliar maciça. A intensa colangite foi o aspecto predominante, mas outras lesões também foram encontradas, tais como metaplasia pilórica e intestinal, hiperplasia epitelial com papilomas intraductais, e por vezes padrão adenomatoso. Restos do helminto foram encontrados fortemente aderidos ao epitélio, sendo intensa a positividade de mucopolissacárides, principalmente ácidos, na borda luminal do epitélio ductal e em glândulas proliferadas ao redor dos ductos. Os autores discutem a semelhança da Ascaridíase Biliar com a Colangio Hepatite Oriental, e sugerem que o processo inflamatório e a presença de restos do verme são responsáveis pelas alterações hiperplásicas e metaplásicas, analogamente ao que ocorre na clonorquíase, fasciolíase e esquistossomose.

Regressão de psoríase em paciente HIV-positivo após terapia anti-retroviral Regression of psoriasis in HIV patient after antiretroviral therapy

Directory of Open Access Journals (Sweden)

Maria de Fátima Amorin Ruiz

2003-12-01

Full Text Available A síndrome da imunodeficiência adquirida foi reconhecida pela primeira vez como nova doença em 1981 devido à associação atípica de sarcoma de Kaposi e pneumonia por Pneumocystis carinii em homens. A pele é sede freqüente de doenças conseqüentes a essa infecção. A psoríase é dermatose crônica que afeta proporção que varia de 1,3 a 5% dos pacientes infectados com HIV. Portadores de psoríase que apresentem formas clínicas exacerbadas e dificuldade de resposta terapêutica devem ser investigados para possível infecção pelo HIV. É relatado caso de paciente do sexo masculino, de 44 anos, que iniciou com lesões eritêmato-escamosas no couro cabeludo, nos cotovelos, joelhos, palma das mãos, planta dos pés, além de comprometimento ungueal, após infecção pelo HIV. Confirmado o diagnóstico de psoríase e introduzida a terapia anti-retroviral, houve melhora significativa das lesões.Immunodeficiency syndrome was first described as a new disease in 1981 because an unusual association of Kaposi's Sarcoma and Pneumocystis carinii pneumonia in men. The skin is a frequent site of diseases due to this infection. Psoriasis is a chronic dermatitis that affects 1.3-5% of HIV-positive patients. The case is described of a 44-year-old man with onset of erythematous scaly lesions in scalp, elbows, knees, hands, feet and nails following HIV infection. After diagnosis of psoriasis was confirmed and antiretroviral therapy instigated, he presented improvement of the psoriasis lesions.

Atingidos pela hanseníase, reparados pelo Estado : as múltiplas histórias performadas da Lei 11.520/2007

OpenAIRE

Glaucia Cristina Maricato Moreto

2015-01-01

Esta dissertação gira em torno da lei nº 11.520, que em setembro de 2007 estabeleceu o direito a uma pensão especial a todas as pessoas atingidas pela hanseníase e compulsoriamente internadas em colônias hospitalares até 31 de dezembro de 1986. Por um lado, alinhado ao trabalho de diversas pesquisadoras, tais como Vianna (2013), Bevilaqua (2013), Schuch (2008), Das e Polle (2008), Vecchioli (2001) e Ferreira (2009), o enfoque não é direcionado à letra da lei 11.520/2007 (enquanto conjunto de ...

Asma e ascaridíase em crianças de 2 a 10 anos de um bairro de periferia Asthma and ascariasis in children aged two to ten living in a low income suburb

Directory of Open Access Journals (Sweden)

Maria Teresa Nascimento Silva

2003-06-01

Full Text Available OBJETIVO: avaliar a associação entre asma e ascaridíase em crianças do bairro Pedregal, da cidade de Campina Grande (Paraíba, onde são baixos os indicadores de desenvolvimento humano. MATERIAL E MÉTODO: foi aplicado o questionário padrão do International Study of Asthma and Allergies in Childhood (ISAAC, em 1.095 crianças, mas apenas 742 o responderam e entregaram a amostra fecal para realização do exame parasitológico. A faixa etária das 742 crianças incluídas no estudo transversal foi de 2 a 10 anos de idade. A associação entre asma e ascaridíase foi estudada pelo índice Kappa. As análises das variáveis demográficas e clínicas, comparando os dois grupos, foram realizadas pelo teste do qui-quadrado (chi² ou o teste t de Student para os dados quantitativos (contínuos. RESULTADOS: nas 742 crianças, as proporções dos sexos foram semelhantes: 51,9% (n = 385 do masculino e 48,1% (n = 357 do feminino. Nessas crianças, a prevalência de asma foi de 59,7% (n = 443 e da ascaridíase de 56,3% (n = 418, sendo semelhante (chi² = 0,27; p > 0,60 a freqüência de asma no grupo portador de ascaridíase (60,5% ou sem essa helmintíase (58,6%. CONCLUSÃO: apesar da elevada freqüência dos agravos estudados, não há aparente associação entre asma e ascaridíase na população estudada.OBJECTIVE: to assess the relation between children with asthma and ascariasis in the low income neighborhood of Pedregal, in Campina Grande (Paraíba, Brazil. MATERIAL AND METHOD: the International Study of Asthma and Allergies in Childhood (ISSAC standard questionnaire was distributed to 1,095 children but only 742 of them answered it and provided stool samples for parasite examination. The cross-sectional study included those 742 children, whose age ranged from 2 to 10 years. The association between asthma and ascariasis was studied through Kappa rating. Demographic and clinic variants comparing the two groups were analyzed by chi-square test

Analisa Faktor Rasio Likuiditas , Rasio Aktivitas, Rasio Profitabilitas Dan Rasio Coverage Dalam Penanaman Modal Asing (Pma (Studi Empiris Pada Perusahaan Sektor Trade, Service Dan Investment

Directory of Open Access Journals (Sweden)

Ade Manggala Hardianto

2015-10-01

Full Text Available Istilah multinasional menunjukan pada perusahaan  penanaman modal asing (PMA, sebagai anak perusahaan yang berafiliasi bisnis dengan dengan perusahaan induk yang berkedudukan kantor pusat diluar negeri. Sedangkan, perusahaan domestik adalah perusahaan penanaman modal dalam negeri , kantor pusat yang berkedudukan di Indonesia.Analisa Faktor Yang Berkorelasi Dalam Penanaman Modal Asing: Matrik 1 Current Ratio (0,599 , Return On Asset (0,931, Retrun On Equity  (0,77, Net Profit Margin (0,601. Matrik 2   1 Earning Per Share  ( EPS (0,993  dan  Dan Times Interest Earned (0,926. Matrik 3 1 cash ratio ( 0,729 dan 2 Account Receivable Turnover ( 0,877 . Matrik 4  Inventory Turnover, (0,982, Matrik 5  Total Asset Turn Over (TATO  sebesar 0,545.Perusahaan PMA dengan profitabiltas dan likuiditas yang tinggi terdapat 1 (satu perusahaan yaitu United tracktor hal ini ditunjukan dengan nilai earning per share (EPS sebesar 1.440 per lembar saham. EPS yang tinggi akan menarik minat para Investor untuk menanamkan dananya lebih banyak, dan keuntungan perusahaan adalah mendapatkan dana segar untuk lebih meningkatkan produktivitas perusahaan. Dan likuiditas sebesar 206% pada Current rasio, 158 % pada Quick test ratio, dan  cash ratio 62%.

Gallstones in children with sickle cell disease followed up at a Brazilian hematology center Litíase biliar em crianças com doença falciforme acompanhadas em um centro de hematologia no Brasil

Directory of Open Access Journals (Sweden)

Ana Paula dos Santos Gumiero

2008-12-01

considered in symptomatic patients. In asymptomatic patients, conservative management seems to be the better choice.RACIONAL: A doença falciforme causa hemólise crônica e acelerada que é reconhecida como fator de risco para desenvolvimento de colelitíase. Essa complicação pode ocorrer em mais de 50% da população adulta com doença falciforme. A colecistectomia é a conduta consensual para pacientes sintomáticos, mas nos assintomáticos a sua indicação é controversa. OBJETIVOS: Verificar a prevalência de colelitíase em pacientes com doença falciforme e descrever a conduta tomada em caso de diagnóstico da complicação, numa corte de pacientes seguidos num centro terciário de hematologia pediátrica. MÉTODOS: Neste estudo descritivo e retrospectivo, foram revistos prontuários de 225 pacientes e os dados relacionados à evolução clínica desses indivíduos foram registrados. RESULTADOS: A freqüência cumulativa de colelitíase foi de 45%, sendo que metade deles não apresentava quaisquer sintomas. As médias de idade ao diagnóstico de colelitíase e seu tratamento cirúrgico foram, respectivamente, 12,5 anos (desvio padrão = 5 anos e 14 anos (desvio padrão = 5,4 anos. A prevalência de colelitíase foi maior nos pacientes com doença SS (homozigotos e Sb (heterozigotos talassemia, comparados aos pacientes com doença falciforme. Entre os pacientes sintomáticos (50%, a dor abdominal inespecífica foi o único sintoma ou o sintoma predominante. Entre pacientes que realizaram colecistectomia (n = 44, 39 tiveram melhora ou resolução de seus sintomas após o procedimento. Em 7 anos (desvio padrão = 4,8 anos de seguimento clínico dos pacientes assintomáticos e não tratados cirurgicamente, verificou-se que nenhuma criança apresentou complicações relacionadas à colelitíase. CONCLUSÕES: A freqüência de colelitíase na população estudada foi de 45%. Um terço dos pacientes foram diagnosticados antes dos 10 anos de idade. Pacientes com fen

Prevalência e fisiopatologia da litíase biliar em pacientes submetidos a transplante de órgãos Prevalence and physiopathology of gallstone in transplant patients

Directory of Open Access Journals (Sweden)

Júlio Cesar Uili Coelho

2009-06-01

Full Text Available INTRODUÇÃO: O objetivo do presente estudo é apresentar revisão da prevalência e dos principais mecanismos fisiopatológicos que levam a formação da litíase biliar em pacientes submetidos a transplante de órgãos. MÉTODOS: Revisão da literatura abrangendo 29 publicações obtidas das bases Medline/Pubmed, Scielo e Lilacs com cruzamento dos unitermos "transplante, transplante renal, transplante hepático, cálculo biliar, colecistite.". Vários estudos que utilizaram a ultrassonografia demonstraram aumento na prevalência da litíase biliar em pacientes submetidos a transplante de órgãos. A taxa de formação de cálculos novos após o transplante variou de 10 a 55% e a total (cálculos formados antes e após o transplante de 17 a 68%. Tanto o ganho como a perda de peso rápida, que podem ocorrer após o transplante, predispõem à formação de cálculos biliares. O uso do imunossupressor ciclosporina é considerado como o principal fator que aumenta a incidência de litíase biliar após o transplante. CONCLUSÃO: A prevalência de litíase biliar é maior nos pacientes submetidos a transplante de órgãos do que na população geral. As principais alterações que ocorrem no paciente transplantado que predispõem a formação dos cálculos são as alterações do peso corporal, uso de imunossupressores, diabete melito e hiperlipidemia.INTRODUCTION: The objective of the present study is to review the prevalence and the main physiopathologic mechanisms that result in gallstone formation in transplant patients. METHODS: Literature review with 29 papers included in Medline/Pubmed, Scielo and Lilacs database, crossing key-words "transplantation; kidney transplantation; liver transplantation; gallstone; cholecystitis". Several ultrasonographic studies have demonstrated an increase in gallstone prevalence in transplant patients. The formation rate of new stones after transplantation varied from 10 to 55% and the rate of total stones

Wide range operation of regenerative optical parametric wavelength converter using ASE-degraded 43-Gb/s RZ-DPSK signals.

Science.gov (United States)

Gao, Mingyi; Kurumida, Junya; Namiki, Shu

2011-11-07

For sustainable growth of the Internet, wavelength-tunable optical regeneration is the key to scaling up high energy-efficiency dynamic optical path networks while keeping the flexibility of the network. Wavelength-tunable optical parametric regenerator (T-OPR) based on the gain saturation effect of parametric amplification in a highly nonlinear fiber is promising for noise reduction in phase-shift keying signals. In this paper, we experimentally evaluated the T-OPR performance for ASE-degraded 43-Gb/s RZ-DPSK signals over a 20-nm input wavelength range between 1527 nm and 1547 nm. As a result, we achieved improved power penalty performance for the regenerated idler with a proper pump power range.

National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) summer faculty fellowship program, 1986, Volume 1

International Nuclear Information System (INIS)

Mcinnis, B.; Goldstein, S.

1987-06-01

The Johnson Space Center (JSC) NASA/ASEE Summer Faculty Fellowship Program was conducted by the University of Houston. The basic objectives of the program are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching objectives of participants' institutions; and (4) to contribute to the research objectives of the NASA Centers. Each faculty fellow spent ten weeks at JSC engaged in a research project commensurate with his interests and background and worked in collaboration with a NASA/JSC colleague. Volume 1 contains sections 1 through 14

Estudo comparativo preliminar entre os alongamentos proprioceptivo e estático passivo em pacientes com seqüelas de hanseníase

OpenAIRE

Diaz, Augusto Floricel; Moro, Fabio Luiz; Binotto, Jussara Machado; Fréz, Andersom Ricardo

2008-01-01

A proposta deste estudo foi comparar a aplicação de alongamento estático passivo e alongamento proprioceptivo no tratamento de seqüelas de hanseníase. Doze pacientes com essas seqüelas participaram da pesquisa, separados aleatoriamente em dois grupos: o grupo FNP, tratado com facilitação neuromuscular proprioceptiva, e o grupo AEP, com alongamento estático passivo. Ambos realizaram dez sessões de alongamentos, sendo submetidos à avaliação inicial e final nas quais foram aplicados o questionár...

Ensaio terapêutico com o Ketoconazol na pitiríase versicolorTherapeutic trial with Ketoconazole in PV

Directory of Open Access Journals (Sweden)

Leila Dagher

1982-11-01

Full Text Available Experimentação terapêutico-laboratorial com o Ketoconazol na Pitiríase Versicolor, obtendo os seguintes resultados: - Curados, 16 (88,88% pacientes; Melhorados, 2 pacientes (11,11%, Inalterados e Piorados, nenhum caso (0,00%, no total de 18 doentes estudados. Do ponto de vista laboratorial, houve negativação dos exames micológicos em 100,00% dos casos.Eighteen patients with pityriasis versicolor were treated with a single daily dose of 200mg of Ketoconazole administered with a meal, for a period of 30 days. Evaluation was based on clinical and mycological responses. Clinical and parasitoligical cure was obtained in 16 (88,88% patients and marked clinical improvement in 2(11,11%. No undesirable side effects were observed in the treatment.

Estudo sobre o diagnóstico da giardíase por meio do método Kato-Katz

Directory of Open Access Journals (Sweden)

Vera Lucia Pagliusi Castilho

1983-06-01

Full Text Available Foi verificado que é possível diagnosticar a giardíase através de exame de fezes realizado pelo método de Kato-Katz, hoje bastante utilizado no Brasil. Todavia, para reconhecimento da protozoose em questão, a eficácia do processo da centrífugo-fiutuação em sulfato de zinco mostrou-se maior. As sensibilidades das técnicas de Kato-Katz e da sedimentação espontânea em água foram equiparáveis, afigurando-se mais produtivas, a propósito do emprego da primeira, as análises efetuadas imediatamente ou após 24 horas em relação à ocasião do preparo.

National Aeronautics and Space Administration (NASA) /American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program. Volume 1

Science.gov (United States)

Bannerot, Richard B. (Editor); Sickorez, Donn G. (Editor)

1997-01-01

The 1996 JSC NASA/ASEE Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The objectives of the program, which began nationally in 1964 and at JSC in 1965 are to (1) further the professional knowledge qualified engineering and science faculty members, (2) stimulate an exchange of ideas between participants and NASA, (3) refresh the research and teaching activities of participants' institutions, and (4) contribute to the research objectives of the NASA centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project in collaboration with a NASA JSC colleague. This document is a compilation of the final reports on the research projects completed by the faculty fellows during the summer of 1996.

Simultaneous analysis of organochlorine pesticides and polychlorinated biphenyls in air samples by using accelerated solvent extraction (ASE) and solid-phase micro-extraction (SPME) coupled to gas chromatography dual electron capture detection.

Science.gov (United States)

Mokbel, Haifaa; Al Dine, Enaam Jamal; Elmoll, Ahmad; Liaud, Céline; Millet, Maurice

2016-04-01

An analytical method associating accelerated solvent extraction (ASE) and solid-phase micro-extraction (SPME) in immersion mode combined with gas chromatography dual electrons capture detectors (SPME-GC-2ECD) has been developed and studied for the simultaneous determination of 19 organochlorine pesticides (OCPs) and 22 polychlorinated biphenyls (PCBs) in air samples (active and XAD-2 passive samplers). Samples were extracted with ASE with acetonitrile using the following conditions: temperature, 150 °C; pressure, 1500 psi; static, 15 min; cycles, 3; purge, 300 s; flush, 100 %. Extracts were reduced to 1 mL, and 500 μL of this extract, filled with deionised water, was subject to SPME extraction. Experimental results indicated that the proposed method attained the best extraction efficiency under the optimised conditions: extraction of PCB-OCP mixture using 100-μm PDMS fibre at 80 °C for 40 min with no addition of salt. The performance of the proposed ASE-SPME-GC-2ECD methodology with respect to linearity, limit of quantification and detection was evaluated by spiking of XAD-2 resin with target compounds. The regression coefficient (R (2)) of most compounds was found to be high of 0.99. limits of detection (LODs) are between 0.02 and 4.90 ng m(-3), and limits of quantification (LOQs) are between 0.05 and 9.12 ng m(-3) and between 0.2 and 49 ng/sampler and 0.52 and 91 ng/sampler, respectively, for XAD-2 passive samplers. Finally, a developed procedure was applied to determine selected PCBs and OCPs in the atmosphere.

Estrongiloidíase maciça: a propósito de quatro casos Massive strongyloidiasis: report of four cases

OpenAIRE

M. C. Ramos; R. J. Pedro; L. J. Silva; M. L. M. Branchinni; F. L. Gonçales Junior

1984-01-01

São relatados quatro casos de estrongiloidíase maciça em pacientes sem diagnóstico prévio da doença ou tratamento imunossupressor. A doença, na maioria dos casos, teve um curso crônico, associada a uma síndrome de má absorção. Em um caso a sintomatologia que motivou a internação foi a de uma meningite purulenta que se repetia pela quarta vez. Não se sabe ao certo qual o desencadeante de tal situação nos quatro casos apresentados, porém, discute-se o possível papel do sistema imunológico na de...

Hanseníase: a implicação da educação em saúde para o autocuidado

OpenAIRE

Duarte, Lucelia Maria Carla Paulo da Silva

2014-01-01

A hanseníase é um problema de saúde em nível mundial devido principalmente ao seu potencial incapacitante. A estratégia de combate à doença adotada pelo Ministério de Saúde é o diagnóstico e tratamento precoces, prevenção e tratamento de incapacidades físicas e vigilância dos contatos domiciliares. Tudo isso fundamentado na educação em saúde como sustentáculo para compreensão do processo de adoecimento, da doença em si, sua aceitação e, principalmente, das ações de autocuidado para prevenção ...

Púrpura em paciente com estrongiloidíase disseminada Purpura in patient with disseminated strongiloidiasis

Directory of Open Access Journals (Sweden)

Luciano C. Ribeiro

2005-05-01

Full Text Available A infecção pelo Strongyloides stercoralis em associação com imunosupressão pode manifestar-se com lesões em múltiplos órgãos e sistemas, caracterizando a forma disseminada da doença. Lesões cutâneas não são freqüentemente relatadas e, se presentes, manifestam-se como rash e petéquias. Púrpuras bem definidas são pouco descritas. No presente trabalho é descrito um caso de estrongiloidíase disseminada, com acometimento cutâneo em forma de púrpura, que se desenvolveu em um paciente timectomizado e usuário crônico de corticosteróide devido à miastenia gravis.The association of systemic corticosteroid therapy and dissemination of Strongyloides stercoralis has been increasingly documented in the literature. Skin involvement in disseminated strongyloidiasis has been reported and the most commonly described cutaneous manifestations are rash and petechial eruptions. We present a case of an immunosuppressed man that developed disseminated strongyloidiasis with extensive purpura.

Tricomoníase: prevalência no gênero feminino em Sergipe no biênio 2004-2005 Trichomoniasis: prevalence in the female gender in 2004-2005 in Sergipe State, Brazil

Directory of Open Access Journals (Sweden)

Mayra Santos Almeida

2010-06-01

Full Text Available A tricomoníase é uma protozoose causada pelo Trichomonas vaginalis, que desencadeia uma ampla variedade de manifestações clínicas, podendo estar associada à transmissão do vírus da imunodeficiência humana, câncer cervical, infertilidade, entre outros. No Brasil, a incidência varia entre 20 e 40%. A via primária de transmissão é pelo contato sexual e o diagnóstico laboratorial pode ser realizado através da Reação de Polimerase em Cadeia (PCR, isolamento em meios de cultura e exame do conteúdo vaginal à fresco e/ou corados pelos métodos de Giemsa e Papanicolau. Esse último possui limitações na detecção de patologias consideradas DST, a exemplo da tricomoníase. Esse artigo trata da prevalência de tricomoníase em mulheres usuárias dos laboratórios conveniados ao Ministério da Saúde, na faixa etária de 19 a 44 anos, que foram submetidas ao teste de Papanicolau, em 2004-2005, no Estado de Sergipe. Os resultados revelaram que, em 206.034 usuárias, 7.349 apresentaram tricomoníase, sendo que 3.788 em 2004 e 3.498 em 2005. Observou-se que a prevalência estimada em Sergipe, no biênio estudado, não corrobora com a realidade brasileira, fato esse que pode estar atrelado ao diagnóstico executado.Trichomoniasis is a disease caused by the protozoan Trichomonas vaginalis, which initiates a wide variety of clinical manifestations. It may be associated with human immunodeficiency virus, cervical cancer, infertility and other diseases. Its incidence ranges from 20% up to 40% in Brazil. The primary channel of transmission is by sexual contact and laboratorial diagnostic may be performed by chain polymerase reaction (CPR, culture medium isolation, fresh vaginal content exam and/or colored by Giemsa and Papanicolau methods. The later has limitations in the detection of pathologies considered sexually transmissible, like Thricomoniasis. This work deals with prevalence of Thricomoniasis in users of laboratories associated with the

Experiment list: SRX100475 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available disease) and Dejerine- Sottas neuropathology (also designated hereditary motor a...se) and Dejerine- Sottas neuropathology (also designated hereditary motor and sensory neuro- pathy III. Egr-

A relação entre soroprevalência de anticorpos contra o glicolipídeo fenólico-I entre crianças em idade escolar e endemicidade da hanseníase no Brasil The relation between seroprevalence of antibodies against phenolic glycolipid-I among school children and leprosy endemicity in Brazil

Directory of Open Access Journals (Sweden)

Samira Bührer-Sékula

2008-01-01

Full Text Available Os programas de controle da hanseníase se beneficiariam de um método fácil para estimar prevalência e avaliar o impacto das ações de controle na prevalência da doença. A determinação da soroprevalência de anticorpos contra PGL-I através de estudos com crianças em idade escolar foi sugerida como indicador útil da taxa de prevalência da hanseníase a nível municipal.Para investigar se a soropositividade estaria associada aos coeficientes de detecção da hanseníase e se poderia ser usada como indicador da prevalência em outras áreas, 7.073 crianças em três estados endêmicos de hanseníase no Brasil foram testadas. Resultados mostram uma considerável variação da distribuição de soropositividade nas comunidades, independente do número de casos de hanseníase detectados. A soroprevalência foi significativamente menor nos colégios. Nenhuma diferença na distribuição da soropositividade determinada por ELISA ou dipstick foi observada. Nenhuma correlação entre o coeficiente de detecção da hanseníase e soropositividade pôde ser estabelecida.Leprosy control programs would benefit expressively from an easy method to estimate disease prevalence and to assess the effect of leprosy control measures on disease prevalence. Determination of the seroprevalence of antibodies to PGL-I through school children surveys might be a useful indicator of leprosy prevalence at the district level. To investigate whether seropositivity rates could be related to leprosy detection rates and whether seropositivity could be used as a proximal indicator to predict the leprosy incidence in other areas, 7,073 school children in three different leprosy-endemic states in Brazil were tested. The results show a widely varying distribution of seropositivity in the communities independent of the number of leprosy cases detected. Seroprevalence was significantly lower at private schools. No differences in the patterns of seropositivity between ELISA

Reviews Book: Extended Project Student Guide Book: My Inventions Book: ASE Guide to Research in Science Education Classroom Video: The Science of Starlight Software: SPARKvue Book: The Geek Manifesto Ebook: A Big Ball of Fire Apps

Science.gov (United States)

2014-05-01

WE RECOMMEND Level 3 Extended Project Student Guide A non-specialist, generally useful and nicely put together guide to project work ASE Guide to Research in Science Education Few words wasted in this handy introduction and reference The Science of Starlight Slow but steady DVD covers useful ground SPARKvue Impressive software now available as an app WORTH A LOOK My Inventions and Other Writings Science, engineering, autobiography, visions and psychic phenomena mixed in a strange but revealing concoction The Geek Manifesto: Why Science Matters More enthusiasm than science, but a good motivator and interesting A Big Ball of Fire: Your questions about the Sun answered Free iTunes download made by and for students goes down well APPS Collider visualises LHC experiments ... Science Museum app enhances school trips ... useful information for the Cambridge Science Festival

Sorologia da hanseníase utilizando PGL-I: revisão sistemática Leprosy serology using PGL-I: a systematic review

OpenAIRE

Rodrigo Scaliante de Moura; Karla Lucena Calado; Maria Leide W. Oliveira; Samira Bührer-Sékula

2008-01-01

A sorologia utilizando o antígeno espécie-específico do Mycobacterium leprae, PGL-I, pode ser um marcador de carga bacteriana em pacientes com hanseníase. Estudos identificaram potencial de uso da sorologia na classificação de pacientes para fins de tratamento, monitoramento de terapia, risco de recidiva e na seleção dos contatos com maior risco de adoecer. Foi realizada uma revisão sistemática e 26 artigos foram incluídos na análise comparativa. Avaliamos os resultados do uso da sorologia PG...

Etiologia dos casos de candidíase cutânea atendidos no serviço de micologia da Universidade Federal Fluminense, Brasil

OpenAIRE

Silva Barbedo, Leonardo; Pereira Brito, Simone Cristina; de Oliveira Kegele, Fabíola Cristina; Alves Cordeiro, Jânio; Carvalhaes de Oliveira, Jeferson; da Graça Sgarbi, Diana Bridon

2013-01-01

Neste trabalho foram estudadas 64 amostras oriundas de 56 pacientes com suspeita clínica de candidíase cutânea, coletadas de novembro de 2008 a agosto de 2009, no serviço de Diagnóstico Micológico Humano e Veterinário do Departamento de Microbiologia e Parasitologia, Instituto Biomédico da Universidade Federal Fluminense. Foram isoladas espécies de Candida em 58 amostras de 51 pacientes, trinta e oito mulheres e treze homens, com a seguinte distribuição: 15 C. parapsilosis, 11 C. famata, 9 C....

Single lesion as an indicator to monitor the leprosy trend to elimination in hyperendemic areas Lesão única como indicador de monitoramento de tendência de eliminação da hanseníase em áreas hiperendêmicas

Directory of Open Access Journals (Sweden)

Eliane Ignotti

2007-09-01

Full Text Available INTRODUCTION: Prevalence and detection rates of leprosy are not sufficient to show the real magnitude of changes in epidemiological patterns. OBJECTIVES: Evaluate the feasibility and usefulness of the proportion of new leprosy patients with a single skin lesion (SSL as a potential indicator of the elimination of leprosy. METHODS: We conducted a retrospective study based on secondary data analyzing newly reported cases of leprosy between 1997 and 2002, in the city of Palmas, Tocantins, Brazil. Patients with a single lesion were compared to remaining patients, and the odds ratio was used as measure of association. RESULTS: Out of the 1,303 new cases of leprosy, 481 (36.9% had a SSL. An increasing time-trend was observed in the proportion of new cases detected with a single lesion, which grew from 20.3% in 1999 to 49.1% in 2002 (linear trend pINTRODUÇÃO: As taxas de detecção e prevalência de hanseníase não são suficientes para mostrar a real magnitude de mudanças nos padrões epidemiológicos da doença. OBJETIVOS: Avaliar a aplicabilidade e utilidade da medida de proporção de casos de hanseníase com lesão única de pele como potencial indicador de avaliação do progresso da eliminação da hanseníase em áreas hiperendêmicas. METODOLOGIA: Estudo retrospectivo baseado na análise de dados secundários de casos novos de hanseníase notificados entre 1997 e 2002 na cidade de Palmas, estado de Tocantins, Brasil. Os registros de pacientes com lesão única foram comparados àqueles registrados com mais de uma lesão. Odds ratio foi utilizado como medida de associação. RESULTADOS: De um total de 1.303 casos novos de hanseníase notificados, 481 (36,9% apresentavam lesão única de pele. Verificou-se tendência de incremento na proporção de casos de casos novos diagnosticados com lesão única variando de 20,3% em 1999 para 49,1% em 2002 (p < 0,001, simultaneamente à redução do registro de número de casos novos após 1999. Maior

Ensaio clínico com um nôvo sal: etilclordifene no tratamento da amebíase intestinal crônica

Directory of Open Access Journals (Sweden)

Donald Huggins

1969-04-01

Full Text Available O autor relata seus resultados iniciais obtidos com nova substância amebicida - Etilclordifene, em 22 pacientes tratados no Instituto de Medicina Tropical da F.M.U.F.Pe. A dose empregada em adultos foi de 600 mg por dia, durante cinco dias e 300 mg por dia, durante cinco dias para crianças. Obteve cura parasitológica em 95,4% dos casos (21 pacientes e excelente tolerância. Conclui ser o nóvel medicamento bastante ativo na amebíase intestinal crônica e certamente deverá ocupar posição privilegiada entre os demais produtos amebicidas ora em voga.

Dermatologia comparativa: similaridade entre elefantíase nostra verrucosa e coral Comparative dermatology: elephantiasis nostra in verrucous form comparable to coral

Directory of Open Access Journals (Sweden)

Lana Bezerra Fernandes

2011-08-01

Full Text Available Demonstra-se quadro raro de Elefantíase Nostra, na sua forma verrucosa, no dorso de pé de homem de 80 anos por episódios prévios de erisipela de repetição. As lesões confluentes vegetantes e difusas em dorso de pé são comparáveis aos corais Trumpet Coral (Caulastrea curvataStudy of a rare case of Elephantiasis Nostra in verrucous form on the dorsum of the foot of an 80year-old male with a history of recurrent erysipelas infection. The vegetant, confluent lesions on the foot resemble Trumpet Coral (Caulastrea curvata

SAIL: Summation-bAsed Incremental Learning for Information-Theoretic Text Clustering.

Science.gov (United States)

Cao, Jie; Wu, Zhiang; Wu, Junjie; Xiong, Hui

2013-04-01

Information-theoretic clustering aims to exploit information-theoretic measures as the clustering criteria. A common practice on this topic is the so-called Info-Kmeans, which performs K-means clustering with KL-divergence as the proximity function. While expert efforts on Info-Kmeans have shown promising results, a remaining challenge is to deal with high-dimensional sparse data such as text corpora. Indeed, it is possible that the centroids contain many zero-value features for high-dimensional text vectors, which leads to infinite KL-divergence values and creates a dilemma in assigning objects to centroids during the iteration process of Info-Kmeans. To meet this challenge, in this paper, we propose a Summation-bAsed Incremental Learning (SAIL) algorithm for Info-Kmeans clustering. Specifically, by using an equivalent objective function, SAIL replaces the computation of KL-divergence by the incremental computation of Shannon entropy. This can avoid the zero-feature dilemma caused by the use of KL-divergence. To improve the clustering quality, we further introduce the variable neighborhood search scheme and propose the V-SAIL algorithm, which is then accelerated by a multithreaded scheme in PV-SAIL. Our experimental results on various real-world text collections have shown that, with SAIL as a booster, the clustering performance of Info-Kmeans can be significantly improved. Also, V-SAIL and PV-SAIL indeed help improve the clustering quality at a lower cost of computation.

Conformational changes in DNA caused by DNA-ase I, gamma and ultraviolet radiation as revealed by differential pulse polarography

International Nuclear Information System (INIS)

Vorlickova, M.

1979-01-01

The height, potential and half width of differential pulse-polarographic peaks of DNA were investigated in dependence on degradation by DNA-ase I and gamma and UV radiation. It was found that in all cases studied growth of peak II (reflecting conformational changes in the DNA double helix) was limited, and only after it reached a certain height further degradation induced the appearance of peak III of single-stranded DNA. This course is explained as reflecting the limited extent of conformational changes in the framework of the double helix, which probably follows from a limited number of sites that can undergo certain types of conformational changes. The character of the conformational changes is dependent on the chemical nature of the damage. (author)

National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1994, volume 1

Science.gov (United States)

Bannerot, Richard; Sickorez, Donn G.

1995-01-01

The JSC NASA/ASEE Summer Faculty Fellowship Program was conducted by Texas A&M University and JSC. The objectives of the program, which began nationally in 1964 and at JSC in 1965 are to: (1) further the professional knowledge of qualified engineering and science faculty members, (2) stimulate an exchange of ideas between participants and NASA, (3) enrich and refresh the research and teaching activities of participants' institutions, and (4) contribute to the research objectives of the NASA centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project in collaboration with a NASA JSC colleague. This document is a compilation of the final reports on the research projects completed by the faculty fellows during the summer of 1994.

Experiment list: SRX190186 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ase) and Dejerine- Sottas neuropathology (also designated hereditary motor and sensory neuro- pathy III. Egr...disease) and Dejerine- Sottas neuropathology (also designated hereditary motor and sensory neuro- pathy III.

Ensaio terapêutico com «mebendazole suspensão» nas helmintíases intestinais em crianças

Directory of Open Access Journals (Sweden)

Donald Huggins

1975-06-01

Full Text Available O Autor medicou 24 crianças portadoras de poliverminoses, com idades entre 8 a 14 anos, todas do sexo feminino, com Mebendazole (suspensão, na dose de 5 ml (100 mg duas vezes por dia e durante três dias consecutives. O diagnóstico e o controle de cura parasitológica foram realizados pelas técnicas de Lutz, Willis, Baerman-Moraes e Graham, antes e no 7.°, 14.° e 21.° dias após o tratamento para as três primeiras, enquanto a última foi executada durante sete dias consecutivos a partir do sétimo dia de encerrada a terapêutica. Verificou cura parasitológica em 100% dos casos para ascariase e enterobiase, 69,2% para tricocefalíase, 36,36% para ancilostomíase e 0% para estrongiloidiase. Nenhuma manifestação colateral foi relatada pelos doentes.The Author reports the therapeutic activity of a new anthelmintic drug - Mebendazole suspension, in the treatment of twenty-four children, aged from 8 to 14 years-old, all females, with multiple intestinal parasitic infections. Mebendazole (suspension was given in a dose of 5 ml (100 mg two times per day (taken all at a morning after breakfast, and night after dinner, for three consecutives days. The diagnosis and the control laboratory data were made before the medication, and repeated 7th, 14th, 21th days after its completion and consisting of Lutz, Willis and Baerman-Moraes methods, and the anal swab technique was made for seven consecutives days, beginning the 7th day after completion of treatment. The percentual of parasitological cure rate obtained was the following: 100% for Ascaris lumbricoides and Enterobius vermicularis; 69,2% for Trichuris trichiura; 36,36% for Ancylostomidae sp and 0% for Strongyloides stercoralis. The drug under observation did not produce any side-affects.

Nefrolitíase em pacientes pediátricos: investigação metabólica e anatômica

Directory of Open Access Journals (Sweden)

Luis Alberto Batista Peres

2011-03-01

Full Text Available Desordens metabólicas são frequentes em pacientes com nefrolitíase pediátrica. OBJETIVOS: Estudar as alterações metabólicas e anatômicas e a análise química dos cálculos encontrados em pacientes da nossa região. MÉTODOS: Este é um estudo retrospectivo em 158 crianças com evidência de formação recente de cálculos, destes apenas 109 concluíram a investigação metabólica. A investigação laboratorial consistiu de duas amostras de urina de 24 horas com dosagem de cálcio, ácido úrico, citrato, oxalato, sódio e creatinina, cistinúria qualitativa, pH urinário seguido de 12 horas de jejum e restrição hídrica, cultura da urina e análise química quando os cálculos foram disponíveis. As técnicas de imagem incluíram ultrassonografia do trato urinário e urografia excretora. RESULTADOS: Em 96,3% das crianças alguma causa foi detectada. A principal alteração metabólica encontrada foi a hipercalciúria (73,4%. Análise química dos cálculos mostrou oxalato de cálcio em 90,9% dos casos. Alterações anatômicas foram encontradas em 18,0% dos pacientes investigados, e a mais frequente foi a duplicação pieloureteral (28,6%. CONCLUSÕES:Hipercalciúria foi a desordem mais encontrada, a alteração anatômica mais comum foi a duplicação pieloureteral e oxalato de cálcio foi o constituinte químico mais frequente. Este trabalho serviu para o conhecimento das características dos pacientes pediátricos portadores de nefrolitíase em nossa região.

National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1992, volume 2

Science.gov (United States)

Bannerot, Richard B. (Editor); Goldstein, Stanley H. (Editor)

1992-01-01

The 1992 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters Washington, DC. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objective of the NASA Centers. This document contains reports 13 through 24.

National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1992, volume 1

Science.gov (United States)

Bannerot, Richard B. (Editor); Goldstein, Stanley H. (Editor)

1992-01-01

The 1992 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, Washington, DC. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objective of the NASA Centers. This document is a compilation of the final reports 1 through 12.

News

Science.gov (United States)

2002-11-01

Resources: First Faulkes Telescope on its way! Events: Everything under the Sun - GIREP 2002 Experiments: The most beautiful experiment, your favourite demonstration Science year: Planet Science takes off Resources: New CD packages Lecture: Fantastic Plastic Summer workshop: The Wright Stuff Resources: Amazing Space 14-16 curriculum: 21st century science ASE conference: ASE 2003 South Africa: Sasol SciFest Earth sciences: JESEI: the answer to all your Earthly problems

Opiniões sobre a doença entre membros da rede social de pacientes de hanseníase no Recife Opinions about Hansen's disease among the members of patients' social network in Recife

Directory of Open Access Journals (Sweden)

Katia V. de O. Feliciano

1997-02-01

Full Text Available O presente artigo descreve um estudo realizado no Recife, Brasil, entre novembro de 1993 e julho de 1994, com a finalidade de explorar as opiniões dos membros da rede social (por exemplo, familiares, amigos e vizinhos de portadores de hanseníase na avaliação, interpretação e manejo das manifestações corporais da doença na trajetória que levou ao diagnóstico. A amostra constou de 93 membros da rede social, com idade entre 20 e 70 anos, que apoiaram o curso de ação de 83 pacientes diagnosticados no período do estudo. A análise buscou detectar variáveis capazes de discriminar os membros da rede de apoio dos pacientes de hanseníase classificados como casos (presença de incapacidades ou lesões precursoras de incapacidades ou controles. O estudo evidenciou a escassez de informações sobre a transmissão da hanseníase e revelou um quadro transicional onde se confrontam expectativa de cura e uma visão estigmatizante das conseqüências da doença. Apenas uma quarta parte dos sujeitos do estudo suspeitou, antes do diagnóstico, que o paciente era portador de hanseníase, o que sugere baixa percepção do risco representado pela doença e reforça a concepção da invisibilidade das suas manifestações corporais. Os resultados mostram um perfil de percepção e manejo da hanseníase que pode facilitar a propagação da doença e a instalação ou agravamento das suas conseqüências físicas e sociais.This article describes a study done in Recife, Brazil, between November 1993 and July 1994 to explore the opinions of the members of the social network (for example, family members, friends, and neighbors of carriers of Hansen's disease regarding their estimation, interpretation, and management of physical manifestations of the disease in the time leading up to diagnosis. The sample consisted of 93 members of the social network, ranging in age between 20 and 70 years, who supported the course of action of 83 patients diagnosed in the

Detection of Mycobacterium leprae DNA for 36kDa protein in urine from leprosy patients: a preliminary report Detecção do DNA do Mycobacterium leprae para proteína 36 kDa na urina de pacientes com hanseníase: relato preliminar

Directory of Open Access Journals (Sweden)

Om Parkash

2004-10-01

Full Text Available We have searched for Mycobacterium leprae DNA for 36kDa protein in urine using a M. leprae specific PCR technique. A limited number of 16 patients (of which 11 belonged to lepromatous leprosy and five to tuberculoid leprosy and eight healthy individuals were included for the present study. The number of urine samples positive by PCR were 36.4% (4/11 in lepromatous patients and 40% (2/5 in tuberculoid patients. None of the samples from healthy individuals was positive. To our knowledge, the results indicate, for the first time, the presence of M. leprae DNA in urine from leprosy patients. Another important finding obtained out of the study is that amongst treated patients 66.6% (4/6 were positive whereas amongst untreated only 20% (2/10 were positive. From the present indicative data it appears that treatment improves the PCR results with urine as a sample. Thus, the approach could prove to be useful for monitoring the treatment response of individual patients and needs to be further evaluated with a large number of patients.Pesquisamos o DNA do Mycobacterium leprae para proteína 36 kDa na urina usando a técnica do PCR específica para M. leprae. Um número limitado de 16 pacientes (dos quais 11 tinham hanseníase multibacilar e cinco hanseníase paucibacilar e oito indivíduos saudáveis foram incluídos neste estudo. O número de amostras de urina positivas pelo PCR foi de 36,4% (4/11 em pacientes com hanseníase multibacilar e 40% (2/5 em pacientes com hanseníase paucibacilar. Nenhuma das amostras de indivíduos saudáveis foi positiva. Até onde chega o nosso conhecimento, os resultados indicam, pela primeira vez, a presença de DNA do M. leprae na urina de pacientes com hanseníase. Outro fato importante obtido através do exame é que entre os pacientes tratados 66.6% (4/6 eram positivos enquanto entre os não tratados somente 20% (2/10 foram positivos. Pelos presentes dados indicativos parece que o tratamento melhora os resultados do

A microfabricated, low dark current a-Se detector for measurement of microplasma optical emission in the UV for possible use on-site

Science.gov (United States)

Abbaszadeh, Shiva; Karim, Karim S.; Karanassios, Vassili

2013-05-01

Traditionally, samples are collected on-site (i.e., in the field) and are shipped to a lab for chemical analysis. An alternative is offered by using portable chemical analysis instruments that can be used on-site (i.e., in the field). Many analytical measurements by optical emission spectrometry require use of light-sources and of spectral lines that are in the Ultra-Violet (UV, ~200 nm - 400 nm wavelength) region of the spectrum. For such measurements, a portable, battery-operated, fiber-optic spectrometer equipped with an un-cooled, linear, solid-state detector may be used. To take full advantage of the advanced measurement capabilities offered by state-of-the-art solid-state detectors, cooling of the detector is required. But cooling and other thermal management hamper portability and use on-site because they add size and weight and they increase electrical power requirements. To address these considerations, an alternative was implemented, as described here. Specifically, a microfabricated solid-state detector for measurement of UV photons will be described. Unlike solid-state detectors developed on crystalline Silicon, this miniaturized and low-cost detector utilizes amorphous Selenium (a-Se) as its photosensitive material. Due to its low dark current, this detector does not require cooling, thus it is better suited for portable use and for chemical measurements on-site. In this paper, a microplasma will be used as a light-source of UV photons for the a-Se detector. For example, spectra acquired using a microplasma as a light-source will be compared with those obtained with a portable, fiber-optic spectrometer equipped with a Si-based 2080-element detector. And, analytical performance obtained by introducing ng-amounts of analytes into the microplasma will be described.

Effects of polymorphisms in ERCC1, ASE-1 and RAI on the risk of colorectal carcinomas and adenomas: a case control study

International Nuclear Information System (INIS)

Skjelbred, Camilla F; Sæbø, Mona; Nexø, Bjørn A; Wallin, Håkan; Hansteen, Inger-Lise; Vogel, Ulla; Kure, Elin H

2006-01-01

The risk of sporadic colorectal cancer is mainly associated with lifestyle factors and may be modulated by several genetic factors of low penetrance. Genetic variants represented by single nucleotide polymorphisms in genes encoding key players in the adenoma carcinoma sequence may contribute to variation in susceptibility to colorectal cancer. In this study, we aimed to evaluate whether the recently identified haplotype encompassing genes of DNA repair and apoptosis, is associated with increased risk of colorectal adenomas and carcinomas. We used a case-control study design (156 carcinomas, 981 adenomas and 399 controls) to test the association between polymorphisms in the chromosomal region 19q13.2-3, encompassing the genes ERCC1, ASE-1 and RAI, and risk of colorectal adenomas and carcinomas in a Norwegian cohort. Odds ratio (OR) and 95% confidence interval (CI) were estimated by binary logistic regression model adjusting for age and gender. The ASE-1 polymorphism was associated with an increased risk of adenomas, OR of 1.39 (95% CI 1.06–1.81), which upon stratification was apparent among women only, OR of 1.66 (95% CI 1.15–2.39). The RAI polymorphism showed a trend towards risk reduction for both adenomas (OR of 0.70, 95% CI 0.49–1.01) and carcinomas (OR of 0.49, 95% CI 0.21–1.13) among women, although not significant. Women who were homozygous carriers of the high risk haplotype had an increased risk of colorectal cancer, OR of 2.19 (95% CI 0.95–5.04) compared to all non-carriers although the estimate was not statistically significant. We found no evidence that the studied polymorphisms were associated with risk of adenomas or colorectal cancer among men, but we found weak indications that the chromosomal region may influence risk of colorectal cancer and adenoma development in women

A haplotype of polymorphisms in ASE-1, RAI and ERCC1 and the effects of tobacco smoking and alcohol consumption on risk of colorectal cancer: a danish prospective case-cohort study

International Nuclear Information System (INIS)

Hansen, Rikke D; Sørensen, Mette; Tjønneland, Anne; Overvad, Kim; Wallin, Håkan; Raaschou-Nielsen, Ole; Vogel, Ulla

2008-01-01

Single nucleotide polymorphisms (SNPs) are the most frequent type of genetic variation in the human genome, and are of interest for the study of susceptibility to and protection from diseases. The haplotype at chromosome 19q13.2-3 encompassing the three SNPs ASE-1 G-21A, RAI IVS1 A4364G and ERCC1 Asn118Asn have been associated with risk of breast cancer and lung cancer. Haplotype carriers are defined as the homozygous carriers of RAI IVS1 A4364G A , ERCC1 Asn118Asn T and ASE-1 G-21A G . We aimed to evaluate whether the three polymorphisms and the haplotype are associated to risk of colorectal cancer, and investigated gene-environment associations between the polymorphisms and the haplotype and smoking status at enrolment, smoking duration, average smoking intensity and alcohol consumption, respectively, in relation to risk of colorectal cancer. Associations between the three individual polymorphisms, the haplotype and risk of colorectal cancer were examined, as well as gene-environment interaction, in a Danish case-cohort study including 405 cases and a comparison group of 810 persons. Incidence rate ratio (IRR) were estimated by the Cox proportional hazards model stratified according to gender, and two-sided 95% confidence intervals (CI) and p-values were calculated based on robust estimates of the variance-covariance matrix and Wald's test of the Cox regression parameter. No consistent associations between the three individual polymorphisms, the haplotype and risk of colorectal cancer were found. No statistically significant interactions between the genotypes and the lifestyle exposures smoking or alcohol consumption were observed. Our results suggest that the ASE-1 G-21A, RAI IVS1 A4364G and ERCC1 Asn118Asn polymorphisms and the previously identified haplotype are not associated with risk of colorectal cancer. We found no evidence of gene-environment interaction between the three polymorphisms and the haplotype and smoking intensity and alcohol consumption

Neurite silenciosa na hanseníase multibacilar avaliada através da evolução das incapacidades antes, durante e após a poliquimioterapia

Directory of Open Access Journals (Sweden)

Pimentel Maria Inês Fernandes

2004-01-01

Full Text Available FUNDAMENTOS: A neurite silenciosa é definida como deterioração da função nervosa na ausência de dor neural, diferenciando-se da neurite franca, em que ocorre dor no nervo periférico, com ou sem prejuízo da função nervosa. Sua detecção precoce é importante para tentar impedir o estabelecimento de seqüelas decorrentes da hanseníase. OBJETIVOS: Conhecer a freqüência das neurites silenciosas em portadores de formas multibacilares de hanseníase. MÉTODOS: Cento e três pacientes (18,4% BB, 47,6% BL e 34% LL foram acompanhados durante o período médio de 64,6 meses a partir do momento do diagnóstico, durante e após a poliquimioterapia, por meio da avaliação do grau de incapacidade. RESULTADOS: Foram analisados doentes que tiveram piora do grau de incapacidade no término de tratamento, ou ao fim do seguimento, em relação ao grau manifestado antes do tratamento ou no término do tratamento medicamentoso. Ao todo, pelo menos cinco pacientes (4,9% do total evoluíram com neurite silenciosa, durante ou após a poliquimioterapia. CONCLUSÃO: Preconiza-se exame neurológico seqüencial cuidadoso dos pacientes multibacilares, de modo a detectar e tratar precocemente a neurite silenciosa.

Pitiríase versicolor circinada: isolamento de Malassezia sympodialis - Relato de caso Pityriasis versicolor circinata: isolation of Malassezia sympodialis - Case report

Directory of Open Access Journals (Sweden)

Valéria Maria de Souza Framil

2010-04-01

Full Text Available Os autores descrevem caso de pitiríase versicolor circinada, cujo agente etiológico isolado foi Malassezia sympodialis em uma mulher de 34 anos. O isolamento e identificação da Malassezia sympodialis foi em ágar Dixon modificado e o método molecular para confirmação da espécie foi PCR-RFLP (polymerase chain reaction and restriction fragment length polymorphism analysis.The authors report a case of pityriasis versicolor circinata whose isolated etiologic agent was Malassezia sympodialis in a 34-year-old woman. The isolation and identification of Malassezia sympodialis were accomplished with modified Dixon's agar, and the molecular method used to confirm the species was polymerase chain reaction and restriction fragment length polymorphism analysis (PCR-RFLP.

To the problem of superfluous cosmic radiation

International Nuclear Information System (INIS)

Savenko, I.A.; Saraeva, M.A.; Shavrin, P.I.

1979-01-01

From consideration of a number of basic works on the excessive cosmic radiation given is the most probable composition (electron, proton, and nuclear components) of this radiation in equatorial regions at altitudes corresponding to minimum altitudes of the drift trajectories hsub(min) <= 0, in case of detecting by detector on the artificial satellite of the Earth (ASE) with the mass up to 1t and of the heavier ASE. The disagreement in spectra of solar cosmic rays obtained along the latitude effect on the ASE. ''Molniya-1'' and in the experiments out of the magnetosphere on the ASE ''Explorer-41'' is explained by excessive radiation production of solar cosmic rays. The comparison of readings of the neutron channel with those of the charged particle channels of the apparatus on the ASE ''Molniya-1'' during the proton event on 25.01.1971 does not contradict to the supposition on the similarity of excessive cosmic radiation production of galactic and solar cosmic rays

Pityriasis versicolor: clinical-epidemiological characterization of patients in the urban area of Buerarema-BA , Brazil Pitiríase versicolor: caracterização clínico-epidemiológica em pacientes da área urbana de Buerarema-BA, Brasil

Directory of Open Access Journals (Sweden)

Juliano Oliveira Santana

2013-04-01

Full Text Available BACKGROUND: Pityriasis versicolor (PV is a cutaneous pigmentation disorder caused by a lipophilic yeast of the genus Malassezia sp. It is a superficial mycosis characterized by well-defined, slightly scaly skin lesions of variable color. In Brazil, the number of reported cases is small, and there are few epidemiological studies. OBJECTIVES: to assess incidence, characteristics of the lesions, effectiveness of the Zileri's Sign procedure, and the epidemiological profile of PV in the urban area of Buerarema - Bahia. METHODS: Biological samples were collected on pre-established days at Basic Health Care Units from July to September 2010. Sample collection was followed by laboratory diagnosis using Porto's Method. RESULTS: Of the 158 patients with suspected PV participating in the study, 105 (66.5% were positive; 72 (68.6% were female and 33 (31.4% were male. Sex and location of lesions showed statistically significant differences (p FUNDAMENTOS: A pitiríase versicolor é um distúrbio de pigmentação cutânea causada pela levedura lipofílica do gênero Malassezia sp. É uma micose superficial caracterizada por produzir lesões delimitadas, com descamação fina e de cor variável. No Brasil, o relato do número de casos e de estudos é restrito. OBJETIVOS: Analisar a incidência, as características das lesões, a eficácia do Sinal de Zileri e o perfil epidemiológico da pitiríase versicolor na área urbana do município de Buerarema-BA. MÉTODOS: Foram coletadas amostras biológicas no período de julho a setembro de 2010, em dias pré-establecidos, nas Unidades Básicas de Saúde. O Método de Porto foi utilizado como diagnóstico laboratorial. RESULTADOS: Dos 158 pacientes cadastrados com suspeita de pitiríase versicolor, 105 (66,5% mostraram-se positivos, sendo 72 (68,6% do sexo feminino e 33 (31,4% do sexo oposto. Ocorreu diferença estatisticamente significante entre sexo e localização das lesões (p<0,05. A região com maior �

Hanseníase históide de localização restrita Histoid leprosy of restricted location

Directory of Open Access Journals (Sweden)

Antônio Pedro Mendes Schettini

2008-10-01

Full Text Available A hanseníase permanece importante problema de saúde pública, e os técnicos de unidades básicas de saúde devem estar capacitados para reconhecer as diversas formas de apresentação clínica da doença. Relata-se caso de paciente com lesões pouco habituais, cujo diagnóstico foi importante por se tratar de doente multibacilar, principal elo da cadeia de transmissão da doença. O diagnóstico e tratamento oportuno desses casos contribuem para atingir as metas de eliminação da doença no país.Leprosy remains a public health problem in Brazil. Every health professional at the primary health care level should be able to detect all presentation forms of leprosy. We report the case of a multibacillary patient with unusual lesions, whose diagnosis was important to interfere in the transmission chain. Diagnosis and adequate treatment contribute to reach the leprosy elimination goal in our country.

Microlithiasis of the gallbladder: role of endoscopic ultrasonography in patients with idiopathic acute pancreatitis Microcolecistolitíase: papel da ecoendoscopia em pacientes com pancreatite aguda sem causa aparente

Directory of Open Access Journals (Sweden)

José Celso Ardengh

2010-01-01

colecistomicrolitíase (cálculos com até 3 mm. Não há, no momento, consenso quanto ao melhor método propedêutico para diagnosticá-lo e, entre os propostos, nenhum apresenta alta sensibilidade. A ecoendoscopia (EE é excelente no diagnóstico da pancreatite crônica incipiente e microcálculos da vesícula biliar (MCV ou colédoco. São poucas as referências na literatura internacional e nenhuma na nacional a respeito do emprego da EE na PA. O objetivo deste trabalho é o de estabelecer o valor da EE no diagnóstico da colecistomicrolitíase em doentes com PA sem causa aparente. MÉTODOS: Trinta e seis pacientes com o diagnóstico de PA sem causa aparente foram consecutivamente estudados durante cinco anos. Dos enviados para exame ecoendoscópico, 21 mulheres e 15 homens com média de idade de 41,6 anos. Todos haviam sido submetidos antes a pelo menos um US e uma TC, que não revelaram alterações na via bílio-pancreática e 63,9% deles tinham apresentado mais de um episódio de PA. O diagnóstico da colecistomicrolitíase pela EE realizada até uma semana durante o surto de PA baseou-se no tamanho do cálculo (até 3 mm, inclusive e hiperecogeneicidade com ou sem sombra acústica. Todos os doentes foram colecistectomizados, após o exame ecoendoscópico. RESULTADO: O exame das peças cirúrgicas mostrou que 27 (75% doentes apresentavam MCV e nove (25% não. A EE levou a erro no diagnóstico da microlitíase em seis (16,8% casos, quatro casos de falsos-positivos e dois casos de falsos-negativos. Em 30 casos (83,2% houve confirmação dos seus resultados. A sensibilidade, a especificidade, os valores preditivos positivo, negativo e a acurácia (com intervalo de confiança de 95% para a EE no diagnóstico dos MCV foram: 92,6% (74,2 a 98,7%, 55,6% (22,7 a 84,7%, 86,2% (67,4% a 95,5%, 71,4% (30,3 a 94,9% e 83,2% (66,5% a 93% respectivamente. CONCLUSÃO: A EE mostra-se, portanto, de grande valor na identificação da colecistomicrolitíase e a PA não deve ser considerada sem

Model of pulse extraction from a copper laser amplifier

International Nuclear Information System (INIS)

Boley, C.D.; Warner, B.E.

1997-03-01

A computational model of pulse propagation through a copper laser amplifier has been developed. The model contains a system of 1-D (in the axial direction), time-dependent equations for the laser intensity and amplified spontaneous emission (ASE), coupled to rate equations for the atomic levels. Detailed calculations are presented for a high-power amplifier at Lawrence Livermore National Laboratory. The extracted power agrees with experiment near saturation. At lower input power the calculation overestimates experiment, probably because of increased ASE effects. 6 refs., 6 figs

National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program: 1995. Volume 1

Science.gov (United States)

Hyman, William A. (Editor); Sickorez, Donn G. (Editor)

1996-01-01

The objectives of the JSC NASA/ASEE Summer Faculty Fellowship Program, which began nationally in 1964 and at JSC in 1965, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of the participants' institutions; and (4) to contribute to the research objectives of the NASA centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project in collaboration with a NASA/JSC colleague. In addition to the faculty participants, the 1995 program included five students. This document is a compilation of the first fifteen of twenty-seven final reports on the research projects completed by the faculty fellows and visiting students during the summer of 1995. The reports of two of the students are integral with that of the respective fellow. Three students wrote separate reports included in Volume 2.

Demarcação da atividade anti-helmíntica do albendazol. Estudo referente à estrongiloidíase humana

Directory of Open Access Journals (Sweden)

Vicente Amato Neto

1985-04-01

Full Text Available Os Autores utilizaram novo anti-helmíntico, o albendazol, no tratamento de 32 pessoas com estrongiloidíase. A casuística foi composta por adultos, de ambos os sexos, que receberam, pela via oral, dose cotidiana única de 400 mg, repetida em três oportunidades intervaladas por períodos de 24 horas. O controle da terapêutica sucedeu através de exames das fezes realizados sete, 14 e 21 dias após o término da administração, tendo sido empregado o método de Rugai, Mattos e Brisola. A porcentagem de curas verificada correspondeu a 28,1% e, ao lado da boa tolerância observada, essa constatação demonstrou baixa eficácia do medicamento em apreço no combate à infecção causada pelo Strongyloldes stercoralis, a despeito de méritos comprovados em investigações anteriores e concernentes a outras parasitoses intestinais.

Effects of polymorphisms in ERCC1, ASE-1 and RAI on the risk of colorectal carcinomas and adenomas: a case control study

Directory of Open Access Journals (Sweden)

Wallin Håkan

2006-07-01

Full Text Available Abstract Background The risk of sporadic colorectal cancer is mainly associated with lifestyle factors and may be modulated by several genetic factors of low penetrance. Genetic variants represented by single nucleotide polymorphisms in genes encoding key players in the adenoma carcinoma sequence may contribute to variation in susceptibility to colorectal cancer. In this study, we aimed to evaluate whether the recently identified haplotype encompassing genes of DNA repair and apoptosis, is associated with increased risk of colorectal adenomas and carcinomas. Methods We used a case-control study design (156 carcinomas, 981 adenomas and 399 controls to test the association between polymorphisms in the chromosomal region 19q13.2-3, encompassing the genes ERCC1, ASE-1 and RAI, and risk of colorectal adenomas and carcinomas in a Norwegian cohort. Odds ratio (OR and 95% confidence interval (CI were estimated by binary logistic regression model adjusting for age and gender. Results The ASE-1 polymorphism was associated with an increased risk of adenomas, OR of 1.39 (95% CI 1.06–1.81, which upon stratification was apparent among women only, OR of 1.66 (95% CI 1.15–2.39. The RAI polymorphism showed a trend towards risk reduction for both adenomas (OR of 0.70, 95% CI 0.49–1.01 and carcinomas (OR of 0.49, 95% CI 0.21–1.13 among women, although not significant. Women who were homozygous carriers of the high risk haplotype had an increased risk of colorectal cancer, OR of 2.19 (95% CI 0.95–5.04 compared to all non-carriers although the estimate was not statistically significant. Conclusion We found no evidence that the studied polymorphisms were associated with risk of adenomas or colorectal cancer among men, but we found weak indications that the chromosomal region may influence risk of colorectal cancer and adenoma development in women.

Dissecting an alternative splicing analysis workflow for GeneChip® Exon 1.0 ST Affymetrix arrays

Directory of Open Access Journals (Sweden)

Calogero Raffaele A

2008-11-01

Full Text Available Abstract Background A new microarray platform (GeneChip® Exon 1.0 ST has recently been developed by Affymetrix http://www.affymetrix.com. This microarray platform changes the conventional view of transcript analysis since it allows the evaluation of the expression level of a transcript by querying each exon component. The Exon 1.0 ST platform does however raise some issues regarding the approaches to be used in identifying genome-wide alternative splicing events (ASEs. In this study an exon-level data analysis workflow is dissected in order to detect limit and strength of each step, thus modifying the overall workflow and thereby optimizing the detection of ASEs. Results This study was carried out using a semi-synthetic exon-skipping benchmark experiment embedding a total of 268 exon skipping events. Our results point out that summarization methods (RMA, PLIER do not affect the efficacy of statistical tools in detecting ASEs. However, data pre-filtering is mandatory if the detected number of false ASEs are to be reduced. MiDAS and Rank Product methods efficiently detect true ASEs but they suffer from the lack of multiple test error correction. The intersection of MiDAS and Rank Product results efficiently moderates the detection of false ASEs. Conclusion To optimize the detection of ASEs we propose the following workflow: i data pre-filtering, ii statistical selection of ASEs using both MiDAS and Rank Product, iii intersection of results derived from the two statistical analyses in order to moderate family-wise errors (FWER.

Adsorbed Carbon Formation and Carbon Hydrogenation for CO_2 Methanation on the Ni(111) Surface: ASED-MO Study

International Nuclear Information System (INIS)

Choe, Sang Joon; Kang, Hae Jin; Kim, Su Jin; Park, Sung Bae; Park, Dong Ho; Huh, Do Sung

2005-01-01

Using the ASED-MO (Atom Superposition and Electron Delocalization-Molecular Orbital) theory, we investigated carbon formation and carbon hydrogenation for CO_2 methanation on the Ni (111) surface. For carbon formation mechanism, we calculated the following activation energies, 1.27 eV for CO_2 dissociation, 2.97 eV for the CO, 1.93 eV for 2CO dissociation, respectively. For carbon methanation mechanism, we also calculated the following activation energies, 0.72 eV for methylidyne, 0.52 eV for methylene and 0.50 eV for methane, respectively. We found that the calculated activation energy of CO dissociation is higher than that of 2CO dissociation on the clean surface and base on these results that the CO dissociation step are the ratedetermining of the process. The C-H bond lengths of CH_4 the intermediate complex are 1.21 A, 1.31 A for the C···H_(_1_), and 2.82 A for the height, with angles of 105 .deg. for H_(_1_)CH and 98 .deg. for H_(_1_)CH_(_1_)

Estudo da mucosa nasal de contatos de hanseníase, com positividade para o antígeno glicolipídio fenólico 1 Nasal mucosa study of leprosy contacts with positive serology for the phenolic glycolipid 1 antigen

Directory of Open Access Journals (Sweden)

Ana Cristina da Costa Martins

2010-10-01

Full Text Available A hanseníase é uma doença infecciosa de evolução crônica causada pelo Mycobacterium leprae que acomete com maior frequência a mucosa nasal. Esse acometimento independe da forma clínica da doença e pode ocorrer mesmo antes do aparecimento de lesões na pele ou em outras partes do corpo. Faz-se necessário a vigilância epidemiológica dos contatos de casos novos de hanseníase para o diagnóstico precoce da doença. OBJETIVOS: Identificar lesões específicas e precoces de hanseníase por meio de exame endoscópico, baciloscópico, histopatológico e da reação em cadeia da polimerase em Tempo Real da mucosa das cavidades nasais dos contatos domiciliares e peridomiciliares com sorologia positiva para o antígeno glicolipídio fenólico. MATERIAL E MÉTODOS: Estudo prospectivo transversal em 31 contatos de pacientes de hanseníase com sorologia positiva (PGL-1, 05 controles negativos e 01 positivo no período de 2003 a 2006. RESULTADOS: Entre os contatos soropositivos a PCR-RT foi positiva para a presença de DNA de M. leprae em 06 (19,35% destes e o maior número de cópias do genoma do bacilo foi encontrado no contato que adoeceu. CONCLUSÃO: Isoladamente os exames da mucosa nasal não permitiram o diagnóstico precoce da hanseníase, mas com a combinação de vários métodos, o exame dos contatos pôde ajudar na identificação da infecção subclínica e monitoramento daqueles que poderiam ter papel importante na transmissão da doença.Leprosy is a chronic infectious disease caused by Mycobacterium leprae. The disease more frequently affects the nasal mucosa and can occur independently of its clinical form or even before lesions on the skin or on other parts of the body. It is necessary to employ epidemiological surveillance of household contacts with new leprosy cases for early disease diagnosis. AIM: identify specific and early leprosy lesions through endoscopic, baciloscopy, histopathology exams, and real time polymerase chain

Pengaruh Market Orientation Terhadap Customer Loyalty Dengan Perceived Quality Dan Customer Experience Sebagai Variabel Perantara Serta Brand Reputation Sebagai Variabel Intervening Di English First Surabaya

OpenAIRE

Santosa, Teguh Wibisono

2015-01-01

- Masuknya AFTA ( ASEAN Free Trade Area ) dan MEA ( Masyarakat Ekonomi ASEAN ) di Indonesia tahun 2015. Berdampak pada kebutuhan SDM yang berkualitas, tentunya salah satu talak ukur kualitas SDM adalah kemampuan berbahasa asing. Hal inilah yang berdampak pada pertumbuhan pelanggan bagi Perusahaan penyedia layanan pendidikan bahasa asing di Indonesia seperti English First, Penelitian ini bertujuan untuk menganalisa pengaruh dari Market Orientation Terhadap Customer Loyalty English First Sur...

Promising Pedagogy: Advancing the Educational Experience of Queer Students Through Transformative Leadership.

Science.gov (United States)

Zook, Thomas

2017-01-01

The school experience for queer youth is often quite different from that of their heterosexual and gender-conforming peers; yet it is often the c ase that little attention is given to the disparate and inequitable educational and social conditions under which lesbian, gay, bisexual, transgender, and queer/questioning (LGBTQ) youth must learn. In fact, the entirety of pedagogical structures in many schools creates milieus where queer youth, those who have loved ones who are queer, and those who are merely perceived to be queer are systematically marginalized and deprived of their right to a safe, supportive, and equitable educational experience. Transformative leadership theory (TLT) inspires educational leaders to create inclusive and excellent schools for all youth. Neither a prescriptive model nor a process-oriented theory, TLT offers eight tenets that operate in concert to form an authentic way of being informing and guiding leaders' decisions and actions toward the goal of individual, organizational, and societal change.

A mucosa oral na hanseníase: um estudo clínico e histopatológico The oral mucosa in leprosy: a clinical and histopathological study

Directory of Open Access Journals (Sweden)

Marilda Aparecida Milanez Morgado de Abreu

2006-06-01

Full Text Available INTRODUÇÃO: a anseníase multibacilar pode causar comprometimento da mucosa oral, com ou sem lesões aparentes. Há poucos estudos que tratam deste assunto na era da multidrogaterapia. OBJETIVO: Verificar a freqüência do comprometimento da mucosa oral em pacientes de hanseníase multibacilar. CASUÍSTICA E MÉTODOS: Foi realizado um estudo transversal em vinte pacientes de hanseníase multibacilar, não-tratados, atendidos consecutivamente em Dracena, São Paulo, entre o período de 2000 e 2002. Foi realizado exame clínico completo da mucosa oral. Os pacientes foram submetidos a biópsias na mucosa jugal, na língua e no palato mole, em alteração ou em pontos pré-estabelecidos. Os cortes foram corados pelas técnicas da hematoxilina-eosina e Ziehl-Neelsen. O encontro de granuloma e bacilos álcool-ácido-resistentes ao exame histopatológico determinou o comprometimento específico. RESULTADOS: O estudo envolveu 19 pacientes multibacilares com tempo médio de evolução de 2,5 anos. Ocorreu comprometimento histopatológico específico em apenas um paciente virchowiano, com mucosa oral clinicamente normal, na língua e no palato mole. CONCLUSÕES: 1. Alteração clínica na mucosa oral não implica em comprometimento pela doença, é necessário confirmação histopatológica. 2. Alterações clínicas específicas aparentes são raras. 3. A mucosa oral clinicamente normal pode exibir comprometimento histopatológico específico.INTRODUCTION: Multibacillary leprosy may involve the oral mucosa, with or without apparent lesions. There are few studies that deal with this issue in the era of multidrug therapy. AIM: To assess the frequence of oral mucosa involvement in multibacillary leprosy patients. PATIENTS AND METHODS: A transversal study with twenty non-treated multibacillary leprosy patients. The patients were treated in Dracena, São Paulo, between 2000 and 2002. Clinical examination of the oral mucosa was carried out. All patients were

Prevalência do complexo teníase-cisticercose na zona rural do município de Viçosa, Minas Gerais Prevalence of Taeniasis-cysticercosis complex in the rural area of Viçosa-MG, Brazil

Directory of Open Access Journals (Sweden)

Adriana Felix Iasbik

2010-07-01

Full Text Available A teníase é uma doença que se manifesta no ser humano em decorrência da presença da forma adulta da Taenia sp., enquanto a cisticercose decorre da infecção pelo estágio larvar da Taenia sp. ou Taenia solium, no caso dos suínos e humanos. Foi realizado um estudo transversal visando a determinar a prevalência de cisticercose em suínos e de teníase em 176 propriedades localizadas na zona rural de Viçosa, Minas Gerais (MG. Foram coletadas amostras de sangue de 226 suínos e fezes de 266 humanos, além da realização de um inquérito epidemiológico. Não foi identificada teníase humana, e a prevalência da cisticercose suína foi de 0,4%. As informações obtidas mostraram que a maioria das pessoas possuía o hábito de consumir carne suína não inspecionada; entretanto, todas as pessoas se alimentavam da carne bem aquecida. Em apenas 1,1% das propriedades, o esgoto era depositado diretamente no solo e em 99,4% destas a água era canalizada, enquanto 88,1% dos suínos eram criados presos. Concluiu-se que, na zona rural do município de Viçosa-MG, a prevalência do complexo teníase-cisticercose foi baixa, mostrando ainda um nível de contaminação inferior ao de outros municípios onde o complexo foi estudado.Taeniasis occurs due to the presence of the adult form of Taenia sp. in human beings, and cysticercosis is caused by the presence of the larval stage of T. solium in pigs and humans. A transversal study was conducted aiming to determine the prevalence of porcine cysticercosis and Taeniasis in 176 farms located in rural areas of Viçosa-MG. Blood samples of 226 pigs, and feces samples of 266 humans were collected. An epidemiological survey has also been done. We found a prevalence of 0.4% of porcine cysticercosis and Taeniasis has not been found. The epidemiological data has shown that although most people consumed non-inspected pork, it used to be prepared well-done. Data showed that 88.1% of the pigs are reared in confinement

National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program: 1995.. Volume 2

Science.gov (United States)

Hyman, William A. (Editor); Sickorez, Donn G. (Editor)

1996-01-01

The JSC NASA/ASEE Summer Faculty Fellowship Program was conducted at JSC, including the White Sands Test Facility, by Texas A&M University and JSC. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of the participants' institutions; and (4) to contribute to the research objectives of the NASA centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project in collaboration with a NASA/JSC colleague. In addition to the faculty participants, the 1995 program included five students. This document is a compilation of the final reports on the research projects completed by the faculty fellows and visiting students during the summer of 1995. The reports of two of the students are integral with that of the respective fellow. Three students wrote separate reports.

Amplified spontaneous emission measurements on the Aurora large aperture module

International Nuclear Information System (INIS)

Oertel, J.A.; Czuchlewski, S.J.; Leland, W.T.; Turner, T.P.

1990-01-01

The large aperture module (LAM) of the Aurora KrF laser can be used to address a number of issues that relate to the scaling of KrF amplifiers to larger ICF systems. Perhaps foremost among these are the possible effects of amplified spontaneous emission (ASE) on laser performance. To assess this problem a 3-D computer code has been developed to model these ASE effects. The code uses an iterative procedure to arrive at a self-consistent steady state solution to the 3-D distribution of coherent and incoherent fluxes within the amplifier. Two-pass energy extraction, wall reflectivity, and nonuniform excitation are included in the model. The authors previously reported the effects of ASE on the small signal gains measured in the 1- x 1- x 2-m 3 LAM. The code also makes quantitative predictions of the ASE that should be generated in the amplifier. This paper indicates the radiance expected for a medium of uniform gain in terms of the (g - ν)L product and the parameter g/a. The quantity (g - ν)L is the product of the net gain and the path length along the direction of observation. The present experiments compare values of ASE measured at various locations around the LAM with the code predictions. The impact of ASE on amplifier output, is also discussed

Impact of an Aging Simulation Game on Pharmacy Students' Empathy for Older Adults.

Science.gov (United States)

Chen, Aleda M H; Kiersma, Mary E; Yehle, Karen S; Plake, Kimberly S

2015-06-25

To evaluate changes in empathy and perceptions as well as game experiences among student pharmacists participating in an aging simulation game. First-year student pharmacists participated in an aging simulation game. Changes were measured pre/post-activity using the Kiersma-Chen Empathy Scale (KCES) and Jefferson Scale of Empathy--Health Professions Scale (JSE-HPS) for empathy and the Aging Simulation Experience Survey (ASES) for perceptions of older adults' experiences and game experiences. Wilcoxon signed rank tests were used to determine changes. One hundred fifty-six student pharmacists completed the instruments. Empathy using the KCES and JSE-HPS improved significantly. Of the 13 items in the ASES, 9 significantly improved. Simulation games may help students overcome challenges demonstrating empathy and positive attitudes toward elderly patients.

Root phosphatase activity, plant growth and phosphorus accumulation of maize genotypes

Directory of Open Access Journals (Sweden)

Machado Cynthia Torres de Toledo

2004-01-01

Full Text Available The activity of the enzyme phosphatase (P-ase is a physiological characteristic related to plant efficiency in relation to P acquisition and utilization, and is genetically variable. As part of a study on maize genotype characterization in relation to phosphorus (P uptake and utilization efficiency, two experiments were set up to measure phosphatase (P-ase activity in intact roots of six local and improved maize varieties and two sub-populations. Plants were grown at one P level in nutrient solution (4 mg L-1 and the P-ase activity assay was run using 17-day-old plants for varieties and 24-day-old plants for subpopulations. Shoot and root dry matter yields and P concentrations and contents in plant parts were determined, as well as P-efficiency indexes. Root P-ase activity differed among varieties, and highest enzimatic activities were observed in two local varieties -'Catetão' and 'Caiano' -and three improved varieties -'Sol da Manhã', 'Nitrodente' and 'BR 106'. 'Carioca', a local variety, had the lowest activity. Between subpopulations, 'ND2', with low yielding and poorly P-efficient plants, presented higher root P-ase activity as compared to 'ND10', high yielding and highly P-efficient plants. In general, subpopulations presented lower P-ase activities as compared to varieties. Positive and/or negative correlations were obtained between P-ase activity and P-efficiency characteristics, specific for the genotypes, not allowing inference on a general and clear association between root-secreted phosphatase and dry matter production or P acquisition. Genotypic variability must be known and considered before using P-ase activity as an indicator of P nutritional status, or P tolerance, adaptation and efficiency under low P conditions.

Revise and Re-evaluate Cross Cultural Understanding Curriculum at Akademi Bahasa Asing Balikpapan (Foriegn Language Academy of Balikpapan

Directory of Open Access Journals (Sweden)

Rachmi Sari Baso

2014-02-01

Full Text Available The study is about the project to revise and re-evaluate the unit of Cross Cultural Understanding curriculum which is taught in the Akademi Bahasa Asing Ballikpapan. The unit is for fifth semester students. The project aimed to provide students' perspectives of cross cultural differences in the workplace with the materials and knowledge that suitable for workplace demands. The information was gained by distributing questionnaires to 2 teachers and 2 employers of multinational companies in Balikpapan. The investigations for teachers were focused on the content, learning activities and materials of the current curriculum. The investigations for the employers were focused on their perspectives on the cross cultural understanding taught in the higher education. The project used Nicholls' cycle model that will be a useful tool to regularly evaluate curriculum based on the situational analysis. As the result, there were some of materials of American business cultural encounter should be revised to meet the companies demands and additional table manners in cultural perspectives should be included in the curriculum. Therefore, the new curriculum will be applied by these materials as the demands of the workplace.

News Conference: Physics brings the community together Training: CERN trains physics teachers Education: World conference fosters physics collaborations Lecture: Physics education live at ASE Prize: Physics teacher wins first Moore medal Festival: European presidents patronize Science on Stage festival Videoconference: Videoconference brings Durban closer to the classroom

Science.gov (United States)

2012-03-01

Conference: Physics brings the community together Training: CERN trains physics teachers Education: World conference fosters physics collaborations Lecture: Physics education live at ASE Prize: Physics teacher wins first Moore medal Festival: European presidents patronize Science on Stage festival Videoconference: Videoconference brings Durban closer to the classroom

Broadband generation by multiple four-wave mixing process due to ASE Q-switching in high-power double-clad ytterbium-doped fiber amplifier

Science.gov (United States)

Chowdhury, Sourav D.; Shekhar, Nishant; Saha, Maitreyee; Sen, Ranjan; Pal, Mrinmay

2014-11-01

Broadband output from 1060nm to 1700nm and cascaded four-wave mixing generated red light pulsing is observed in a fiber amplifier set up consisting of a 5.5m double clad, double D shaped Ytterbium doped fiber, a single clad passive fiber for excess pump absorption and a splitter, both with and without a CW seed. Self-pulsing occurs from ASE due to passive Q-switching by saturable absorption effect of the active fiber and also depends on splice loss. The pulses generate broadband output by multiple four-wave mixing process with maximum broadening efficiency near 1300nm which is the zero dispersion wavelength for silica fiber. Pulses traveling both in forward and backward direction have enough peak power and energy to damage splice points and fiber components. When seeded the self-pulsing and broadband generation is often suppressed but again generate at increased pump powers.

Dapsone hypersensitivity syndrome in an adolescent during treatment during of leprosy Síndrome de hipersensibilidade à dapsona em uma adolescente durante tratamento de hanseníase

Directory of Open Access Journals (Sweden)

Fábio Bucaretchi

2004-04-01

Full Text Available A 12 y old girl was admitted 24 days after start a WHO multidrug therapy scheme for multibacillary leprosy (dapsone, clofazimine and rifampicin with intense jaundice, generalized lymphadenopathy, hepatoesplenomegaly, oral erosions, conjunctivitis, morbiliform rash and edema of face, ankles and hands. The main laboratory data on admission included: hemoglobin, 8.4 g/dL; WBC, 15,710 cells/mm³; platelet count, 100,000 cells/mm³; INR = 1.49; increased serum levels of aspartate and alanine aminotransferases, gamma-glutamyl transpeptidase, alkaline phosphatase, direct and indirect bilirubin. Following, the clinical conditions had deteriorated, developing exfoliative dermatitis, shock, generalized edema, acute renal and hepatic failure, pancytopenia, intestinal bleeding, pneumonia, urinary tract infection and bacteremia, needing adrenergic drugs, replacement of fluids and blood product components, and antibiotics. Ten days after admission she started to improve, and was discharged to home at day 39th, after start new supervised treatment for leprosy with clofazimine and rifampicin, without adverse effects. This presentation fulfils the criteria for the diagnosis of dapsone hypersensitivity syndrome (fever, generalized lymphadenopathy, exfoliative rash, anemia and liver involvement with mixed hepatocellular and cholestatic features. Physicians, mainly in geographical areas with high prevalence rates of leprosy, should be aware to this severe, and probably not so rare, hypersensitivity reaction to dapsone.Menina, 12 anos, foi admitida referindo o uso de esquema de poliquimioterapia preconizado pela OMS para tratamento de hanseníase forma multicibacilar (dapsona, rifampicina e clofazimina há 24 dias, apresentando icterícia, linfadenomegalia generalizada, hepatoesplenomegalia, conjuntivite, úlceras orais, exantema morbiliforme e edema de face, mãos e tornozelo. Os principais achados laboratoriais à admissão incluíam: hemoglobina, 8,4 g

Columnar recombination for X-ray generated electron-holes in amorphous selenium and its significance in a-Se x-ray detectors

International Nuclear Information System (INIS)

Bubon, O.; Jandieri, K.; Baranovskii, S. D.; Kasap, S. O.; Reznik, A.

2016-01-01

Although amorphous selenium (a-Se) has a long and successful history of application in optical and X-ray imaging, some of its fundamental properties are still puzzling. In particularly, the mechanism of carrier recombination following x-ray excitation and electric field and temperature dependences of the electron-hole pair creation energy (W_e_h_p) remain unclear. Using the combination of X-ray photocurrent and pulse height spectroscopy measurements, we measure W_e_h_p in a wide range of temperatures (218–320 K) and electric fields (10–100 V/µm) and show that the conventional columnar recombination model which assumes Langevin recombination within a column (a primary electron track) fails to explain experimental results in a wide range of electric fields and temperatures. The reason for the failure of the conventional model is revealed in this work, and the theory of the columnar recombination is modified to include the saturation of the recombination rate at high electric field in order to account for the experimental results in the entire range of fields and temperatures.

Prevalência e aspectos epidemiológicos da giardíase em creches no município de Aracaju, SE, Brasil

Directory of Open Access Journals (Sweden)

Gileno de Sá Cardoso

1995-03-01

Full Text Available A survey of the giardiasis prevalence was done in children from 2 till 5 years old who frequented two day nurseries ("A " and "B ". Its relation with some epidemiological aspects through the realization of parasitological exams of stool and an inquiry applied to mothers. Inday nursery "A " with a higth standard of life, 20 (66.6% of 30 inquired children were parasitised and all the children in day nursery "B" had some enteroparasite. Giardia lamblia wasfound in 15 (50% of the children-in better standart of life and in 19 (63.3% of the children with a lower one. The ingesting of vegetables was the only allied factor to the high degree of giardiasis, in day nursery "A ". The day nursery "B " suffered influences from other aspects: no potable water in the residences, the inappropriate destiny of the garbage, the ingesting of vegetables habit and collective bedroom. The adequate sanitation and the existence of domestic animals were not related to parasitism by Giardia lamblia.Foi feito um levantamento da prevalência de giardíase entre crianças na faixa etária de 2 a 5 anos que frequentam duas creches ("A " e "B '' e sua relação com alguns aspectos epidemia lógicos, através da realização de exames parasitológicos de fezes e de inquérito familiar aplicado às mães. Na creche "A ", com padrão sócio-econômico elevado, 20 (66,6% das 30 crianças pesquisadas apresentavam-se parasitadas e na creche "B " todas possuíam algum enteroparasita. Giardia lamblia foi encontrada em 15 (50,0% das crianças da creche com melhor nível sócio-econômico e em 19 (63,3 %das crianças com nívelmais baixo. O hábito de ingerir hortaliças foi o único fator aliado ao alto grau de giardíase na creche "A A creche "B" sofreu influência de outros aspectos: água não potávelnas residências, destino inadequado do lixo, hábito de ingerir hortaliças e dormitório coletivo. O destino inadequado dos dejetos e a existência de animais domésticos n

Validação de questionários de avaliação da qualidade de vida em pacientes de psoríase Validation of life quality questionnaires for psoriasis patients

Directory of Open Access Journals (Sweden)

Gladys Aires Martins

2004-10-01

Full Text Available A psoríase é doença crônica que acomete entre 0,1 e 3% da população mundial e cujo impacto social e psicológico costuma ser subestimado.¹ Muitos estudos têm relatado o impacto produzido por essa doença na qualidade de vida dos pacientes, e questionários para analisar objetivamente essa incapacidade estão sendo descritos.1,2 É importante avaliar a percepção do portador de psoríase em relação a seu estado de saúde, incapacidade e qualidade de vida a fim de estabelecer a melhor terapêutica para cada indivíduo. Este artigo de EMC-D aborda a validação de dois questionários de avaliação da qualidade de vida para a língua portuguesa.Psoriasis is a chronic disease that affects about 0.1 to 3% of the world's population and most people underestimate the social and psychological impact of the disease.¹ MSeveral studies have described the many ways in which psoriasis affects patients' lives, and techniques have been described to quantify the disability caused.1,2 It is important to assess the perceived levels of health status, disability and quality of life when considering what kind of treatment options to offer patients with psoriasis. Underscoring the importance of this, the EMC-D article focuses on a validation of two quality of life questionnaires translated into Brazilian Portuguese.

Betametasona e extrato aquoso de Arctium lappa no tratamento da angiostrongilíase Betamethasone and aqueous extract of Arctium lappa for treating angiostrongyliasis

Directory of Open Access Journals (Sweden)

Camila Argenta Fante

2008-12-01

Full Text Available Angiostrongylus costaricensis é um parasita que causa angiostrongilíase abdominal em humanos, seu tratamento inclui o uso de antiinflamatórios apesar da falta de estudos que justifiquem esta conduta. O objetivo deste artigo é avaliar o efeito da betametasona e da Arctium lappa na evolução de lesões intestinais induzidas pelo parasita. Utilizou-se camundongos Swiss, machos, adultos, distribuídos em 4 grupos: infectados tratados com betametasona; com Arctium lappa; não tratados e grupo controle. Os tratamentos iniciaram no 15º dia de infecção e permaneceram por 15 dias. Infiltrado eosinofílico e granuloma foram avaliados (1-leve; 2-moderado; 3-severo. A betametasona permitiu a evolução das lesões para formas mais graves, enquanto o extrato não interferiu na progressão da patologia. As substâncias empregadas não mostraram eficácia na proteção das lesões induzidas pelo Angiostrongylus costaricensis em camundongos. Estes achados desmotivam o uso de betametasona e Arctium lappa em humanos acometidos por angiostrongilíase abdominal.Angiostrongylus costaricensis is a parasite that causes abdominal angiostrongyliasis in humans. The treatment for it includes the use of anti-inflammatory drugs, despite the lack of studies to justify this approach. The objective of this paper was to evaluate the effect of betamethasone and Arctium lappa on the evolution of intestinal lesions induced by this parasite. Adult male Swiss mice were used, distributed into four groups: infected and treated with betamethasone; infected and treated with Arctium lappa; infected and not treated; and control group. The treatments were started on the 15th day after infection and continued for 15 days. The presence of eosinophilic infiltration and granuloma was evaluated (1-mild; 2-moderate; 3-severe. Betamethasone allowed the lesions to evolve into more severe forms, while the extract did not interfere with disease progression. The substances applied were

Impact of an Aging Simulation Game on Pharmacy Students’ Empathy for Older Adults

Science.gov (United States)

Kiersma, Mary E.; Yehle, Karen S.; Plake, Kimberly S.

2015-01-01

Objective. To evaluate changes in empathy and perceptions as well as game experiences among student pharmacists participating in an aging simulation game. Methods. First-year student pharmacists participated in an aging simulation game. Changes were measured pre/post-activity using the Kiersma-Chen Empathy Scale (KCES) and Jefferson Scale of Empathy – Health Professions Scale (JSE-HPS) for empathy and the Aging Simulation Experience Survey (ASES) for perceptions of older adults’ experiences and game experiences. Wilcoxon signed rank tests were used to determine changes. Results. One hundred fifty-six student pharmacists completed the instruments. Empathy using the KCES and JSE-HPS improved significantly. Of the 13 items in the ASES, 9 significantly improved. Conclusion. Simulation games may help students overcome challenges demonstrating empathy and positive attitudes toward elderly patients. PMID:26396274

Estudo retrospectivo de 66 casos de urolitíase obstrutiva em ovinos

Directory of Open Access Journals (Sweden)

Janaina Azevedo Guimarães

2012-09-01

Full Text Available Objetivou-se realizar um estudo retrospectivo dos principais achados epidemiológicos, clínicos, patológicos e laboratoriais de ovinos acometidos por urolitíase obstrutiva, atendidos na Clínica de Bovinos, Campus Garanhuns/ UFRPE. Para isso, foram analisadas 66 fichas clínicas de ovinos, todos machos não castrados, com idade entre dois meses e cinco anos. A maioria dos casos (79,63% ocorreu na época chuvosa. A maioria dos animais (87,88% era criada intensivamente e todos eram alimentados com concentrados. Os sinais clínicos mais importantes foram as manifestações de dor, congestão de mucosas, hipertermia e aumento da tensão abdominal associados a obstrução do trato urinário. Metade dos animais apresentou obstrução total da uretra. Destes, 69,70% morreram, enquanto nos casos de obstrução parcial, 30,30% morreram. Nos exames laboratoriais verificou-se neutrofilia e desvio à esquerda regenerativo, hiperfibrinogenemia e azotemia. Na urinálise constatou-se hematúria em 89,29% dos casos e pH ácido em 46,43%. Na sedimentoscopia predominaram hemácias, leucócitos, células de descamação do epitélio uretral e cristais de urato amorfo. Os achados necroscópicos renais mais frequentes foram pielonefrite (61,54% dos casos e hidronefrose (50%. Nos ureteres foram visualizados ureterite e hidroureter. Na bexiga foi mais evidente a cistite hemorrágica difusa (50% e a presença de urólitos (57,69%. Na uretra observaram-se urólitos (61,54% e uretrite hemorrágica difusa (57,69%. Quanto à composição dos urólitos predominaram os compostos por oxalato de cálcio hidratado. Conclui-se que no Agreste de Pernambuco a urolitiase é uma doença importante de ovinos, com alta letalidade, estando associada à alimentação rica em concentrados e sal mineral.

Qual é o tipo de fototerapia mais comumente indicada no tratamento da psoríase?: UVB banda estreita e PUVA: comportamento da prescrição What is the most common phototherapy prescription for psoriasis: NB-UVB or PUVA? Prescription behavior

Directory of Open Access Journals (Sweden)

Ida Duarte

2009-07-01

Full Text Available FUNDAMENTOS: Formas moderada e grave de psoríase requerem fototerapia e/ou medicações sistêmicas. Tanto UVB banda estreita quanto fototerapia UVA com psoralênicos (PUVA podem ser utilizadas no tratamento dessas formas de psoríase, sendo comprovada a efetividade de ambas as terapias. OBJETIVOS: Avaliar as indicações de dois tipos de fototerapia no tratamento da psoríase refratária à terapia tópica: UVB banda estreita e PUVA. MÉTODOS: Entre janeiro de 2006 e dezembro de 2007, os pacientes encaminhados a dois serviços de fototerapia foram incluídos neste estudo. Dados sobre os casos e tipos de prescrição foram coletados de maneira retrospectiva. RESULTADOS: Dentre os 67 pacientes estudados, 51 (76% foram tratados com UVB banda estreita. As razões para sua indicação foram presença de psoríase em gotas (22%, presença de finas placas (15%, uso de drogas fotossensibilizantes (15%, idade abaixo de 20 anos (9%, fototipo I (9% e doença hepática (6%. Os 16 (24% restantes foram tratados com PUVA. A principal indicação dessa terapia foi gravidade da doença (15%, seguida de fototipo IV (9%. CONCLUSÕES: As prescrições de UVB banda estreita excederam as de PUVA devido ao menor número de contraindicações, menor possibilidade de efeitos colaterais, e ainda por ser uma opção mais prática.BACKGROUND: Moderate and severe forms of psoriasis require phototherapy and / or systemic medications. Both UVA and UVB can be used to treat cases of moderate and severe psoriasis, and the effectiveness of both has been proven. OBJECTIVE: to access the prescription behavior relating to two types of phototherapy for treating psoriasis refractory to topical treatment: narrowband UVB (NB-UVB or psoralen plus UVA phototherapy (PUVA. METHODS: Between January 2006 and December 2007, patients referred to two phototherapy services were included in this study. Data on the cases and on the type of prescription were collected retrospectively. RESULTS

Hanseníase: um estudo sobre a experiência da enfermidade de pacientes em Salvador-Bahia

OpenAIRE

Martins, Patrícia Vieira

2013-01-01

A pesquisa que originou esta tese foi realizada com indivíduos residentes no Estado da Bahia, que buscaram tratamento em um hospital de referência na cidade de Salvador, e teve como objetivo responder, a partir de uma perspectiva socioantropológica, a uma série de indagações, tais como: de que maneira os pacientes construíram a experiência da enfermidade vivenciada por eles; qual foi a repercussão social da doença em suas vidas; quais os significados atribuídos a ela; quais as estratégias de ...

Representações sociais e hanseníase em São Domingos do Capim: um estudo de caso na Amazônia Social representations and hansen's disease in São Domingos do Capim, state of Pará: a study in brazilian Amazon

Directory of Open Access Journals (Sweden)

Anete Umbelina Ferreira de Almeida Lins

2010-01-01

Full Text Available Este estudo analisa as representações sociais da hanseníase em São Domingos do Capim-PA, a partir da perspectiva da antropologia da doença. As representações são compreendidas como estruturas dinâmicas socialmente construídas que fundamentam as ações dos sujeitos e dos grupos na resolução dos episódios de doença e na produção de sentido para as experiências de adoecimento. Para compreender a lógica das interpretações da doença, foram reconstituídos os itinerários terapêuticos dos doentes, a partir de dados coletados na observação de campo, realizada ao longo de quatro anos, e entrevistas narrativas com doentes, familiares e agentes comunitários de saúde. Foram deduzidas quatro categorias nosológicas êmicas referentes aos sintomas da hanseníase - "manchas", "lepra", "feitiço" e "hanseníase" -, que constituem o repertório a partir do qual as interpretações e práticas são formuladas. O uso das diferentes categorias ocorre segundo esquemas locais que permitem a avaliação dos contextos pessoal e social de irrupção da doença numa dinâmica que articula as percepções do doente e de seus familiares, as interpretações e diagnósticos de curadores tradicionais e a abordagem dos profissionais da Biomedicina. O estudo mostra que o repertório interpretativo e os meios terapêuticos da Biomedicina são reinterpretados, pelos doentes, segundo a lógica das representações e das práticas locais de saúde, e que o controle da endemia hansênica pressupõe a compreensão das dinâmicas sociais implicadas nas interpretações e práticas da doença, de forma a possibilitar o estabelecimento de uma relação dialógica entre os profissionais de saúde e os atores locais.This study analyzes the social representations of Hansen's disease in São Domingos do Capim-PA, from the perspective of the anthropology of disease. The representations are understood as socially constructed dynamic structures that underlie the

Avaliação da expressão de interleucina 1 beta (IL-1β e antagonista do receptor de interleucina 1 (IL-1Ra em pacientes com hanseníase Evaluation of the expression of interleukin 1 beta(IL-1β and interleukin 1 receptor antagonist (IL-1Ra in leprosy patients

Directory of Open Access Journals (Sweden)

Rosane Dias Costa

2008-01-01

Full Text Available A hanseníase é uma doença infectocontagiosa espectral que acompanha-se por uma série de eventos imunológicos desencadeados pela resposta do hospedeiro frente ao agente etiológico, o Mycobacterium leprae. Evidências sugerem que a indução e manutenção da resposta imune/inflamatória na hanseníase estão vinculadas a interações de múltiplas células e fatores solúveis, particularmente através da ação de citocinas. Nesse estudo, foram mensurados níveis de IL-1β e IL-1Ra de 37 casos novos de hanseníase acompanhados ao longo do tratamento e 30 controles sadios pelo teste ELISA. A coleta de sangue periférico foi realizada em quatro tempos para os casos de hanseníase (pré-tratamento com PQT, 2ª dose, 6ª dose e pós-PQT e em único momento para os controles. Na comparação dos níveis das moléculas de casos no pré-PQT e controles, houve diferença estatisticamente significativa somente para IL-1β. Nossos resultados sugerem a participação dessa citocina no processo imune/inflamatório.Leprosy is an infectious and contagious spectral disease accompanied by a series of immunological events triggered by the host's response to the etiologic agent, Mycobacterium leprae. Evidence suggests that the induction and maintenance of the immune/inflammatory response in leprosy are linked to multiple cell interactions and soluble factors, mainly through the action of cytokines. The ELISA test was used to measure the levels of IL-1β and IL-1Ra in 37 new leprosy patients followed-up during treatment and 30 healthy controls. Peripheral blood was collected four times during the treatment of leprosy patients (MDT pretreatment, 2nd dose, 6th dose and post-MDT, and only once from the controls. The comparison of molecular levels in pre-MDT patients and controls showed a statistically significant difference for IL-1β. The results suggest the participation of this cytokine in the genesis of the immune/inflammatory process.

Sorologia da hanseníase utilizando PGL-I: revisão sistemática Leprosy serology using PGL-I: a systematic review

Directory of Open Access Journals (Sweden)

Rodrigo Scaliante de Moura

2008-01-01

Full Text Available A sorologia utilizando o antígeno espécie-específico do Mycobacterium leprae, PGL-I, pode ser um marcador de carga bacteriana em pacientes com hanseníase. Estudos identificaram potencial de uso da sorologia na classificação de pacientes para fins de tratamento, monitoramento de terapia, risco de recidiva e na seleção dos contatos com maior risco de adoecer. Foi realizada uma revisão sistemática e 26 artigos foram incluídos na análise comparativa. Avaliamos os resultados do uso da sorologia PGL-I em diferentes situações, suas limitações e possíveis aplicações. Estudos mostraram eficácia da sorologia PGL-I na classificação de pacientes, monitoramento da terapia, e nas reações hansênicas como teste preditivo. Para diagnóstico precoce e seguimento de população de alto risco, as metodologias utilizadas ainda não demonstraram custo-benefício favorável, porém estudos indicam que a utilização do teste poderá influenciar positivamente nos programas de controle da hanseníase. Com técnicas simples e robustas, o uso da sorologia PGL-I é viável.Serology using a species-specific antigen for Mycobacterium leprae, PGL-I, could be a marker for the bacterial load of patients with leprosy. Various studies have identified the potential use of serology in the classification of patients for treatment purposes, case monitoring, identification of the risk of relapse and selection of household contacts with a higher risk of contracting the disease. A systematic review of the literature was conducted and 26 articles were included in this comparative analysis. The results of the use of PGL-I serology in different situations, its limitations and possible applications were evaluated. Studies show the efficacy of PGL-I serology in the classification of patients, treatment monitoring and as a predictive test for leprosy reactions. To improve early diagnosis and follow-up of the population at greatest risk of developing leprosy, the

UVB suscetibilidade como fator de risco para o desenvolvimento da hanseníase virchowiana UVB susceptibility as a risk factor to the development of lepromatous leprosy

Directory of Open Access Journals (Sweden)

Mecciene Mendes Rodrigues

2010-12-01

Full Text Available FUNDAMENTOS: A radiação ultravioleta B (RUVB é o mais importante fator ambiental capaz de modificar a função imunológica da pele humana. OBJETIVO: estudar a associação entre o fenótipo de suscetibilidade ou resistência à radiação RUVB e as formas polares da hanseníase. MATERIAL E MÉTODOS: foram avaliados 38 pacientes com hanseníase virchowiana (MHV e 87 pacientes com hanseníase tuberculoide (MHT de acordo com a classificação de Ridley e Jopling (1966. Todos os pacientes foram submetidos ao teste para determinação do fenótipo de suscetibilidade ou resistência à RUVB por meio da aplicação de um disco de dinitroclorobenzeno (DNCB a 2% em uma área de pele previamente irradiada com duas vezes a dose eritematosa mínima (DEM. Após 21 dias, outra aplicação de um disco similar de DNCB a 0,05% na região escapular (área não exposta à RUVB foi realizada para avaliar se houve sensibilização, com leitura após 48 horas. Os pacientes que apresentaram reação positiva ao DNCB foram considerados UVB-resistentes e o oposto foi considerado para aqueles que não apresentaram resposta (UVB-suscetíveis. RESULTADOS: A frequência de UVB-suscetíveis foi de 63,2% (24 pacientes no grupo MHV e 34,4% (30 pacientes no grupo MHT (OR = 3,26; IC = 1,36-7,87; x² = 7,73; p = 0,005. CONCLUSÃO: Os resultados sugerem que a UVB-suscetibilidade é um fator de risco para o desenvolvimento da MHV.BACKGROUNDS: Ultraviolet radiation B (UVRB is the most important environmental factor capable of altering the immune function of human skin. OBJECTIVE: To evaluate the association of the phenotypes of susceptibility or resistance to ultraviolet radiation B (UVRB and the polar forms of leprosy. MATERIAL AND METHODS: We evaluated 38 patients with lepromatous leprosy (LL and 87 patients with tuberculoid (TT leprosy, according to the classification by Ridley and Jopling (1966. All the patients were submitted to a test to determine the phenotypes of

Vigilância da hanseníase em Olinda, Brasil, utilizando técnicas de análise espacial Leprosy surveillance in Olinda, Brazil, using spatial analysis techniques

Directory of Open Access Journals (Sweden)

Tiago Lapa

2001-10-01

Full Text Available Contribui-se com o sistema de Vigilância Epidemiológica em nível local por meio de análise espacial em razão do predomínio do caráter urbano da hanseníase em nosso meio e por sua distribuição não homogênea - em parte, pela forma de ocupação e transformação do espaço urbano. Trabalha-se o conceito de risco coletivo pela definição de micro-áreas homogêneas mediante o indicador de carência social, verificando-se sua coerência com padrões da distribuição da hanseníase obtidos da base de dados do SINAN para o Município de Olinda no período 1991-96. Para cada estrato, definido segundo níveis semelhantes dos indicadores, foi calculado o coeficiente de detecção médio para o período. Ao exame da associação entre carência social (risco e coeficiente de detecção de hanseníase obteve-se coeficiente de explicação de 66,1% no modelo multiplicativo, acrescido para 84,3% com a variável renda. Para atender à lógica de intervenção, definiram-se estratos de alto, médio e baixo risco nos distritos sanitários e área programática. A construção desses mapas mostrou-se útil a instrumentalizar o planejamento em nível local.In the State of Pernambuco, Brazil, leprosy has been mainly an urban disease, with an uneven geographical distribution related at least partially to the way urban space has been occupied and transformed. Spatial analysis may thus become an important tool to establish an epidemiological surveillance system for leprosy. Homogeneous micro-areas were defined in the city of Olinda through the integration of two databases, the Population Census and SINAN, and through the use of digital maps and geoprocessing techniques. Census tracts were classified according to a social deprivation index (SDI, and micro-area homogeneity was based on similar values for this indicator. Cluster analysis (K-means was used to define cut-offs between strata. The same procedure was repeated using the income variable only

Measurement of amplified spontaneous emission at 200 A

International Nuclear Information System (INIS)

Ceglio, N.M.

1985-01-01

Recent interest in the production of laser radiation at soft x-ray wavelengths makes appropriate the discussion of diagnostic considerations and techniques for the measurement of same. A source of soft x-ray ASE has a number of characteristics which drive the design of diagnostic instruments: (1) the anisotropy of the ASE makes target alignment a critical part of the diagnosis, and couples collection solid angle to S/N considerations in the measurement; (2) the narrow linewidth of the amplified emission and its long wavelength put a high S/N premium on spectroscopic instrumentation of high spectral resolution and good higher-order discrimination; (3) the specialized plasma conditions required to produce gain are typically short lived, requiring time-resolved or at least time-discriminating spectroscopy; (4) the nonlinear nature of the threshold processes involved in ASE requires instrumentation of large dynamic range, broad angular acceptance, and large field of view and depth of focus. Of the many possible methods for gain verification of the x-ray source, five are discussed: (1) probe amplification; (2) spatial coherence measurement (as a function of gain length); (3) output intensity measurement (absolute measurement and nonlinear variation with gain length); (4) divergence measurement; and (5) cavity formation. In addition, recent soft x-ray laser experiments at LLNL are discussed along with descriptions of the instruments used to measure the ASE. Diagnostic design suggestions for future soft x-ray laser experiments are also presented

Pitiríase versicolor: isolamento e identificação das principais espécies de Malassezia Pityriasis versicolor: isolation and identification of the main species

Directory of Open Access Journals (Sweden)

Valéria Maria de Souza Framil

2010-02-01

Full Text Available As espécies do gênero Malassezia isoladas foram: Malassezia sympodialis (16,66%, Malassezia furfur (12,50%, Malassezia globosa (11,45% e Malassezia slooffiae (2,10%. A Malassezia sympodialis foi a espécie que predominou em nosso estudo. As espécies de Malassezia identificadas não mostraram correlação com as variantes clínicas e com a distribuição das lesões de pitiríase versicolor quanto às regiões do corpo.Species of the genus Malassezia isolated were: Malassezia sympodialis (16.66%, Malassezia furfur (12.50%, Malassezia globosa (11.45%, and Malassezia slooffiae (2.10%. Malassezia sympodialis predominated in the study. The species of Malassezia identified did not show correlation with clinical variants and with the distribution of pityriasis versicolor lesions in relation to areas of the body.

Membangkitkan Motivasi Belajar Bahasa Indonesia bagi Penutur Asing (BIPA Melalui Media Komik

Directory of Open Access Journals (Sweden)

Randi Ramliyana

2016-12-01

Full Text Available Abstract: This research used a qualitative method with case study approach. The aim of this research is to describe the use of media comic to raise the motivation to learn in learning Indonesian for Foreign Speakers (BIPA at Trisakti University Language Center. One of the biggest problems facing the BIPA learning is learning motivation of participants. There are many reasons the participants are less motivated to learn BIPA, one of which is a boring classroom atmosphere. One thing we know to raise the motivation to study participants is to give something extraordinary and new in BIPA learning, especially among participants adolescence and early adulthood. The results showed that comics can be used efficiently to generate motivation to learn BIPA participants. Therefore, the use of comics into learning will have the same impact with the use of the method of learning the game in BIPA. It provides a pleasant atmosphere in the classroom. Comics are not just entertaining and engaging participants, but also there are many reasons to use it in teaching BIPA. Keywords: universal pragmatism; motivation; comic; media; BIPA Abstrak: Penelitian ini menggunakan metode kualitatif dengan pendekatan studi kasus. Tujuan penelitian ini mendeskripsikan penggunaan media komik untuk membangkitkan motivasi belajar pada pembelajaran Bahasa Indonesia bagi Penutur Asing (BIPA di Pusat Bahasa Universitas Trisakti Jakarta. Salah satu masalah terbesar yang dihadapi dalam pembelajaran BIPA ialah motivasi belajar peserta.  Banyak alasan peserta kurang  termotivasi  dalam  belajar  BIPA,  salah  satunya  adalah suasana kelas yang membosankan. Salah satu yang dapat membangkitkan  motivasi  belajar  peserta adalah dengan memberikan suatu  hal  yang luar biasa dan baru di dalam pembelajaran BIPA, terutama di antara peserta usia remaja dan dewasa awal. Hasil penelitian menunjukkan bahwa komik dapat digunakan secara efisien untuk membangkitkan motivasi belajar peserta

Anemarrhena asphodeloides Non-Steroidal Saponin Components Alter the Pharmacokinetic Profile of Its Steroidal Saponins in Rat.

Science.gov (United States)

Tang, Zhishu; Li, Guolong; Yang, Jie; Duan, Jinao; Qian, Dawei; Guo, Jianming; Zhu, Zhenhua; Song, Zhongxing

2015-06-26

A rapid, selective and sensitive UPLC-MS/MS assay was established to determine the plasma concentrations of four steroidal saponins. Sprague-Dawley rats were allocated to four groups which were orally administered Anemarrhena asphodeloides extracts (ASE), ASE combined with macromolecular fraction (ASE-MF), ASE combined with small molecule fraction (ASE-SF) and ASE combined with small molecule and macromolecular fraction (ASE-SF-MF) containing approximately the same dose of ASE. At different time points, the concentration of timosaponin BII, anemarsaponin BIII, timosaponin AIII and timosaponin E1 in rat plasma were determined and main pharmacokinetic parameters including Cmax, Tmax, T1/2, AUC were calculated using the DAS 3.2 software package. The statistical analysis was performed using the Student's t-test with p saponins. It was found that Cmax and AUC of four steroidal saponins in group ASE-SF and ASE-SF-MF, were significantly increased compared with those in group ASE. These results indicate that SF in A. asphodeloides extracts could increase the absorption and improve the bioavailability of the steroidal saponins.

Electron beams accelerated with two TW class lasers. Preplasma effect of target materials

International Nuclear Information System (INIS)

Bergaux, M.; Gobet, F.; Tarisien, M.; Hannachi, F.; Aleonard, M.M.; D'Humieres, E.; Nicolai, P.; Tikhonchuk, V.; Malka, G.; Debayle, A.

2010-01-01

Complete text of publication follows. It is well known that ultra short pulses of UH1 lasers in the TW domain can produce energetic electrons above 10 MeV. For nuclear physics purposes the range 10-100 MeV is well appropriate to explore (g,xn) reactions. These reactions are of interest, in particular, to study the production of isomers in plasma in relation with astrophysical problems. Meanwhile a careful study of the produced photons is of interest for the study of intense photon 'beams' (radiography, ignition in the Inertial Fusion physics). In both cases, the optimization of these photon beams as regards the number of photons as well as their angular dispersion is important. From previous experiments, with polypropylene targets, it has been shown that both the target thickness and the preplasma conditions influenced the distributions of the produced electrons. Here we investigate the effect of the target atomic number (Z) on the electron production. The experiments have been done with two TW class lasers, with fs pulses; targets of CH, Al, Cu, Au and Ta have been used. All the targets had the same thickness (10 μm). The energy distribution of the electrons and their angular distribution have been characterized. Both lasers had nearly the same energy, the pulse duration was respectively 40 and 80 fs, respectively at LOA (Palaiseau) and IOQ (Iena). The main differences of the lasers regarded the contrast (10 6 at LOA, 10 7 at IOQ) and the ASE duration (2 ns or 0.5 ns). In presence of a large ASE the number of electrons above 10 MeV were ∼ 10 9 , roughly 3 orders of magnitude higher than without ASE. As regards the angular dispersion of electrons above 10 MeV, measured at LOA, it was increasing progressively between CH targets and Au ones, ranging from 10 deg to 40 deg between these increasing atomic numbers. The explanation of such a flagrant difference in the results of these two apparently similar experimental campaigns is related to the size and form of

Estudo comparativo preliminar entre os alongamentos proprioceptivo e estático passivo em pacientes com seqüelas de hanseníase Preliminary comparative study between proprioceptive and passive static stretching in patients with leprosy sequelae

OpenAIRE

Augusto Floricel Diaz; Fabio Luiz Moro; Jussara Machado Binotto; Andersom Ricardo Fréz

2008-01-01

A proposta deste estudo foi comparar a aplicação de alongamento estático passivo e alongamento proprioceptivo no tratamento de seqüelas de hanseníase. Doze pacientes com essas seqüelas participaram da pesquisa, separados aleatoriamente em dois grupos: o grupo FNP, tratado com facilitação neuromuscular proprioceptiva, e o grupo AEP, com alongamento estático passivo. Ambos realizaram dez sessões de alongamentos, sendo submetidos à avaliação inicial e final nas quais foram aplicados o questionár...

Cisticercose suína, teníase e neurocisticercose humana no município de Barbalha, Ceará Porcine cysticercosis, taeniasis and human neurocysticercosis in municipal district of Barbalha, Ceará

Directory of Open Access Journals (Sweden)

M.C. Silva

2007-04-01

Full Text Available Em Barbalha, Ceará, foram realizados levantamentos de casos de cisticercose suína, teníase e neurocisticercose humana causadas por Taenia solium, e realizou-se uma pesquisa quanto aos sistemas de criação de suínos na região. De 85 suínos abatidos em abatedouro local 4,7% apresentavam cisticercose, a maioria dos cisticercos localizava-se na língua e coração. Entre 2001 e 2004, das 302 criações de suínos denunciadas à vigilância sanitária, 96,6% eram chiqueiros. A teníase, entre 1998 e 2003, correspondeu a 1,1% das verminoses diagnosticadas pela Secretária de Saúde Municipal. Entre 2001 e 2003, os casos de neurocisticercose humana corresponderam a 5% das tomografias de crânio requisitadas nos hospitais da região.In Barbalha, municipal district of Ceará state, an assessment of cases of porcine cysticercosis, taeniasis and human neurocysticercosis caused by the Taenia solium was performed in order to evaluate the situation of these diseases. It was also carried out a research about the types of swine farms registered in the area. Considering the 85 swine slaughtered at the slaughterhouse of Barbalha, 4.7% presented cysticercosis. Most cysticerci were located in the tongue and in the heart. Between 2001 and 2004, from 302 swine farms denounced to the Sanitary Surveillance, 9.6% were pigsties. Taeniasis, between 1998 and 2003, corresponded to 1.1% of the helminthes diagnosed by the Municipal Health Office. From 2001 to 2003, the cases of human neurocysticercosis corresponded to 5% of the skull tomographies requested in the hospitals of the area.

Effect of acoustic softening on the thermal-mechanical process of ultrasonic welding.

Science.gov (United States)

Chen, Kunkun; Zhang, Yansong; Wang, Hongze

2017-03-01

Application of ultrasonic energy can reduce the static stress necessary for plastic deformation of metallic materials to reduce forming load and energy, namely acoustic softening effect (ASE). Ultrasonic welding (USW) is a rapid joining process utilizing ultrasonic energy to form a solid state joint between two or more pieces of metals. Quantitative characterization of ASE and its influence on specimen deformation and heat generation is essential to clarify the thermal-mechanical process of ultrasonic welding. In the present work, experiments were set up to found out mechanical behavior of copper and aluminum under combined effect of compression force and ultrasonic energy. Constitutive model was proposed and numerical implemented in finite element model of ultrasonic welding. Thermal-mechanical analysis was put forward to explore the effect of ultrasonic energy on the welding process quantitatively. Conclusions can be drawn that ASE increases structural deformation significantly, which is beneficial for joint formation. Meanwhile, heat generation from both frictional work and plastic deformation is slightly influenced by ASE. Based on the proposed model, relationship between ultrasonic energy and thermal-mechanical behavior of structure during ultrasonic welding was constructed. Copyright © 2016 Elsevier B.V. All rights reserved.

Psoriatic arthritis in patients with psoriasis: evaluation of clinical and epidemiological features in 133 patients followed at the University Hospital of Brasília Artrite psoriásica em pacientes com psoríase: avaliação de características clínicas e epidemiológicas em 133 pacientes atendidos no Hospital Universitário de Brasília

Directory of Open Access Journals (Sweden)

Jamille Nascimento Carneiro

2012-08-01

Full Text Available BACKGROUND: Psoriatic arthritis is an inflammatory arthritis associated with psoriasis. Its prevalence in patients with psoriasis varies from 7 to 42% but its exact prevalence is unknown. OBJECTIVES: Considering the lack of national data related to its diagnosis in patients with psoriasis, this study aims to describe the clinical, laboratorial and radiological manifestations of psoriatic arthritis in these patients. METHODS: We evaluated 133 patients with psoriasis, treated as outpatients. These patients were asked to fill in the forms with data about the disease and were submitted to a clinical evaluation by a dermatologist and a rheumatologist. Suspected cases of arthritis were referred for further investigation and were classified according to presence or absence of psoriatic arthritis according to CASPAR criteria. RESULTS: The number of patients with psoriatic arthritis was 47 (35%, 17 of them were new cases. There was no difference between the groups regarding the type of psoriasis, nail involvement, presence of scalp lesions and psoriatic arthritis. Patients with psoriatic arthritis had more enthesitis and dactylitis (46.7% than those without arthritis. CONCLUSIONS: Despite the high prevalence of arthritis found, we know that results from epidemiological studies are variable, which limits their use and interpretation. We conclude that more studies are needed to draw a profile of rheumatic manifestations in our population of psoriasis patients.FUNDAMENTOS: A artrite psoriásica é uma artrite inflamatória associada à psoríase. Sua prevalência nos pacientes com psoríase de 7 a 42% mas sua exata prevalência ainda é desconhecida. OBJETIVOS: Considerando a escassez de dados nacionais relacionados ao seu diagnóstico em pacientes com psoríase o presente estudo visa descrever o quadro clínico, laboratorial e radiológico da doença nesses pacientes. MÉTODOS: Foram avaliados 133 pacientes com diagnóstico de psoríase acompanhados no

The nurse and the theme of leprosy in the school context: case studies

Directory of Open Access Journals (Sweden)

Mônica Gisele Costa Pinheiro

2015-07-01

Full Text Available Objetivo: Avaliar o conhecimento de escolares sobre a hanseníase e proporcionar ações de educação em saúde. Métodos: Trata-se de um como descritivo, uma vez que descreve a experiência vivenciada por graduandos de enfermagem durante a execução de uma atividade de extensão focada na realização de diálogos relacionados à hanseníase, como forma de educação e promoção da saúde. Foram considerados os princípios éticos da pesquisa envolvendo seres humanos, e após aprovação pelo Comitê de Ética em Pesquisa, sob parecer nº 072/09 e CAAE 00780051000-09, a pesquisa foi iniciada. Resultados: Evidenciou-se que as atividades de educação em saúde, dirigidas aos escolares, com ênfase na hanseníase, são de fundamental importância, pois denotam a apropriação de conhecimento relacionado à doença. Conclusão: O empedramento sobre hanseníase pode contribuir com a disseminação de tais conhecimentos, visto que os escolares poderão se sentir instigados a divulgar as informações a outras pessoas, como familiares. Descritores: Enfermagem, Educação em Saúde, Hanseníase.

Características da reação tipo 1 e associação com vírus B e C da hepatite na hanseníase Type 1 reaction in leprosy: characteristics and association with hepatitis B and C viruses

Directory of Open Access Journals (Sweden)

Vitória P.A. Rego

2007-10-01

Full Text Available O episódio reacional tipo 1 ou reação reversa é ocorrência inflamatória aguda que atinge a pele e nervos periféricos, encontrada em até 30% dos pacientes com hanseníase, sendo causa comum de incapacidade física. Fatores de risco associados incluem uso de poliquimioterapia e infecções virais. Neste estudo, foram avaliados 620 pacientes com hanseníase. Reação reversa foi diagnosticada em 121 (19,5% casos, sendo mais freqüente nos indivíduos borderlines (48%. Início da poliquimioterapia foi considerado fator de risco para reação reversa, com 52% dos casos apresentando o primeiro episódio neste momento. Neurite foi documentada em 73% dos casos. A presença de vírus B ou C da hepatite foi documentada em 9% de 55 pacientes com reação reversa e em nenhum dos 57 pacientes sem reação (p = 0, 026; teste exato de Fisher, sugerindo possível papel destes agentes como fatores de risco para desenvolvimento de reação reversa na hanseníase.Type 1 reaction or reversal reaction is an acute inflammatory episode in the skin and peripheral nerves that is found in up to 30% of leprosy patients and commonly causes physical disabilities. Multidrug chemotherapy and viral infections are associated risk factors. In this study, 620 leprosy patients were evaluated. Reversal reactions were diagnosed in 121 cases (19.5% and were most frequently found in borderline patients (48%. Starting on multidrug chemotherapy was considered to be a risk factor for reversal reaction: 52% of the cases presented their first episode at this time. Neuritis was found in 73% of the cases. The presence of hepatitis B or C virus was documented in 9% of the 55 patients with reversal reaction, while it was not detected in any of the 57 patients without reaction (p = 0.026, Fisher’s exact test. This suggests that these agents may have a role as risk factors for developing reversal reactions.

Diagnóstico da hanseníase fora do município de residência: uma abordagem espacial, 2001 a 2009 Leprosy diagnosis in municipalities other than the patients' place of residence: spatial analysis, 2001-2009

Directory of Open Access Journals (Sweden)

Carlos Henrique Morais de Alencar

2012-09-01

Full Text Available Caracterizar o fluxo de pessoas afetadas pela hanseníase, do município de residência para o de diagnóstico, em área de alta endemicidade no Brasil. Estudo baseado em dados do Sistema de Informação de Agravos e Notificação de 2001-2009, nos estados do Maranhão, Pará, Tocantins e Piauí. Dos 373 municípios, 349 (93,6% tiveram pelo menos um residente afetado pela hanseníase notificado em outro município (4.325 casos, 5,2% dos notificados. Os municípios com maior número de casos notificados fora de sua residência foram Timon (248 e São José de Ribamar (201, no Maranhão. Os municípios que mais receberam casos para diagnóstico foram São Luís (719 e Teresina (516. Destacam-se Goiânia (146 e o Distrito Federal (42 como polos de notificações de casos residentes no agregado, mesmo a mais de 1.000km de distância da área. O fluxo observado indica lacunas na descentralização do processo de atenção integral à pessoa afetada pela hanseníase e chama atenção para as dificuldades e desafios associados com o acompanhamento durante e após a poliquimioterapia.The study analyzed the flow of persons with leprosy from their municipality (county of residence to that of their diagnosis in a highly endemic area in Brazil. The study was based on data from the National Information System for Notifiable Diseases from 2001 to 2009 in the States of Maranhão, Pará, Tocantins, and Piauí. Of the 373 municipalities, 349 (93.6% had at least one resident with leprosy that had been diagnosed in a different municipality (4,325 cases, or 5.2% of the total. The municipalities with the most cases reported elsewhere were Timon (248 and São José de Ribamar (201, Maranhão State. The municipalities that received the most exogenous cases for diagnosis were São Luís (719, capital of Maranhão, and Teresina (516, capital of Piauí. Goiânia (146, capital of Goiás, and the Federal District (42 also reported numerous cases, even though they are

Tolerance of laser-driven microshell targets to fluorescence and prepulse energy

International Nuclear Information System (INIS)

Leonard, T.; Moncur, N.K.; Sullivan, D.

1976-01-01

Glass-shell targets currently being used for laser-fusion experiments are susceptible to damage by preenergy from the laser. This energy can result from amplified spontaneous emission (ASE) throughout the laser chain during the period of high-population inversion or it can take the form of a short prepulse nanoseconds before the main laser pulse. We point out the energy levels which a typical target can tolerate in the form of ASE and prepulses. These energies are low enough that special precautions must be taken to prevent significant perturbations of the target or its environment before the main laser pulse

Microlitíase alveolar pulmonar: achados na tomografia computadorizada de alta resolução do tórax em 10 pacientes Pulmonary alveolar microlithiasis: high-resolution computed tomography findings in 10 patients

Directory of Open Access Journals (Sweden)

Edson Marchiori

2007-10-01

Full Text Available OBJETIVO: Apresentar os achados na tomografia computadorizada de alta resolução (TCAR do tórax da microlitíase alveolar pulmonar. MÉTODOS: Foram estudadas, retrospectivamente, as tomografias de dez pacientes adultos, sete mulheres e três homens, com idade média de 38,7 anos. Os exames foram analisados por dois radiologistas, de forma independente, e as decisões finais foram obtidas por consenso. RESULTADOS: Os achados mais freqüentes foram as opacidades em vidro fosco e as calcificações subpleurais, ambas presentes em 90% dos pacientes estudados. Os outros achados de maior relevância foram pequenos nódulos parenquimatosos, calcificação ao longo dos septos interlobulares, cissuras nodulares, nódulos subpleurais, cistos subpleurais, consolidações densas e padrão de pavimentação em mosaico. CONCLUSÕES: A microlitíase alveolar pulmonar apresenta aspectos na TCAR que são altamente sugestivos da doença, na maior parte dos casos dispensando a realização de biópsias pulmonares.OBJECTIVE: To present the high-resolution computed tomography (HRCT findings of pulmonary alveolar microlithiasis. METHODS: The HRCT scans of 10 adult patients (seven females and three males; mean age, 38.7 years were retrospectively analyzed. The films were studied independently by two radiologists. RESULTS: The most common tomographic findings were ground-glass attenuation and linear subpleural calcifications, which were seen in 90% of the patients. Other relevant findings were small parenchymal nodules, calcification along the interlobular septa, nodular cissures, subpleural nodules, subpleural cysts, dense consolidations, and a mosaic pattern of attenuation. CONCLUSIONS: The HRCT findings presented by individuals with pulmonary alveolar microlithiasis are distinct. In most cases, such findings can form the basis of the diagnosis, eliminating the need to perform a lung biopsy.

O uso da sorologia como ferramenta adicional no apoio ao diagnóstico de casos difíceis de hanseníase multibacilar: lições de uma unidade de referência The use of serology as an additional tool to support diagnosis of difficult multibacillary leprosy cases: lessons from clinical care

Directory of Open Access Journals (Sweden)

Maria Leide W. Oliveira

2008-01-01

Full Text Available Sete casos de hanseníase multibacilar (MB e dois casos com suspeição de hanseníase atendidos em situações distintas do atendimento clínico-dermatológico na Universidade Federal do Rio de Janeiro são descritos. Todos apresentaram dificuldades no diagnóstico visto que não tinham sinais e sintomas cardinais da hanseníase. Um teste sorológico utilizado como ferramenta auxiliar foi útil no processo de diagnóstico ou exclusão de cada caso e facilitou as discussões acadêmicas na hora do exame clínico. A sorologia e baciloscopia de linfa são consideradas como os únicos instrumentos rápidos e de baixo custo para a confirmação de casos MB atípicos, e as vantagens e desvantagens de cada exame são discutidas. Ambos os testes complementam o processo diagnóstico e classificação dos casos para fins terapêuticos. A vantagem da baciloscopia está na sua capacidade de confirmação do diagnóstico. As vantagens da sorologia são: (a sua aplicabilidade para uso direto por profissionais de saúde no momento da consulta, visto que os resultados são imediatos, (b a possibilidade da participação dos pacientes no processo, e (c oferece uma oportunidade para melhor ensino da patogênese da hanseníase.Seven multibacillary leprosy and two suspected cases assisted in different situations during clinical care activities at the university in Rio de Janeiro city are described. All cases presented some difficulties for diagnosis, since they evolved with few or no cardinal signs or symptoms of leprosy. A serological test used as an auxiliary tool was helpful in the diagnosis or exclusion procedure of each case, facilitating academic discussions at the time of case examination. Considering serology and bacilloscopy (skin smear as the only rapid and relatively cheap available tests for confirmation of atypical MB leprosy, the advantages and disadvantages of their use were discussed. Both tests support the diagnostic procedure and the

Activity of some nucleases of cotton sorts and species of various radiosensitivity

International Nuclear Information System (INIS)

Nazirov, N.N.; Arslanova, S.B.

1979-01-01

The activity of some nucleases under the effect of gamma rays was studied on cotton varieties and species differing in radiosensitivity. It was found that acid nuclease was more active in wild cotton forms as compared to the cultivated varieties, whereas with alkaline DNA-ase it was opposite. At the radiation dose of 30 kR the activity of alkaline DNA-ase activated in 26-chromosome wild cotton G. arboreum ssp. alfusifalium and 52-chromosome S.h.ssp.mexicanum, while the activity of acid DNA-ase somewhat decreased. Under irradiating AN-402 variety (produced from ssp. mexicanum by irradiation) the activity of alkaline DNA-ase increased noticeably when budding, whereas the activity of acid DNA-ase was at the level of control. The activity of the alkaline DNA-ase form normalized in the phase of blooming. In C-70-59 variety (G.arboreum) the activity of both DNA-ases increased after irradiation in the phase of blooming. The activity of acid DNA-ase and RNA-ase drastically activated in guza 183 (G. herbaceum) under gamma irradiation, whereas that of alkaline ones remained unchanged

The Study of Permanent Magnets Synchronous Machine (PMSM of the Autonomous Electric Power Supply System (ASE, compatible with the Concept of a More Electric Aircraft (MEA

Directory of Open Access Journals (Sweden)

Setlak Lucjan

2018-01-01

Full Text Available Based on the analysis and mathematical models of synchronous electric machines (motor/generator, basing on permanent magnets, presented in this paper, the main importance of alternator AC power sources in the form of starter/generator (for conventional aircraft and in the form of integrated unit starter (motor/AC synchronous generator S/G AC (with respect to advanced aircraft concept in terms of more electric aircraft was highlighted. Additionally, through the analysis and selected simulations of the on-board autonomous power supply system of the modern aircrafts, sources of electrical energy (synchronous motor/generator, integrated unit starter/AC generator were located in board autonomic power system ASE (EPS, PES. Main components of this system are the electro-energetic power system EPS and the energo-electronic power system PES. In addition, the analysis and exemplary simulations of main electricity sources based on mathematical models have contributed to highlighting the main practical applications in accordance with the concept of MEA.

The Business Case for Automated Software Engineering

Science.gov (United States)

Menzies, Tim; Elrawas, Oussama; Hihn, Jairus M.; Feather, Martin S.; Madachy, Ray; Boehm, Barry

2007-01-01

Adoption of advanced automated SE (ASE) tools would be more favored if a business case could be made that these tools are more valuable than alternate methods. In theory, software prediction models can be used to make that case. In practice, this is complicated by the 'local tuning' problem. Normally. predictors for software effort and defects and threat use local data to tune their predictions. Such local tuning data is often unavailable. This paper shows that assessing the relative merits of different SE methods need not require precise local tunings. STAR 1 is a simulated annealer plus a Bayesian post-processor that explores the space of possible local tunings within software prediction models. STAR 1 ranks project decisions by their effects on effort and defects and threats. In experiments with NASA systems. STARI found one project where ASE were essential for minimizing effort/ defect/ threats; and another project were ASE tools were merely optional.

Cloning and expression of DNA encoding a ripening form of a polypeptide having rhamno-galacturonase activity.

NARCIS (Netherlands)

Musters, W.; Stam, H.; Suykerbuyk, M.E.; Visser, J.; Verbakel, J.M.

1993-01-01

The invention relates to isolation of an Aspergillus gene encoding rhamnogalacturonase (RG-ase) and the construction of recombinant Aspergillus strains with overexpression of RG-ase. These strains can be used for the commercial production of RG-ase. RG-ase is an important enzyme in processes

Electrochemical properties of carbon nanotubes-hydrogenase conjugates Langmuir-Blodgett films

International Nuclear Information System (INIS)

Liu, Ai-Rong; Wakayama, Tatsuki; Nakamura, Chikashi; Miyake, Jun; Zorin, Nikolay A.; Qian, Dong-Jin

2007-01-01

We report the preparation of Langmuir-Blodgett (LB) films composed of oxidized carbon nanotubes (CNTs) and hydrogenase (H 2 ase) conjugates and their electrochemical properties. Both single-walled (SWNTs) and multi-walled CNTs (MWNTs) were used to form mixed monolayers with H 2 ase on the Tris-HCl subphase surfaces. By using the LB method, the CNTs-H 2 ase monolayers were transferred onto CaF 2 and indium tin oxide (ITO) electrode surfaces. The LB film modified electrodes showed a couple of waves centered at around -500 mV (versus Ag/AgCl), which corresponding to the redox reaction of [4Fe-4S] 2+/1+ clusters in the H 2 ase. The current intensity was enhanced after co-assembly with CNTs. Because of the different diameters of CNTs, this current intensity was proportional to the scan rate (υ) for the electrodes modified with the LB films of pure H 2 ase and SWNTs-H 2 ase, but to the root of scan rate (υ 1/2 ) for those modified with the MWNTs-H 2 ase LB film. The products of diffusion coefficient and concentration (D 1/2 C) increased in the order of pure H 2 ase, SWNTs-H 2 ase, and MWNTs-H 2 ase LB films

Therapeutic Drug Monitoring of Asparaginase Activity-Method Comparison of MAAT and AHA Test Used in the International AIEOP-BFM ALL 2009 Trial.

Science.gov (United States)

Lanvers-Kaminsky, Claudia; Rüffer, Andrea; Würthwein, Gudrun; Gerss, Joachim; Zucchetti, Massimo; Ballerini, Andrea; Attarbaschi, Andishe; Smisek, Petr; Nath, Christa; Lee, Samiuela; Elitzur, Sara; Zimmermann, Martin; Möricke, Anja; Schrappe, Martin; Rizzari, Carmelo; Boos, Joachim

2018-02-01

In the international AIEOP-BFM ALL 2009 trial, asparaginase (ASE) activity was monitored after each dose of pegylated Escherichia coli ASE (PEG-ASE). Two methods were used: the aspartic acid β-hydroxamate (AHA) test and medac asparaginase activity test (MAAT). As the latter method overestimates PEG-ASE activity because it calibrates using E. coli ASE, method comparison was performed using samples from the AIEOP-BFM ALL 2009 trial. PEG-ASE activities were determined using MAAT and AHA test in 2 sets of samples (first set: 630 samples and second set: 91 samples). Bland-Altman analysis was performed on ratios between MAAT and AHA tests. The mean difference between both methods, limits of agreement, and 95% confidence intervals were calculated and compared for all samples and samples grouped according to the calibration ranges of the MAAT and the AHA test. PEG-ASE activity determined using the MAAT was significantly higher than when determined using the AHA test (P Wilcoxon signed-rank test). Within the calibration range of the MAAT (30-600 U/L), PEG-ASE activities determined using the MAAT were on average 23% higher than PEG-ASE activities determined using the AHA test. This complies with the mean difference reported in the MAAT manual. With PEG-ASE activities >600 U/L, the discrepancies between MAAT and AHA test increased. Above the calibration range of the MAAT (>600 U/L) and the AHA test (>1000 U/L), a mean difference of 42% was determined. Because more than 70% of samples had PEG-ASE activities >600 U/L and required additional sample dilution, an overall mean difference of 37% was calculated for all samples (37% for the first and 34% for the second set). Comparison of the MAAT and AHA test for PEG-ASE activity confirmed a mean difference of 23% between MAAT and AHA test for PEG-ASE activities between 30 and 600 U/L. The discrepancy increased in samples with >600 U/L PEG-ASE activity, which will be especially relevant when evaluating high PEG-ASE activities in

Desafios na era pós genômica para o desenvolvimento de testes laboratoriais para o diagnóstico da hanseníase Challenges in the post genomic era for the development of tests for leprosy diagnosis

Directory of Open Access Journals (Sweden)

Mariane Martins de Araújo Stefani

2008-01-01

Full Text Available O diagnóstico da hanseníase se baseia em manifestações clínicas e não existe teste laboratorial para diagnosticar casos assintomáticos ou para prever progressão da doença entre indivíduos expostos. Novas análises genômicas comparativas in silico e ferramentas de biologia molecular têm sido empregadas para revelar proteínas exclusivas do Mycobacterium leprae que apresentem potencial aplicação diagnóstica. A hanseníase tuberculóide paucibacilar (PB apresenta baixo nível de anticorpos e forte resposta imune celular (RIC tipo Th1/interferon gamma (IFN-γ. A doença lepromatosa multibacilar (MB apresenta sorologia positiva e fraca RIC. Portanto, testes laboratoriais para diagnosticar hanseníase PB e MB devem contemplar testes de RIC e sorologia. Proteínas recombinantes do Mycobacterium leprae sorologicamente reativas podem ser incorporadas ao antígeno PGLI para melhorar o diagnóstico sorológico de pacientes MB. Proteínas recombinantes e peptídeos sintéticos do Mycobacterium leprae têm sido testados em ensaios de RIC/IFN-γ para diagnosticar casos PB. Sorologia anti-PGLI modificada incorporando novos antígenos do Mycobacterium leprae e ensaios baseados na RIC/produção de IFN-γ devem permitir a detecção precoce de casos MB e PB em países endêmicos.Leprosy diagnosis is based mainly on clinical manifestations and no laboratory test is available to diagnose asymptomatic disease or to predict disease progression among exposed individuals. Novel comparative genomic in silico analyses and molecular biology tools have discovered unique Mycobacterium leprae proteins with potential diagnostic application. Tuberculoid paucibacillary leprosy (PB shows low antibodies titers and strong Th1 type/ IFN-γ specific cell mediated immunity (CMI, while lepromatous multibacillary patients (MB show high antibody titers and low CMI. Therefore, laboratory tests for PB and MB leprosy diagnosis will require CMI and antibody based assays

REFSIM Handbook of Variable Names.

Science.gov (United States)

1982-11-04

INT2 LREFSEEK R /AERO/ INT4 L: REFSEEK D2THET missile pitch acceleration in degrees/R /AERO/ AER02 M CREFAIR second**2. R /AERO/ AER03 M LREFAIR R...LREFSEEK R /INTERP/ AWM’l L REFSEEK R /INTERP/ ANMh2 CREFSEEK DELA Peak magnitude difference at port and R /CSAS/ AMERCS LREFENW4T starboard. (db/m**2) R...ASE/ GLINT2 L REFD1VMT R /ASE/ INIiT M LIREFSEEK, R /ASE,/ INT2 REFSEEK R /ASE/ INT4 L-RE’SEEK R /ASE/ LOCK2 L-EFSEEK R /ASE/ 1’tLOCK LIREFSEEK DELUhP

Comportamento da eosinofilia após o tratamento das geohelmintoses

Directory of Open Access Journals (Sweden)

Marta Maria Bozóti

1973-04-01

Full Text Available A eosinofilia sanguínea após o tratamento anti-helmíntico específico se comportou numa amostragem de 57 crianças da seguinte forma: .Na ascaridíase isolada ou associada à trieuríase a hipereosinofilia parasitária ou descia uniformemente após o tratamento, ou houve primeiro uma exacerbação que durava até a terceira semana após a erradicação da, parasitose, descendo em seguida. Em ambos os casos houve normalização do hemograma em dois meses. Na associação ascaridíase/ancilostomíase também são possíveis dois tipos de comportamento da eosinofilia após tratamento eficaz: ou vai diminuindo a hipereosinofilia, logo em seguida à expulsão dos parasitos, ou há no primeiro mês um aumento da hipereosinofilia (geralmente mais acentuado na primeira semana que se segue ao tratamento, para diminuir após o fim do primeiro mês progressivamente até desaparecer. Na estrongiloidíase e na associação ascaridíase/estrongiloidíase há diminuição constante da hipereosinofilia logo após o tratamento e o hemograma se normaliza em cerca de dois meses. Na trieuríase, a hipereosinofilia, aliás já discreta, diminui pouco com o tratamento. Na ancilostomíase e na associação ancilostomíase/trieuríase a hipereosinofilia ou desce após o tratamento gradativo e lentamente, ou primeiro há uma exaltação temporária nas primeiras três semanas após a terapêutica, para diminuir em seguida. Na associação ancilostomíase/estrongiloidíase também se encontram esses dois tipos de comportamento da hipereosinofilia verminótica, mas a exacerbação da hipereosinofilia, que ocorre na metade dos casos, só dura duas semanas; a regressão eosinofílica ocorre dois meses após o tratamento. Nas tri e tetraeparasitoses a involução pós-terapêutica da hipereosinofilia é irregular e a normalização das taxas sanguíneas de eosinófilos é sempre arrastada, principalmente nas associações ascaridíase/estrongiloidíase/ancilostomíase e

Mass treatment for intestinal helminthisis control in an Amazonian endemic area in Brazil Tratamento em massa para controle das helmintíases intestinais em área endêmica na Amazônia Brasileira

Directory of Open Access Journals (Sweden)

Márcio Neves Bóia

2006-08-01

Full Text Available The objective of the present study was to estimate the prevalence of soil-transmitted helminthiasis and evaluate the sanitary conditions and the role of a mass treatment campaign for control of these infections in Santa Isabel do Rio Negro. A cross-sectional survey was carried out in 2002, to obtain data related to the sanitary conditions of the population and fecal samples for parasitological examination in 308 individuals, followed by a mass treatment with albendazole or mebendazole with coverage of 83% of the city population in 2003. A new survey was carried out in 2004, involving 214 individuals, for comparison of the prevalences of intestinal parasitosis before and after the mass treatment. The prevalences of ascariasis, trichuriasis and hookworm infection were 48%; 27% and 21% respectively in 2002. There was a significant decrease for the frequency of infections by Ascaris lumbricoides (p O presente trabalho objetivou avaliar a prevalência e o papel de um tratamento em massa das helmintíases intestinais em Santa Isabel do Rio Negro, Estado do Amazonas, Brasil. Foi realizado em 2002 um estudo seccional, incluindo inquérito copro-parasitológico, objetivando a obtenção das prevalências das parasitoses intestinais e dados sobre as condições sanitárias do local, estudando-se uma amostra de 308 indivíduos. Em 2003 foi realizada intervenção para tratamento em massa das helmintíases intestinais com administração de albendazol (ou mebendazol para crianças entre 12 e 24 meses na sede do município, alcançando-se 83% de cobertura. Novo inquérito copro-parasitológico foi realizado em 2004, para comparação das prevalências antes a após o tratamento. As prevalências das infecções por Ascaris lumbricoides, Trichuris trichiura e ancilostomídeos foram 48%, 27% e 21%, respectivamente em 2002. Em 2004 observou-se redução significativa das infecções por Ascaris lumbricoides (p < 0,05; OR / 95% IC = 0,44 / 0,30 - 0,65, Trichuris

ANTS/PAM: Future Exploration of the Asteroid Belt

Science.gov (United States)

Clark, P. E.; Curtis, S. A.; Rilee, M. L.; Cheung, C. Y.

2004-05-01

The Autonomous Nano-Technology Swarm (ANTS) is applied to the Prospecting Asteroid Mission (PAM) concept, as part of a NASA RASC study. The ANTS architecture is inspired by success of social insect colonies, based on the division of labor within the colonies: 1) within their specialties, individual specialists generally outperform general-ists, and 2) with sufficiently efficient social interaction and coordination, the group of specialists generally outper-forms the group of generalists. ANTS as applied to PAM involves a thousand individual specialist `sciencecraft', one subswarm per target, in an environment where detection and tracking of irregular, infrequent targets is a major chal-lenge. Workers, carry and operate eight to nine different scientific instruments, including spectrometers, ranging and radio science devices, imagers. The remaining specialists, Messenger/Rulers, provide communication and coordina-tion. The non-expendable propulsion system is based on autonomously deployable and configurable solar sails, a system suitable to a low gravity environment. The design of the neural basis function requires a minimum of 4 or 5 specialists for collective decision making. Allowing for ten instrument specialist teams and compensating for antici-pated high attrition, we calculate an initial minimum of 100 per subswarm should allow characterization of hundreds of asteroids. The difficulty in observing irregular, rapidly moving, poorly illuminated objects is largely overcome by the ANT sciencecraft capability to optimize conditions for each instrument. Components are composed of carbon nanotubules reversibly deployable from NEMS nodes, allowing 100 times decrease in packaging volume. 1000 smart 10 centimeter, 1 kg cubic boxes create a 1000 kg 1 meter cube.

A hanseníase no laboratório Hansen's disease in the laboratory

Directory of Open Access Journals (Sweden)

Euzenir Nunes Sarno

2003-01-01

Full Text Available Médica, doutora em patologia, Euzenir Sarno é estudiosa da imunopatologia da hanseníase, infecção crônica das mais antigas que constitui uma doença exclusivamente humana. Integrante de um dos ambulatórios de referência sobre a doença no Brasil, no qual são diagnosticados de 220 a 250 pacientes novos/ano, ressalta que uma das conseqüências da impossibilidade de se cultivar o Mycobacterium leprae é a permanência das mesmas questões seculares a respeito da transmissão e a suscetibilidade à doença. Há, também, muitas interrogações no terreno epidemiológico que permanecem sem resposta. Estima-se que entre as pessoas que mantêm contato com pacientes multibacilares, 90% são infectados mas apenas 8% mais ou menos ficam doentes. O índice elevado de infecção de quem convive com doentes multibacilares, sem que a doença se manifeste, indica que apenas um pequeno número de indivíduos não tem resistência ao Mycobacterium leprae. Essa é uma das questões que a imunologia não consegue responder: por que algumas pessoas têm resistência e outras não. A proporção é menor se o contato ocorrer com pacientes paucibacilares, uma forma de manifestação com poucos bacilos. A hanseníase é conhecida como uma doença dermatológica, mas a especialista destaca que a primeira lesão é anestésica: o nervo é atingido. Além dos nervos sensitivos da pele, há danos que determinam lesões motoras e deformidades irreversíveis, que levam à amputação de extremidades. O Mycobacterium leprae foi uma das primeiras bactérias patogênicas que tiveram o genoma completamente seqüenciado, em 2000. Agora é que se está começando a ter realmente condições para obter testes mais precisos. A doença não é hereditária e apenas em 1986 os serviços de saúde no Brasil passaram a se organizar para combatê-la, pois durante os vinte anos de ditadura militar o sistema foi desmantelado. Em 1991, o tratamento de um ano que inclui tr

Influence of the extraction mode on the yield of some furanocoumarins from Pastinaca sativa fruits.

Science.gov (United States)

Waksmundzka-Hajnos, Monika; Petruczynik, Anna; Dragan, Anna; Wianowska, Dorota; Dawidowicz, Andrzej L; Sowa, Ireneusz

2004-02-05

Analysis of plant material is an important task in chemotaxonomical investigations, in search of plants with pharmacological activity or in standardisation of plant drugs. The choice of optimal conditions for the analysis of plant material and effect of extraction method on the yield of furanocoumarins from Pastinaca sativa fruits were examined. The following extraction methods were used in experiments: exhaustive extraction in Soxhlet apparatus, ultrasonification (USAE) at 25 and 60 degrees C, microwave-assisted solvent extraction in open and closed system (MASE) and accelerated solvent extraction (ASE). In most cases, the yield of furanocoumarins was highest by use of ASE method as well as by ultrasonification at 60 degrees C.

Panorama sobre a hanseníase: quadro atual e perspectivas A panorama of Hansen's disease: present status and perspectives

Directory of Open Access Journals (Sweden)

Tadiana Alves Moreira

2003-01-01

Full Text Available A entrevistada fala sobre a endemia no Brasil, atualmente com 4.4 casos por dez mil habitantes, sendo o segundo país em número de doentes. Ao discorrer sobre o engajamento do Brasil no programa lançado pela Organização Mundial de Saúde, Tadiana explica que o objetivo da OMS é eliminar a hanseníase até 2005. No entanto, ela diz que a meta brasileira é, neste prazo, reduzir a incidência da doença a até menos de um caso por dez mil pessoas. Em nosso país, a estrutura e organização de tal programa, que engloba desde a formação e especialização de profissionais para garantir o diagnóstico precoce, ao acompanhamento do paciente durante o tratamento, é realizado pelo Sistema Único de Saúde (SUS, implantado em todos os estados da federação. O tratamento poliquimioterápico dura, em média, um ano, se for seguido à risca. Em muitos casos, a doença volta a se manifestar posteriormente. Ela comenta as diferenças de incidência da hanseníase, dependendo da região: já foi eliminada em dois dos três estados do Sul do país, ao passo que em estados do Norte e Centro-Oeste atinge índices hiperendêmicos. Trabalhando em estreita articulação com as associações de pacientes e ex-pacientes, inicialmente como enfermeira e, depois, na implantação das políticas de atenção ao hanseniano, Tadiana Alves Moreira fala sobre a importância do diagnóstico precoce visando evitar seqüelas físicas que a doença provoca quando alcança estágios avançados, e assim, reduzir o estigma que recai sobre os seus portadores.The interviewee speaks about the endemic disease, which at present contaminates 4.4 out of ten thousand inhabitants in Brazil, the country with the second highest number of patients. When Tadiana speaks about the Brazilian participation in the program launched by the World Health Organization, she explains that WHO's objective is to extinguish Hansen's disease on the planet until 2005. However, she says that Brazilian

NAPSI utilization as an evaluation method of nail psoriasis in patients using acitretin Utilização do NAPSI como instrumento de avaliação na psoríase ungueal em pacientes com uso da acitretina

Directory of Open Access Journals (Sweden)

Maira Mitsue Mukai

2012-04-01

Full Text Available BACKGROUND: assessment instruments of nail psoriasis have been published in literature as means to standardize the previous subjective assessments of authors. OBJECTIVES: Using Nail Psoriasis Severity Index for evaluation in patients with plaque psoriasis during treatment with acitretin. METHODS: Thirty volunteers with plaque psoriasis were selected for the study. Twenty patients (8 women and 12 men completed the study. The initial dose of acitretin was 0.3 mg/kg/day for 30 days and was later raised to 0.5 mg/kg/day. Nail Psoriasis Severity Index was collected in the first evaluation, after 2 and 4 months. Nails of both hands were evaluated. RESULTS: nail lesions were present in all patients at first evaluation. The initial Nail Psoriasis Severity Index median was 20 and the final score 20.5 (2.5% of worsening at the end of the study. No statistically significant difference between the three evaluations was found (X2 = 0.8084, GL = 2, p = 0.6657. Seven patients worsened in the final score. Three patients improved 50% of the initial Nail Psoriasis Severity Index and only one had an improvement of 75%. Linear correlation showed a weak association between the improvement percentage in PASI and Nail Psoriasis Severity Index (r = 0.105, F = 2.12, p = 0.162. CONCLUSION: The method was easy and of rapid execution while potentially bringing information about changes in nail plate and matrix during treatment. The Nail Psoriasis Severity Index does not quantify the existing lesions and might not have the sensitivity to detect small changes.FUNDAMENTOS: instrumentos de avaliação da psoríase ungueal têm sido publicados na literatura como meio de padronizar as avaliações antigamente subjetivas dos autores. OBJETIVOS: utilizar índice de Gravidade da Psoríase Ungueal ou Nail Psoriasis Severity Index para avaliação em pacientes portadores de psoríase em placas durante o tratamento com acitretina. MÉTODOS: trinta voluntários portadores de psoríase

Fatores de risco para transmissão da Hanseníase Factores de riesgo para la transmisión de la Lepra Risk factors for Leprosy transmission

Directory of Open Access Journals (Sweden)

Andréia Soprani dos Santos

2008-11-01

Full Text Available Estudo caso controle que objetivou identificar fatores individuais de risco relacionados à transmissão da doença. O grupo caso, composto por 90 pacientes de hanseníase notificados no SINAN entre 2003 e 2006; o grupo controle, constituído por 270 indivíduos sadios, pareados por sexo e faixa etária. Houve associação significativa entre a ocorrência da doença e a presença atual (OR= 2,9 e antiga (OR=5,0 de hanseníase entre parentes co-sangüíneos. Sabendo-se que o exame único dos contatos, no ato do diagnóstico, detecta uma parcela mínima dos casos, propõe-se a realização de exames periódicos dos contatos de hansenianos a fim de detectar os novos casos.Estudio caso controle que objetivó identificar factores individuales del riesgo relacionados a transmisión de la enfermedad. El grupo caso, compuesto por 90 pacientes con lepra notificados en el SINAN entre 2003 y 2006; y el grupo controle, constituido por 270 individuos saludables, pareados por sexo y edad. Hubo asociación significativa entre la ocurrencia de la enfermedad y la presencia actual (OR= 2,9 y antigua (OR=5,0 de la lepra entre parientes co-sanguíneos. Sabiéndose que el examen único de los contactos en el acto del diagnóstico detecta una parcela mínima de los casos, se propone a la realización del examen periódico de los contactos de leprosos a fin de detectar los nuevos casos.This case-control study aimed to identify individual risk factors regarding the transmission of leprosy. The group case represented by 90 cases of leprosy sick people pontificated at SINAN during 2003 and 2006 and a group control constituted by 270 healthy people, paired by gender and age. There was significant statistical between occurrence of the disease and its current presence (OR: 2,9 and old cases (OR= 5,0 of leprosy among co-sanguine relatives. Knowing that the only exam of the contact in the act of the diagnostic detects a minimum part of the new cases, it is proposed to

Level of Sexual Myths Level in Premature Ejaculation Cases

Directory of Open Access Journals (Sweden)

Mehmet Gunes

2016-06-01

Full Text Available Objective: The aim of this study is to determine level of belief in sexual myths in the cases of premature ejacula­tion (PE which is the most common sexual dysfunction in men. Methods: This study included 100 cases who applied Di­cle University Faculty of Medicine hospitals meet prema­ture ejaculation criteria of DSM-5 and 70 healthy controls. Sociodemographic data form, Hamilton Depression Rat­ing Scale (HDS, Hamilton Anxiety Rating Scale (HAS, Arizona Sexual Experience Scale (ASES-Men form and Sexual Myths Evaluation Form were applied to partici­pants. Results: In the study, rate of belief in sexual myths in PE cases was found significantly higher than healthy controls. In the PE cases, education time less than 10 years, the presence of comorbid sexual dysfunction were found to be statistically significant factors that increase the level of belief in sexual myths in the PE cases, HDS (p=0.0002, HAS (p=0.0001, ASES (p=0.0004 scores were statisti­cally significantly higher than the control group. In the loss of sexual desire in men with comorbid ASES (p=0.0001, with ED, ASES (p=0.001 and HDS (p=0.040 scores were found statistically significantly higher. Conclusions: Sexual information should be given in the appropriate age by educated person in educational insti­tutions.

Significados e usos de materiais educativos sobre hanseníase segundo profissionais de saúde pública do Município do Rio de Janeiro, Brasil Meanings and use of educational materials on Hansen disease according to public health officials in the Municipality of Rio de Janeiro, Brazil

Directory of Open Access Journals (Sweden)

Adriana Kelly-Santos

2009-04-01

Full Text Available O artigo objetiva refletir sobre os processos comunicativos de Programas de Controle de Hanseníase (PCH do Sistema Único de Saúde (SUS, por meio da análise da recepção de materiais educativos por profissionais de dois serviços de saúde pública no Rio de Janeiro, Brasil. O trabalho discute em que medida a análise de impressos favorece a negociação dos sentidos e das práticas sobre hanseníase vigentes nos PCH. Foram analisados 38 materiais produzidos entre 1993 a 2005, por instituições governamentais e não-governamentais e realizados dois grupos focais com profissionais atuantes no PCH. Durante os grupos focais 6 materiais foram examinados. Os resultados revelaram a verticalidade e fragmentação nos processos comunicativos, expressas pela: ênfase em campanhas, produção centralizada, homogeneização dos públicos e conteúdos e privilégio dado ao saber biomédico. As atividades horizontais e participativas não eram comuns. Foi identificada uma lacuna entre a institucionalização do discurso da hanseníase, como alternativa à terminologia da lepra, e a sua circulação e consumo entre os diferentes atores sociais.This article reflects on the communications processes in the Hansen Disease Control Programs under the Unified National Health System (SUS in Brazil, analyzing how professionals at two public health services in Rio de Janeiro perceive the educational materials on the disease. The article discusses how analysis of printed materials favors negotiation of prevailing meanings and practices on Hansen disease in the programs. Thirty-eight different educational materials were analyzed (produced from 1993 to 2005 by governmental and nongovernmental institutions through two focus groups with program staff. Six materials were examined during the focus groups. The findings showed the communications processes are vertical and fragmented, with an emphasis on campaigns, centralized production of materials, homogenization of

Early experience in the use of quantitative image quality measurements for the quality assurance of full field digital mammography x-ray systems

International Nuclear Information System (INIS)

Marshall, N W

2007-01-01

Quantitative image quality results in the form of the modulation transfer function (MTF), normalized noise power spectrum (NNPS) and detective quantum efficiency (DQE) are presented for nine full field digital mammography (FFDM) systems. These parameters are routinely measured as part of the quality assurance (QA) programme for the seven FFDM units covered by our centre. Just one additional image is required compared to the standard FFDM protocol; this is the image of an edge, from which the MTF is calculated. A variance image is formed from one of the flood images used to measure the detector response and this provides useful information on the condition of the detector with respect to artefacts. Finally, the NNPS is calculated from the flood image acquired at a target detector air kerma (DAK) of 100 μGy. DQE is then estimated from these data; however, no correction is currently made for effects of detector cover transmission on DQE. The coefficient of variation (cov) of the 50% point of the MTF for five successive MTF results was 1%, while the cov for the 50% MTF point for an a-Se system over a period of 17 months was approximately 3%. For four a-Se based systems, the cov for the NNPS at 1 mm -1 for a target DAK of 100 μGy was approximately 4%; the same result was found for four CsI based FFDM units. With regard to the stability of NNPS over time, the cov for four NNPS results acquired over a period of 12 months was also approximately 4%. The effect of acquisition geometry on NNPS was also assessed for a CsI based system. NNPS data acquired with the antiscatter grid in place showed increased noise at low spatial frequency; this effect was more severe as DAK increased. DQE results for the three detector types (a-Se, CsI and CR) are presented as a function of DAK. Some reduction in DQE was found for both the a-Se and CsI based systems at a target DAK of 12.5 μGy when compared to DQE data acquired at 100 μGy. For the CsI based systems, DQE at 1 mm -1 fell from 0

Hanseníase: subnotificação de casos em Fortaleza - Ceará, Brasil Leprosy: underreported cases in Fortaleza - Ceará, Brazil

Directory of Open Access Journals (Sweden)

Mônica Cardoso Façanha

2006-08-01

Full Text Available FUNDAMENTO: Visando à eliminação da hanseníase como problema de saúde pública no Brasil, o Ministério da Saúde tem como meta alcançar taxa de prevalência de menos de 1 caso/10.000 habitantes, estimulando o diagnóstico e tratamento dos casos e reduzindo a disseminação da doença. O Sistema de Informação de Agravos de Notificação (SINAN foi designado para acompanhar o cumprimento dessa meta. OBJETIVO: Verificar a proporção dos casos de hanseníase diagnosticados nas unidades de saúde do município de Fortaleza que foi notificada ao SINAN. MÉTODOS: Foi feita a identificação dos casos diagnosticados e registrados nas unidades de saúde e notificados à Secretaria Municipal de Saúde de Fortaleza (SMSF entre 2002 e 2004 por meio da comparação nominal entre os registros locais e os registros do SINAN. RESULTADOS: Foram identificados e resgatados para o SINAN 411 casos que haviam sido diagnosticados e não notificados (17,5% do total informado de 15 (64% das unidades que informaram pelo menos um caso no período. Cerca 342 casos constavam nos livros e estavam notificados no banco de dados do SINAN das unidades de atendimento, mas não compunham o banco de dados do SINAN da SMSF. CONCLUSÕES: Constatou-se subnotificação de 14,9% dos casos detectados, fato que precisa ser prevenido para que os indicadores reflitam a real freqüência dos casos no município.BACKGROUND: To eliminate leprosy as a public health problem in Brazil, the Ministry of Health aims to achieve a prevalence rate of less than 1.0 case/10,000 inhabitants, encouraging diagnosis and treatment of patients and reducing dissemination of the disease. The National Disease Notification System (SINAN is in charge of verify the elimination plan results. OBJECTIVE: To verify the proportion of leprosy cases diagnosed and reported to SINAN by health centers of the city of Fortaleza, in Ceará, Northeastern region of Brazil. METHODS: Comparison between cases registered in

PERILAKU HARGA DAN VOLUME PERDAGANGAN (Studi Peristiwa Dampak Penundaan Pencairan Bantuan IMF pada Saham Dominasi Asing dengan Pendekatan Koreksi Beta

Directory of Open Access Journals (Sweden)

Rini - Mahgianti

2012-05-01

Full Text Available ABSTRACT   Theoritically has been stated that any relevant informations can create any market reactions indicated by price behaviour and trading volume. Research aimed  at analysing market reaction through any indicator of  cumulative abnormal return (CAR and cumulative abnormal trading volume (CATVA resulted by the delay of IMF grant.  Research was focused on the broad dominance stock and domestic dominance stock as a comparation. Market model approach was used in this analysis and the beta corection model to determine the expected return. Results show that delay of IMF grant contain any negative informations indicated by the significant reduce of CAR and CATVA, before and after annoucement.   Keywords: prive behaviour, CAR, CATVA, trading volume ABSTRAK   Secara teoritis dinyatakan bahwa informasi yang relevan dapat menimbulkan reaksi pasar yang dapat tercermin dari harga dan volume perdagangan. Penelitian ini bertujuan menguji reaksi pasar melalui indikator cumulative abnormal return (CAR dan cumulative abnormal trading volume (CATVA akibat pengumuman penundaan pencairan bantuan IMF. Obyek penelitian dilakukan pada saham dominasi asing dan sebagai pembanding dilakukan pula pengujian pada saham dominasi domestik. Pengujian dilakukan dengan pendekatan market model dan menambahkan model koreksi beta untuk penentuan expected return. Hasil penelitian yang diperoleh menunjukkan bahwa pengumuman penundaan bantuan IMF memiliki kandungan informasi negatif yang terlihat dari adanya penurunan CAR dan CATVA yang signifikan sebelum dan setelah pengumuman.   Kata kunci: Perilaku harga, CAR, CATVA, volume perdagangan

Ostomy Home Skills Program

Medline Plus

Full Text Available ... ASE Resident Prep Curriculum ACS/ASE Medical Student Core Curriculum ACS/ASE Medical Student Simulation-Based Surgical Skills Curriculum Cancer Education Cancer Education Cancer Education Cancer Programs Conference: Learn. ...

Your Lung Operation: After Your Operation

Medline Plus

Full Text Available ... ASE Resident Prep Curriculum ACS/ASE Medical Student Core Curriculum ACS/ASE Medical Student Simulation-Based Surgical Skills Curriculum Cancer Education Cancer Education Cancer Education Cancer Programs Conference: Learn. ...

Behind the scenes of GS: each to his own lock and key

CERN Multimedia

Anaïs Schaeffer

2014-01-01

The GS-ASE team in charge of access control has an access solution for every type of premises, from radiation-controlled areas to simple administrative offices.   Although CERN is unquestionably open to the world, some of its doors must remain closed for a simple reason: as an industrial site, it must put safety and security at the top of its priorities and control access to certain areas in order to protect people and property from hazards. The AC (Access Control) section of the GS-ASE group uses a range of access control tools as the type of restrictions varies considerably according to the type of premises or area concerned: the requirements at the entrances to the different CERN sites may be quite different, for example, to those at the entrances to a specific building, a storage area, a workshop or an experiment hall within the fenced part of the CERN site. “We use different types of access systems at CERN”, explains Rui Nunes, head of the GS-ASE-AC section. &ldq...

The regulation of alfalfa saponin extract on key genes involved in hepatic cholesterol metabolism in hyperlipidemic rats.

Directory of Open Access Journals (Sweden)

Yinghua Shi

Full Text Available To investigate the cholesterol-lowering effects of alfalfa saponin extract (ASE and its regulation mechanism on some key genes involved in cholesterol metabolism, 40 healthy 7 weeks old male Sprague Dawley (SD rats were randomly divided into four groups with 10 rats in each group: control group, hyperlipidemic group, ASE treatment group, ASE prevention group. The body weight gain, relative liver weight and serum lipid 1evels of rats were determined. Total cholesterol (TC and total bile acids (TBA levels in liver and feces were also measured. Furthermore, the activity and mRNA expressions of Hmgcr, Acat2, Cyp7a1 and Ldlr were investigated. The results showed the following: (1 The abnormal serum lipid levels in hyperlipidemic rats were ameliorated by ASE administration (both ASE prevention group and treatment group (P<0.05. (2 Both ASE administration to hyperlipidemic rats significantly reduced liver TC and increased liver TBA level (P<0.05. TC and TBA levels in feces of hyperlipidemic rats were remarkably elevated by both ASE administration (P<0.05. (3 mRNA expressions of Hmgcr and Acat2 in the liver of hyperlipidemic rats were remarkably down-regulated (P<0.05, as well as mRNA expressions of Cyp7a1 and Ldlr were dramatically up-regulated by both ASE administration (P<0.05. The activities of these enzymes also paralleled the observed changes in mRNA levels. (4 There was no significant difference between ASE treatment and ASE prevention group for most parameters evaluated. Our present study indicated that ASE had cholesterol-lowering effects. The possible mechanism could be attributed to (1 the down-regulation of Hmgcr and Acat2, as well as up-regulation of Cyp7a1 and Ldlr in the liver of hyperlipidemic rats, which was involved in cholesterol biosynthesis, uptake, and efflux pathway; (2 the increase in excretion of cholesterol. The findings in our study suggested ASE had great potential usefulness as a natural agent for treating hyperlipidemia.

Rocket experiment on spontaneously and artificially stimulated VLF plasma waves in the ionosphere

International Nuclear Information System (INIS)

Matsumoto, H.; Miyatake, S.; Kimura, I.

1975-01-01

In situ active experiments on the nonlinear wave-wave and wave-particle interactions in the ionospheric plasma were performed by a Japanese sounding rocket K-9M-41. Both spontaneously and artificially stimulated plasma waves in the VLF range were observed. When a large amplitude electron plasma wave was transmitted from the rocket, parametrically excited ion acoustic waves were observed in addition to natural emissions such as whistlers, LHR emissions, and hisslike emissions. It was also found that 'risers' were triggered by the LHR emissions, which seem to be very similar to a phenomenon of the so-called ASE (artificially stimulated emissions). When a slow electron beam with energy lower than 3 eV was ejected from the rocket, a new type of periodic U-shaped discrete emission was observed which was excited through a wave-particle interaction. The frequency of these emissions is lower than the LHR frequency and decreases as the beam energy is increased. Spectrograms of the observed plasma are presented, and some are analyzed theoretically. (auth)

Reviews Books: IGCSE physics textbooks from CIE and Edexcel Book: Three Steps to the Universe CD: ASE/SEP CD for Heads of Science and Principal Teachers Book: Exposed! Ouija, Firewalking and other Gibberish Book: Superconductivity: A Very Short Introduction Software: ROBOLAB 2.9 and NXT-G 2.0 Book: The Language of Physics: A Foundation for University Study Apparatus: Mini Magdeburgs Web Watch

Science.gov (United States)

2010-01-01

WE RECOMMEND IGCSE Physics (for the CIE course) A clear, approachable textbook for the new course ASE/SEP CD for Heads of Science and Principal Teachers An excellent resource to help those new to authority Superconductivity: A Very Short Introduction Well written summary of a complex subject ROBOLAB 2.9 Versatile datalogging software for Lego MINDSTORMS The Language of Physics: A Foundation for University Study Book closes the gap between A-level and degree-level physics Mini Magdeburgs Fun apparatus that can be used for teaching and play WORTH A LOOK Edexcel IGCSE Physics An up-to-date but uninspiring new textbook Three Steps to the Universe A book crammed full of space science Exposed! Ouija, Firewalking and other Gibberish Science explains why not to believe in pseudo-science HANDLE WITH CARE NXT-G 2.0 Very limited datalogging software for Lego MINDSTORMS WEB WATCH Virtual experiments have their place but cannot replace real practical work in the classroom

Ensaio terapêutico com o pamoato de pirantel na ascaridíase e enterobíase em dose única: estudo da atividade sôbre demais helmintos

Directory of Open Access Journals (Sweden)

Lino Dias Rodrigues

1970-12-01

Full Text Available Os autores apresentam estudo de 90 pacientes medicados pelo Pamoato de Pirantel (Trans-1,4,5,6-Tetraidro-1-metil-1-2/2- (2-Tienil vinil/pirimidina. todos portadores de parasitoses intestinais, principalmente Ascaris lumbricoides e Enterobius vermicularis. Os pacientes foram divididos em dois grupos; o primeiro, constituído de 25 pacientes, recebeu a dosagem de 5mg/kg, dose única, numa só tomada e neste grupo apenas se estudou a atividade terapêutica na ascaridiase e enterobiase. No segundo grupo, de 65 pacientes, empregou-se a dose única de 10mg/kg numa só tomada e foi estudada, além da ação terapêutica na ascaridiase e enterobiase, possível atividade também sôbre outras helmintiases. Todos os pacientes após a medicação eram submetidos a 3 exames proctoparasitoscópicos de controle (no 7º, 15º, e 30º dia e nos casos prèviamente positivos para Enterobius vermicularis também se fêz controle no 7º e 15º dia pelo "Anal-swab". Comprovaram os autores no primeiro grupo, cura proctoparasitológica de 13 dos 18 casos de ascaridiase (72,2%; na enterobiase obtiveram cura de 61,5%, e na associação Ascaris-Enterobius obtiveram cura de 50,0% de ambos os parasitas, não havendo, entretanto, nenhum caso de falha total nos casos restantes. No segundo grupo, os resultados que obtiveram foram os seguintes: ascaridiase, 50 casos; curados, 40 (80,0%. Enterobiase, 22 casos; curados, 16 (72,7%. Necaturiase, 8 casos; curados, 5 (17,8%. Tricuríase, 41 casos; curados, 5 (12,1%. Estrongiloidiase, 5 casos; curado, 1 caso (20,0%. Associação Enterobius-Ascaris, 14 casos; cura total de ambos os parasitas em 10 casos (71,4%; 4 casos com cura parcial de um ou do outro parasita, não havendo falha total em nenhum caso. Empregaram comprimidos contendo 100 e 300mg da substância ativa, e forma liquida contendo 10mg da substância ativa por cm³. Efeitos colaterais reduzidos em número e em intensidade; o primeiro grupo 12,0% dos casos (epigastralgia

Patterns of Care and Disparities in the Treatment of Early Breast Cancer

Science.gov (United States)

2010-09-01

that used claims- ased covariates to identify patients with a high probability f having stage I or II disease (unpublished data; Appendix, nline ). So...density markets or availability of collabora- tive knowledge and experience using new treatments associated with higher patient volumes. The

Translation into Brazilian portuguese and validation of the psoriasis family index Tradução e validação do instrumento índice de qualidade de vida para familiares de pacientes com psoríase para o português falado no Brasil

Directory of Open Access Journals (Sweden)

Juliana Catucci Boza

2013-06-01

Full Text Available Psoriasis Family Index is a quality of life instrument for family members of patients with psoriasis developed in English. The aims of this study were to translate the Psoriasis Family Index into Brazilian Portuguese, culturally adapt it and verify its reliability and validity. The study followed these two steps: 1 Translation, linguistic and cultural adaptation, 2 Validation. The translated Psoriasis Family Index showed high internal consistency and high test-retest reliability, confirming its reproducibility. The Portuguese version of the Psoriasis Family Index was validated for our population and can be recommended as a reliable instrument to assess the QoL of family members and partners of patients with psoriasis.Psoriasis Family Index é um instrumento para aferição da qualidade de vida em familiares de pacientes com psoríase, desenvolvido em língua inglesa. O objetivo deste estudo é traduzir o Psoriasis Family Index para o Português, adaptá-lo culturalmente e determinar sua confiabilidade e validade. Foi realizado em duas etapas: 1 tradução, adaptação cultural e linguística e 2 validação. O Psoriasis Family Index traduzido demonstrou alta consistência interna e alta confiabilidade de teste e reteste, confirmando sua reprodutibilidade. A versão brasileira do Psoriasis Family Index foi validada para nossa população e pode ser recomendada como uma ferramenta na avaliação da influência da psoríase na família dos pacientes.

Your Lung Operation: After Your Operation

Medline Plus

Full Text Available ... ASE Resident Prep Curriculum ACS/ASE Medical Student Core Curriculum ACS/ASE Medical Student Simulation-Based Surgical ... General Surgery Selected Readings in General Surgery CME Test Login SRGS Online Login Subscribe to SRGS Issues ...

Ostomy Home Skills Program

Medline Plus

Full Text Available ... ASE Resident Prep Curriculum ACS/ASE Medical Student Core Curriculum ACS/ASE Medical Student Simulation-Based Surgical ... General Surgery Selected Readings in General Surgery CME Test Login SRGS Online Login Subscribe to SRGS Issues ...

O exame neurológico inicial na hanseníase multibacilar: correlação entre a presença de nervos afetados com incapacidades presentes no diagnóstico e com a ocorrência de neurites francas

Directory of Open Access Journals (Sweden)

Pimentel Maria Inês Fernandes

2003-01-01

Full Text Available FUNDAMENTOS: As incapacidades constituem o principal problema decorrente da hanseníase. É importante identificar os fatores de risco envolvidos, de modo a acompanhar os pacientes mais propensos com maior atenção. OBJETIVOS: Determinar se a presença de nervos periféricos espessados e/ou dolorosos no momento do diagnóstico se correlaciona com a ocorrência de incapacidades físicas no exame inicial, bem como com episódios posteriores de neurite, em pacientes multibacilares, durante e após a poliquimioterapia. MÉTODOS: Foram estudados 103 pacientes portadores de formas multibacilares de hanseníase, sendo anotados a presença de nervos periféricos acometidos no momento o diagnóstico, o grau de incapacidade antes do tratamento (GIAT, e a ocorrência de episódios de neurites durante e após a poliquimioterapia para multibacilares. RESULTADOS: A detecção de nervos periféricos acometidos à época do diagnóstico correlacionou-se estatisticamente (p 0. Do mesmo modo, correlacionou-se significativamente (p < 0,05 com a ocorrência de neurites, durante a poliquimioterapia e no acompanhamento subseqüente (período médio de seguimento dos pacientes de 64,6 meses, a partir do diagnóstico. CONCLUSÃO: Sublinha-se a necessidade de realização de cuidadoso exame dos nervos periféricos por ocasião do diagnóstico, tanto para uma maior atenção para incapacidades já instaladas, quanto com relação à prevenção de incapacidades posteriores. Os profissionais que lidam com os portadores desta enfermidade devem estar atentos ao acometimento neurológico inicial por constituir fator de suscetibilidade às neurites e seqüelas neurológicas.

Comparison of nail lacquer clobetasol efficacy at 0,05%, 1% and 8% in nail psoriasis treatment: prospective, controlled and randomized pilot study Comparação da eficácia do clobetasol em esmalte 0,05%, 1% e 8% no tratamento da psoríase ungueal: estudo piloto, prospectivo, controlado e randomizado

Directory of Open Access Journals (Sweden)

Robertha Carvalho Nakamura

2012-04-01

Full Text Available BACKGROUND: Nail psoriasis may affect up to 90% of patients with psoriasis in the course of the disease throughout their lives and it is often a therapeutic challenge to dermatologists. Topical treatments described in the literature have demonstrated variable efficacy, and unsatisfactory results have been associated to inefficient penetration of the active ingredient into the nail plate and proximal nail fold. Recently the use of clobetasol on nail lacquer vehicle has been suggested, with satisfactory results and no side effects. OBJECTIVE: To determine the efficacy and safety of clobetasol in nail lacquer vehicle in three concentrations (0.05%, 1% and 8% in patients with nail psoriasis. METHODS: Prospective, controlled, randomized pilot study in fifteen patients with nail bed and/or nail matrix psoriasis in both hands, subdivided into three groups: A(0.05% clobetasol nail lacquer, B(1% clobetasol nail lacquer and C(8% clobetasol nail lacquer. All groups used clobetasol nail lacquer on the left hand and base coat nail lacquer as control on the right, twice a week for 16 weeks. Clinical evaluation was done by photographic records and the NAPSI score of both treated and control hands, as well as modified NAPSI score of the most affected nail of the treated hand. RESULTS: Group C showed a statistically relevant clinical response compared to the other groups, reflected in the improvement of clinical parameters, of treated hand NAPSI score, when compared to the control hand, and modified NAPSI score of the most affected nail in the treated hand. CONCLUSION: The 8% clobetasol nail lacquer was effective and safe, and it can be considered a good option of topical therapy in the treatment of nail psoriasis.FUNDAMENTOS: A psoríase ungueal, de difícil manejo terapêutico, pode afetar até 90% dos portadores de psoríase no transcurso da doença, ao longo de suas vidas. Os tratamentos tópicos descritos na literatura têm eficácia variável, muitas vezes

O “drama” da hanseníase: Governador Valadares, as políticas públicas de saúde e suas implicações territoriais na década de 1980

Directory of Open Access Journals (Sweden)

Patrícia Falco Genovez

Full Text Available Resumo A incidência da hanseníase em Governador Valadares nos anos 1980 propiciou à cidade tornar-se uma das pioneiras na introdução da poliquimioterapia. O objetivo aqui é compreender as relações entre os diversos “atores” inseridos nesse contexto, especialmente os funcionários da Fundação Serviço Especial de Saúde Pública e os pacientes. Para a identificação dos territórios que essas relações necessariamente constituíam, foram utilizados diversos instrumentos teóricos, como o “dramatismo” (Burke e a performance (Turner. Buscou-se, com a metáfora teatral, uma dinâmica na qual os diversos atores não só se apresentassem, mas também estabelecessem as suas relações mais significativas, num processo dinâmico de constituições e reconstituições de territórios.

Effects of attitude, social influence, and self-efficacy model factors on regular mammography performance in life-transition aged women in Korea.

Science.gov (United States)

Lee, Chang Hyun; Kim, Young Im

2015-01-01

This study analyzed predictors of regular mammography performance in Korea. In addition, we determined factors affecting regular mammography performance in life-transition aged women by applying an attitude, social influence, and self-efficacy (ASE) model. Data were collected from women aged over 40 years residing in province J in Korea. The 178 enrolled subjects provided informed voluntary consent prior to completing a structural questionnaire. The overall regular mammography performance rate of the subjects was 41.6%. Older age, city residency, high income and part-time job were associated with a high regular mammography performance. Among women who had undergone more breast self-examinations (BSE) or more doctors' physical examinations (PE), there were higher regular mammography performance rates. All three ASE model factors were significantly associated with regular mammography performance. Women with a high level of positive ASE values had a significantly high regular mammography performance rate. Within the ASE model, self-efficacy and social influence were particularly important. Logistic regression analysis explained 34.7% of regular mammography performance and PE experience (β=4.645, p=.003), part- time job (β=4.010, p=.050), self-efficacy (β=1.820, p=.026) and social influence (β=1.509, p=.038) were significant factors. Promotional strategies that could improve self-efficacy, reinforce social influence and reduce geographical, time and financial barriers are needed to increase the regular mammography performance rate in life-transition aged.

Allele-specific expression in the germline of patients with familial pancreatic cancer: An unbiased approach to cancer gene discovery

OpenAIRE

Tan, Aik Choon; Fan, Jian-Bing; Karikari, Collins; Bibikova, Marina; Garcia, Eliza Wickham; Zhou, Lixin; Barker, David; Serre, David; Feldmann, Georg; Hruban, Ralph H.; Klein, Alison P.; Goggins, Michael; Couch, Fergus J.; Hudson, Thomas J.; Winslow, Raimond L.

2007-01-01

Physiologic allele-specific expression (ASE) in germline tissues occurs during random X-chromosome inactivation1 and in genomic imprinting,2 wherein the two alleles of a gene in a heterozygous individual are not expressed equally. Recent studies have confirmed the existence of ASE in apparently non-imprinted autosomal genes;3–14 however, the extent of ASE in the human genome is unknown. We explored ASE in lymphoblastoid cell lines of 145 individuals using an oligonucleotide array based assay....

Embodying complexity through movement sonification : case study on empowering the speed-skater

NARCIS (Netherlands)

Stienstra, J.T.; Overbeeke, C.J.; Wensveen, S.A.G.

2011-01-01

In this paper, we describe the Augmented Speed-skate Experience (ASE), a case of movement sonification in professional speed-skating. We designed and developed a system that provides feedback on technique to a professional speed-skater through an extra sense-modality, i.e. sound. Complexity is

Theoretical and experimental study of fundamental differences in the noise suppression of high-speed SOA-based all-optical switches

DEFF Research Database (Denmark)

Nielsen, Mads Lønstrup; Mørk, Jesper; Suzuki, R.

2005-01-01

We identify a fundamental difference between the ASE noise filtering properties of different all-optical SOA-based switch configurations, and divide the switches into two classes. An in-band ASE suppression ratio quantifying the difference is derived theoretically and the impact of the ASE...

Abnormally Malicious Autonomous Systems and their Internet Connectivity

Energy Technology Data Exchange (ETDEWEB)

Shue, Craig A [ORNL; Kalafut, Prof. Andrew [Grand Valley State University (GVSU), Michigan; Gupta, Prof. Minaxi [Indiana University

2011-01-01

While many attacks are distributed across botnets, investigators and network operators have recently targeted malicious networks through high profile autonomous system (AS) de-peerings and network shut-downs. In this paper, we explore whether some ASes indeed are safe havens for malicious activity. We look for ISPs and ASes that exhibit disproportionately high malicious behavior using ten popular blacklists, plus local spam data, and extensive DNS resolutions based on the contents of the blacklists. We find that some ASes have over 80% of their routable IP address space blacklisted. Yet others account for large fractions of blacklisted IP addresses. Several ASes regularly peer with ASes associated with significant malicious activity. We also find that malicious ASes as a whole differ from benign ones in other properties not obviously related to their malicious activities, such as more frequent connectivity changes with their BGP peers. Overall, we conclude that examining malicious activity at AS granularity can unearth networks with lax security or those that harbor cybercrime.

Quantificação do stone clinic effect em pacientes com nefrolitíase Quantification of the stone clinic effect in patients with nephrolithiasis

Directory of Open Access Journals (Sweden)

Maurício Carvalho

2004-01-01

Full Text Available O termo stone clinic effect refere-se ao efeito do aumento da ingestão hídrica e aconselhamento dietético na evolução clínica da doença calculosa renal. OBJETIVO: O nosso objetivo foi quantificar esta variável em pacientes portadores de nefrolitíase. MÉTODOS: Vinte e cinco pacientes (11 mulheres e 14 homens; 47,64±10,55 anos com nefrolitíase recorrente foram acompanhados com consultas trimestrais por um ano. Orientações sobre aumento da ingestão hídrica, diminuição do consumo de sal e proteína foram rotineiramente fornecidas. Nenhum paciente foi submetido à terapia farmacológica. Foram coletados no início (S1 e no final do seguimento (S2 os seguintes parâmetros: atividade clínica e radiológica da doença litiásica, urina de 24 horas com dosagem de creatinina, cálcio, sódio, ácido úrico, citrato, oxalato e magnésio. A supersaturação (SS para o oxalato de cálcio foi calculada pelo índice de Tiselius. RESULTADOS: Onze (44% pacientes apresentaram hipocitratúria, nove (36% hipercalciúria e cinco (20% hiperuricosúria. Houve aumento do volume urinário (1903±811 vs 2381±919 ml/dia, pBACKGROUND: The ''stone clinic effect'' refers to the effect of encouraging a high intake of fluid and diet counseling in the clinical evolution of kidney stone disease. Objective: Our objective was to determine the extent of this variable in patients with nephrolithiasis. METHODS: Twenty-five patients (11 female and 14 male; 47.64±10.55 years old with recurrent nephrolithiasis were prospectively followed for one year, with 3-month interval medical evaluation. Patients were advised to increase the fluid intake, and to limit the intake of salt and protein. No patient was submitted to pharmacological therapy. Two 24-hour urine samples were collected at baseline (S1 and in the end of follow-up (S2 for the measurement of creatinine, calcium, sodium, uric acid, citrate, oxalate and magnesium. Metabolic and radiological activity was also

Clinical etiology of myiasis in ENT: a reterograde period - interval study Etiologia clínica da miíase em otorrinolaringologia: um estudo retrospectivo

Directory of Open Access Journals (Sweden)

Shitij Arora

2009-06-01

Full Text Available Myiasis in ENT, once a deadly disease still presents as a significant outdoor problem, though advances in management including supportive therapy has led to early healing with significant reduction in bed occupancy rate. AIMS: To assess the clinico etiology, relationship of myiasis to habit and habitat of patients and to assess the changes in age, seasonal, socioeconomic incidence, nasal bacterial flora and usefulness of certain commonly done tests with reference to a gap of 25 years. MATERIALS & METHODS: The presenting study was conducted on 80 patients selected over a period of two time intervals ; first 40 cases were chosen from 1979 to 1980 and next 40 over 2003 to 2004. Cases were studied in a retrograde manner and data tabulated. RESULTS & CONCLUSIONS: Atrophic turbinates was the commonest pathological finding in nose in 30% of cases . Significant change seen was in the age group 51 and above with a rise of 30%. Mode during 2003-04 was 60 years. Incidence of palatal perforation dropped from 17.88 to 2.5% . Klebsiella emerged as a significant contributor to the nasal microbial flora. VDRL and split skin smear showed poor etiological association for the diseases.Miíase em ORL não é mais uma doença fatal, mas ainda está presente como um significativo problema em ambientes externos. Entretanto, progressos alcançados no tratamento, incluindo terapêutica de suporte, têm levado à cura precoce com significativa redução na taxa de internação hospitalar por causa dessa enfermidade. OBJETIVOS: Avaliar a etiologia clínica e as associações entre miíase e os hábitos e habitats dos pacientes; e avaliar diferenças no tocante à idade, estação do ano, incidência socioeconômica, flora bacteriana nasal e a utilidade de certos exames comumente feitos - um estudo retrospectivo de 25 anos. MATERIAIS E MÉTODOS: O presente estudo envolveu 80 pacientes selecionados em dois períodos; os primeiros 40 casos foram selecionados de 1979 a 1980

Molecular biology of microbial hydrogenases.

Science.gov (United States)

Vignais, P M; Colbeau, A

2004-07-01

Hydrogenases (H2ases) are metalloproteins. The great majority of them contain iron-sulfur clusters and two metal atoms at their active center, either a Ni and an Fe atom, the [NiFe]-H2ases, or two Fe atoms, the [FeFe]-H2ases. Enzymes of these two classes catalyze the reversible oxidation of hydrogen gas (H2 2 H+ + 2 e-) and play a central role in microbial energy metabolism; in addition to their role in fermentation and H2 respiration, H2ases may interact with membrane-bound electron transport systems in order to maintain redox poise, particularly in some photosynthetic microorganisms such as cyanobacteria. Recent work has revealed that some H2ases, by acting as H2-sensors, participate in the regulation of gene expression and that H2-evolving H2ases, thought to be involved in purely fermentative processes, play a role in membrane-linked energy conservation through the generation of a protonmotive force. The Hmd hydrogenases of some methanogenic archaea constitute a third class of H2ases, characterized by the absence of Fe-S cluster and the presence of an iron-containing cofactor with catalytic properties different from those of [NiFe]- and [FeFe]-H2ases. In this review, we emphasise recent advances that have greatly increased our knowledge of microbial H2ases, their diversity, the structure of their active site, how the metallocenters are synthesized and assembled, how they function, how the synthesis of these enzymes is controlled by external signals, and their potential use in biological H2 production.

Severe exercise and exercise training exert opposite effects on human neutrophil apoptosis via altering the redox status.

Directory of Open Access Journals (Sweden)

Guan-Da Syu

Full Text Available Neutrophil spontaneous apoptosis, a process crucial for immune regulation, is mainly controlled by alterations in reactive oxygen species (ROS and mitochondria integrity. Exercise has been proposed to be a physiological way to modulate immunity; while acute severe exercise (ASE usually impedes immunity, chronic moderate exercise (CME improves it. This study aimed to investigate whether and how ASE and CME oppositely regulate human neutrophil apoptosis. Thirteen sedentary young males underwent an initial ASE and were subsequently divided into exercise and control groups. The exercise group (n = 8 underwent 2 months of CME followed by 2 months of detraining. Additional ASE paradigms were performed at the end of each month. Neutrophils were isolated from blood specimens drawn at rest and immediately after each ASE for assaying neutrophil spontaneous apoptosis (annexin-V binding on the outer surface along with redox-related parameters and mitochondria-related parameters. Our results showed that i the initial ASE immediately increased the oxidative stress (cytosolic ROS and glutathione oxidation, and sequentially accelerated the reduction of mitochondrial membrane potential, the surface binding of annexin-V, and the generation of mitochondrial ROS; ii CME upregulated glutathione level, retarded spontaneous apoptosis and delayed mitochondria deterioration; iii most effects of CME were unchanged after detraining; and iv CME blocked ASE effects and this capability remained intact even after detraining. Furthermore, the ASE effects on neutrophil spontaneous apoptosis were mimicked by adding exogenous H(2O(2, but not by suppressing mitochondrial membrane potential. In conclusion, while ASE induced an oxidative state and resulted in acceleration of human neutrophil apoptosis, CME delayed neutrophil apoptosis by maintaining a reduced state for long periods of time even after detraining.

Slovakian-Russian partnership as a part of the supply chain for nuclear power plants and advanced Russian technology for nuclear power plants

International Nuclear Information System (INIS)

Ivanov, T.; Chernyakhovskaya, Y.

2009-01-01

The first nuclear power project in the Slovak Republic was launched in 1958 through close cooperation with the Russian nuclear industry. Since then the Slovak and Russian nuclear branches were never separated. Technical and economic performances of the NPP units constructed with participation of Russian specialists were and continue being one of the best globally. The culture of business and competence of ASE is based on about 40 years of experience in construction of 29 NPP power units abroad with 20 GW total capacity. ASE strives to present to the Customers line of NPP designs ready for implementation and well-developed network of the multi-functional alliances and JVs. Currently, large-scale NPP projects involve public-private partnership (PPP) more and more. ASE development vision is to flexibly conform to Customers' requirements and needs and to diversify in related segments of EPC-business, namely designing, manufacturing, electric power trade, etc. Systematical approach to the fostering of mutual relations under the new economic conditions and nuclear renaissance, the Slovak-Russian cooperation in NPP engineering, manufacturing and construction are once again promising and long-term oriented. (authors)

Amplification of picosecond pulse by electron-beam pumped KrF laser amplifiers. Denshi beam reiki KrF laser zofukuki ni yoru piko byo pulse no zofuku

Energy Technology Data Exchange (ETDEWEB)

Okuda, I.; Tomie, T.; Owadano, Y.; Yano, M. (Electrotechnical Laboratory, Tsukuba (Japan))

1991-08-20

Experiments on the amplification of a picosecond pulse by electron-beam pumped KrF laser amplifiers were carried out for the purpose of its application to the field such as excitation light source for soft X-ray laser which requires large energy besides peak power. The picosecond pulse was amplified by a discharge pumped KrF amplifier and two electron-beam pumped KrF amplifiers(at the middle stage and the final stage). The energy of 4J, which was the largest energy for short pulse excimer laser so far, was obtained by these devices. About 90% of the window area of the final amplifier with 29cm diameter was filled by the input beam, and energy density of the picosecond beam reached 3.9 times saturation energy density. Measured energy of amplified spontaneous emission(ASE) showed good agreement with the theoretically estimated value. Most of ASE was derived from the discharge pumped laser as the first amplifier. As for the focused power density, the power density ratio of the picosecond pulse to ASE was estimated to be as large as 10{sup 5}. 11 refs., 4 figs.

Hanseníase em populações indígenas do Amazonas, Brasil: um estudo epidemiológico nos municípios de Autazes, Eirunepé e São Gabriel da Cachoeira (2000 a 2005 Leprosy in indigenous populations of Amazonas State, Brazil: an epidemiological study in the counties of Autazes, Eirunepé and São Gabriel da Cachoeira (2000 to 2005

Directory of Open Access Journals (Sweden)

Elsia Belo Imbiriba

2009-05-01

Full Text Available O Estado do Amazonas, Brasil, apresentou, em 2005, coeficientes hiperendêmicos de detecção de hanseníase e prevalência de média endemicidade. O estado detém a maior população indígena no país, mas inexistem informações sobre o perfil da hanseníase nesses grupos. O estudo objetivou a descrição e análise das características epidemiológicas das notificações de hanseníase nos municípios de Autazes, Eirunepé e São Gabriel da Cachoeira, comparando achados entre indígenas e não indígenas, segundo variáveis de interesse. Foram analisados os casos notificados no SINAN, no período de 2000 a 2005. Do total de 386 casos notificados, verificaram-se coeficientes médios de detecção de 3,55, 14,94 e 2,13/10 mil (entre os não indígenas e de 10,95, 1,93 e 0,78/10 mil (para os indígenas, para Autazes, Eirunepé e São Gabriel da Cachoeira, respectivamente. Houve predomínio de casos paucibacilares em indígenas e em não indígenas, no entanto, a forma dimorfa representou 1/3 das notificações. Apesar das limitações de cobertura e do sub-registro, os achados sugerem que a hanseníase representa importante problema de saúde pública para os indígenas no Amazonas. A classificação segundo "raça/etnicidade" se constituiu em ferramenta útil para elucidar desigualdades em saúde.In 2005, Amazonas State, Brazil, showed hyperendemic leprosy detection coefficients and prevalence with medium endemicity. Although this State has the largest indigenous population in Brazil, there are no data on the leprosy profile in these groups. This study aimed to describe and analyze the epidemiological characteristics of leprosy case reporting in the municipalities (counties of Autazes, Eirunepé, and São Gabriel da Cachoeira, comparing indigenous and non-indigenous findings according to target variables. A total of 386 cases reported to SINAN from 2000 to 2005 were analyzed. Mean detection rates were 3.55, 14.94, and 2.13/10,000 (among non

To danske tilfælde af autoimmun synaptisk encefalitis

DEFF Research Database (Denmark)

Nielsen, Signe Modvig; Høi-Hansen, Christina Engel; Uldall, Peter

2012-01-01

Autoimmune synaptic encephalitis (ASE) is a recently recognized disease entity. The early and correct diagnosis of ASE is of importance, since the prognosis depends on the early onset of treatment. We present two Danish case reports of ASE: a 15-year-old boy presenting with a severe course of N...

Fabrication of hydrogenase-cationic electrolyte biohybrids at interfaces and their electrochemical properties in Langmuir-Blodgett films

International Nuclear Information System (INIS)

Liu An; Zorin, Nikolay A.; Nakamura, Chikashi; Miyake, Jun; Qian Dongjin

2010-01-01

Hydrogenase (H 2 ase)-cationic electrolyte biohybrids were assembled at the air-water interface via intermolecular electrostatic interaction. The H 2 ase used was purified from the phototropic bacterium of Thiocapsa roseopersicina. Two kinds of cationic electrolyte compounds (CECs) were used, the difference of which was whether they contained viologen substituent or not. Surface pressure-area isotherms indicated that these CECs were co-existed with the H 2 ase in the monolayers, which were then transferred to substrate surfaces to form H 2 ase-CECs hybrid films by the Langmuir-Blodgett (LB) method. Uniform film was formed when polyelectrolyte was used as the subphase. Cyclic voltammograms (CVs) of the LB films showed a couple of redox waves in the potential range of -0.4 to -0.65 V vs. Ag/AgCl, which was ascribed to one electron process of either [4Fe-4S] clusters of H 2 ase or viologens of the CECs. A direct electron transfer between the H 2 ase and electrode surface was achieved in the LB films. Stronger current intensity was recorded when the CV measurements were done in H 2 saturated electrolyte solution than that in Ar. It was confirmed that the H 2 ase biocatalytic activity remained in the LB films. Thus, we suggest that the present H 2 ase-CECs biohybrids could act as potential materials for the studies of interconversion reaction of H 2 and protons.

Comportamento da eosinofilia após o tratamento das geohelmintoses

Directory of Open Access Journals (Sweden)

Marta Maria Bozóti

1973-04-01

Full Text Available A eosinofilia sanguínea após o tratamento anti-helmíntico específico se comportou numa amostragem de 57 crianças da seguinte forma: .Na ascaridíase isolada ou associada à trieuríase a hipereosinofilia parasitária ou descia uniformemente após o tratamento, ou houve primeiro uma exacerbação que durava até a terceira semana após a erradicação da, parasitose, descendo em seguida. Em ambos os casos houve normalização do hemograma em dois meses. Na associação ascaridíase/ancilostomíase também são possíveis dois tipos de comportamento da eosinofilia após tratamento eficaz: ou vai diminuindo a hipereosinofilia, logo em seguida à expulsão dos parasitos, ou há no primeiro mês um aumento da hipereosinofilia (geralmente mais acentuado na primeira semana que se segue ao tratamento, para diminuir após o fim do primeiro mês progressivamente até desaparecer. Na estrongiloidíase e na associação ascaridíase/estrongiloidíase há diminuição constante da hipereosinofilia logo após o tratamento e o hemograma se normaliza em cerca de dois meses. Na trieuríase, a hipereosinofilia, aliás já discreta, diminui pouco com o tratamento. Na ancilostomíase e na associação ancilostomíase/trieuríase a hipereosinofilia ou desce após o tratamento gradativo e lentamente, ou primeiro há uma exaltação temporária nas primeiras três semanas após a terapêutica, para diminuir em seguida. Na associação ancilostomíase/estrongiloidíase também se encontram esses dois tipos de comportamento da hipereosinofilia verminótica, mas a exacerbação da hipereosinofilia, que ocorre na metade dos casos, só dura duas semanas; a regressão eosinofílica ocorre dois meses após o tratamento. Nas tri e tetraeparasitoses a involução pós-terapêutica da hipereosinofilia é irregular e a normalização das taxas sanguíneas de eosinófilos é sempre arrastada, principalmente nas associações ascaridíase/estrongiloidíase/ancilostomíase e

Euterpe oleracea Mart.-Derived Polyphenols Protect Mice from Diet-Induced Obesity and Fatty Liver by Regulating Hepatic Lipogenesis and Cholesterol Excretion.

Science.gov (United States)

de Oliveira, Paola Raquel B; da Costa, Cristiane A; de Bem, Graziele F; Cordeiro, Viviane S C; Santos, Izabelle B; de Carvalho, Lenize C R M; da Conceição, Ellen Paula S; Lisboa, Patrícia Cristina; Ognibene, Dayane T; Sousa, Pergentino José C; Martins, Gabriel R; da Silva, Antônio Jorge R; de Moura, Roberto S; Resende, Angela C

2015-01-01

The aim of this study was to investigate the effect of a polyphenol-rich Açaí seed extract (ASE, 300 mg/kg-1d-1) on adiposity and hepatic steatosis in mice that were fed a high-fat (HF) diet and its underlying mechanisms based on hepatic lipid metabolism and oxidative stress. Four groups were studied: C57BL/6 mice that were fed with standard diet (10% fat, Control), 10% fat + ASE (ASE), 60% fat (HF), and 60% fat + ASE (HF + ASE) for 12 weeks. We evaluated the food intake, body weight gain, serum glucose and lipid profile, hepatic cholesterol and triacyglycerol (TG), hepatic expression of pAMPK, lipogenic proteins (SREBP-1c, pACC, ACC, HMG-CoA reductase) and cholesterol excretion transporters, ABCG5 and ABCG8. We also evaluated the steatosis in liver sections and oxidative stress. ASE reduced body weight gain, food intake, glucose levels, accumulation of cholesterol and TG in the liver, which was associated with a reduction of hepatic steatosis. The increased expressions of SREBP-1c and HMG-CoA reductase and reduced expressions of pAMPK and pACC/ACC in HF group were antagonized by ASE. The ABCG5 and ABCG8 transporters expressions were increased by the extract. The antioxidant effect of ASE was demonstrated in liver of HF mice by restoration of SOD, CAT and GPx activities and reduction of the increased levels of malondialdehyde and protein carbonylation. In conclusion, ASE substantially reduced the obesity and hepatic steatosis induced by HF diet by reducing lipogenesis, increasing cholesterol excretion and improving oxidative stress in the liver, providing a nutritional resource for prevention of obesity-related adiposity and hepatic steatosis.

Electrical interface characteristics (I-V), optical time of flight measurements, and the x-ray (20 keV) signal response of amorphous-selenium/crystalline-silicon heterojunction structures

Science.gov (United States)

Hunter, David M.; Ho, Chu An; Belev, George; De Crescenzo, Giovanni; Kasap, Safa O.; Yaffe, Martin J.

2011-03-01

We have investigated the dark current, optical TOF (time of flight) properties, and the X-ray response of amorphousselenium (a-Se)/crystalline-silicon (c-Si) heterostructures for application in digital radiography. The structures have been studied to determine if an x-ray generated electron signal, created in an a-Se layer, could be directly transferred to a c-Si based readout device such as a back-thinned CCD (charge coupled device). A simple first order band-theory of the structure indicates that x-ray generated electrons should transfer from the a-Se to the c-Si, while hole transfer from p-doped c-Si to the a-Se should be blocked, permitting a low dark signal as required. The structures we have tested have a thin metal bias electrode on the x-ray facing side of the a-Se which is deposited on the c-Si substrate. The heterostructures made with pure a-Se deposited on epitaxial p-doped (5×10 14 cm-3) c-Si exhibited very low dark current of 15 pA cm-2 at a negative bias field of 10 V μm-1 applied to the a-Se. The optical TOF (time of flight) measurements show that the applied bias drops almost entirely across the a-Se layer and that the a-Se hole and electron mobilities are within the range of commonly accepted values. The x-ray signal measurements demonstrate the structure has the expected x-ray quantum efficiency. We have made a back-thinned CCD coated with a-Se and although most areas of the device show a poor x-ray response, it does contain small regions which do work properly with the expected x-ray sensitivity. Improved understanding of the a-Se/c-Si interface and preparation methods should lead to properly functioning devices.

Antistress activity of Argyreia speciosa roots in experimental animals

Directory of Open Access Journals (Sweden)

Nikunj B Patel

2011-01-01

Full Text Available The antistress effect of a seven-day treatment (100 and 200 mg / kg, p.o. of the hydroalcoholic extract of Argyreia speciosa root (ASE was evaluated by using the swimming endurance test, acetic acid-induced writhing test, pentylenetetrazole-induced convulsion test, anoxic tolerance test, cold-restraint, stress-induced gastric ulcers, aspirin-induced ulcers, and biochemical, and histopathological changes in the cold-restraint stress test. The immunomodulatory activity was also evaluated for the same doses, and treatment of ASE was done using the hemagglutination test. Both the doses of ASE showed antistress activity in all the tested models. The ASE-treated animals showed a decrease in immobility time and an increase in anoxic tolerance time in swimming endurance and the anoxic tolerance tests, respectively. The effect of glacial acetic acid and pentylenetetrazole were also reduced by decreasing the number of writhing responses and increasing the onset of convulsions, respectively. In the cold restrained stress and aspirin-induced gastric ulcer models, ASE showed a significant reduction in the ulcer index. Pretreatment with ASE significantly ameliorated the cold stress-induced variations in biochemical levels such as increased plasma cholesterol, triglyceride, glucose, total protein, and cortisol. ASE was also effective in preventing the pathological changes in the adrenal gland, due to cold restrained stress, in rats. In mice immunized with sheep red blood cells, the treatment groups subjected to restraint stress prevented the humoral immune response to the antigen. The immunostimulating activity of the ASE was indicated by an increase in the antibody titer in mice pre-immunized with sheep red blood cells and subjected to restraint stress. The findings of the present investigations indicate that the ASE has significant antistress activity, which may be due to the immunostimulating property and increased resistance, nonspecifically, against all

Structural characterization of CO-inhibited Mo-nitrogenase by combined application of nuclear resonance vibrational spectroscopy, extended X-ray absorption fine structure, and density functional theory: new insights into the effects of CO binding and the role of the interstitial atom.

Science.gov (United States)

Scott, Aubrey D; Pelmenschikov, Vladimir; Guo, Yisong; Yan, Lifen; Wang, Hongxin; George, Simon J; Dapper, Christie H; Newton, William E; Yoda, Yoshitaka; Tanaka, Yoshihito; Cramer, Stephen P

2014-11-12

The properties of CO-inhibited Azotobacter vinelandii (Av) Mo-nitrogenase (N2ase) have been examined by the combined application of nuclear resonance vibrational spectroscopy (NRVS), extended X-ray absorption fine structure (EXAFS), and density functional theory (DFT). Dramatic changes in the NRVS are seen under high-CO conditions, especially in a 188 cm(-1) mode associated with symmetric breathing of the central cage of the FeMo-cofactor. Similar changes are reproduced with the α-H195Q N2ase variant. In the frequency region above 450 cm(-1), additional features are seen that are assigned to Fe-CO bending and stretching modes (confirmed by (13)CO isotope shifts). The EXAFS for wild-type N2ase shows evidence for a significant cluster distortion under high-CO conditions, most dramatically in the splitting of the interaction between Mo and the shell of Fe atoms originally at 5.08 Å in the resting enzyme. A DFT model with both a terminal -CO and a partially reduced -CHO ligand bound to adjacent Fe sites is consistent with both earlier FT-IR experiments, and the present EXAFS and NRVS observations for the wild-type enzyme. Another DFT model with two terminal CO ligands on the adjacent Fe atoms yields Fe-CO bands consistent with the α-H195Q variant NRVS. The calculations also shed light on the vibrational "shake" modes of the interstitial atom inside the central cage, and their interaction with the Fe-CO modes. Implications for the CO and N2 reactivity of N2ase are discussed.

[Aging Law of PAHs in Contaminated Soil and Their Enrichment in Earthworms Characterized by Chemical Extraction Techniques].

Science.gov (United States)

Zhang, Ya-nan; Yang, Xing-lun; Bian, Yong-rong; Gu, Cheng-gang; Liu, Zong-tang; Li, Jiao; Wang, Dai-zhang; Jiang, Xin

2015-12-01

To evaluate the effect of aging on the availability of PAHs, chemical extraction by exhaustive ( ASE extraction) and nonexhaustive techniques (Tenax-TA extraction, hydroxypropyl-p-cyclodextrin ( HPCD ) extraction, n-butyl alcohol ( BuOH) extraction) as well as PAHs accumulation in earthworms (Eisenia fetida) were conducted in yellow soil from Baguazhou, Nanjing, China, and red soil from Hainan, China, spiked with phenanthrene, pryene and benzo(a) pyrene and aged 0, 7, 15, 30 and 60 days. The results showed that the concentration of PAHs extracted by ASE and three nonexhaustive techniques and accumulated by earthworms significantly decreased with aging time, except the ASE extracted concentration between 30-and 60-day aging time. Furthermore, the relationships were studied in this experiment between chemical extracted PAHs concentration and accumulated concentration in earthworms. PAHs accumulated concentration in earthworms was not significantly correlated with the exhaustive extracted concentration of PAHs in soil (R² 0.44-0.56), which indicated that ASE extraction techniques could not predict PAHs bioavailability to earthworms because it overestimated the risk of PAHs. However, the PAHs accumulated concentration in earthworms was significantly correlated with the three nonexhaustive extracted concentrations of PAHs in soil, which indicated that all the three nonexhaustive techniques could predict PAHs bioavailability to earthworm to some extent, among which, HPCD extraction (R² 0.94-0.99) was better than Tenax-TA extraction (R² 0.62-0.87) and BuOH extraction (R² 0.69-0.94). So HPCD extraction was a more appropriate and reliable technique to predict bioavailability of PAHs in soil.

Average spectral efficiency analysis of FSO links over turbulence channel with adaptive transmissions and aperture averaging

Science.gov (United States)

Aarthi, G.; Ramachandra Reddy, G.

2018-03-01

In our paper, the impact of adaptive transmission schemes: (i) optimal rate adaptation (ORA) and (ii) channel inversion with fixed rate (CIFR) on the average spectral efficiency (ASE) are explored for free-space optical (FSO) communications with On-Off Keying (OOK), Polarization shift keying (POLSK), and Coherent optical wireless communication (Coherent OWC) systems under different turbulence regimes. Further to enhance the ASE we have incorporated aperture averaging effects along with the above adaptive schemes. The results indicate that ORA adaptation scheme has the advantage of improving the ASE performance compared with CIFR under moderate and strong turbulence regime. The coherent OWC system with ORA excels the other modulation schemes and could achieve ASE performance of 49.8 bits/s/Hz at the average transmitted optical power of 6 dBm under strong turbulence. By adding aperture averaging effect we could achieve an ASE of 50.5 bits/s/Hz under the same conditions. This makes ORA with Coherent OWC modulation as a favorable candidate for improving the ASE of the FSO communication system.

Area Spectral Efficiency and Energy Efficiency Tradeoff in Ultradense Heterogeneous Networks

Directory of Open Access Journals (Sweden)

Lanhua Xiang

2017-01-01

Full Text Available In order to meet the demand of explosive data traffic, ultradense base station (BS deployment in heterogeneous networks (HetNets as a key technique in 5G has been proposed. However, with the increment of BSs, the total energy consumption will also increase. So, the energy efficiency (EE has become a focal point in ultradense HetNets. In this paper, we take the area spectral efficiency (ASE into consideration and focus on the tradeoff between the ASE and EE in an ultradense HetNet. The distributions of BSs in the two-tier ultradense HetNet are modeled by two independent Poisson point processes (PPPs and the expressions of ASE and EE are derived by using the stochastic geometry tool. The tradeoff between the ASE and EE is formulated as a constrained optimization problem in which the EE is maximized under the ASE constraint, through optimizing the BS densities. It is difficult to solve the optimization problem analytically, because the closed-form expressions of ASE and EE are not easily obtained. Therefore, simulations are conducted to find optimal BS densities.

Antiherpes Activity and Skin/Mucosa Distribution of Flavonoids from Achyrocline satureioides Extract Incorporated into Topical Nanoemulsions

Directory of Open Access Journals (Sweden)

Juliana Bidone

2015-01-01

Full Text Available This study investigated the inhibitory effects of Achyrocline satureioides extract (ASE incorporated into a topical nanoemulsion on Herpes Simplex Virus type 1 (HSV-1/KOS strain replication, as well as the distribution of the main ASE flavonoids (quercetin, luteolin, and 3-O-methylquercetin in porcine skin and mucosa. The ASE-loaded nanoemulsion showed more pronounced effects against HSV-1 replication when compared to the ASE or pure quercetin, as determined by the viral plaque number reduction assay. All flavonoids were detected in the skin epidermis (2.2 µg/cm2 and the mucosa upper layers (3.0 µg/cm2 from ASE-loaded nanoemulsion until 8 h after topical application. A higher amount of flavonoids was detected when these tissues were impaired, especially in deeper mucosa layers (up to 7-fold. Flavonoids were detected in the receptor fluid only when the mucosa was injured. Such results were supported by confocal microscopy images. Overall, these findings suggest that the tested ASE-loaded nanoemulsion has potential to be used topically for herpes infections.

Positividade sorológica antiPGL-I em contatos domiciliares e peridomiciliares de hanseníase em área urbana Seropositivity with anti-PGL-I of household and neighbours contacts of leprosy patients in an urban area

Directory of Open Access Journals (Sweden)

Karla Lucena Sampaio Calado

2005-12-01

Full Text Available FUNDAMENTOS: Pesquisas atuais buscam avaliar a prevalência de pessoas infectadas pelo M. leprae, bem como o valor preditivo dos testes utilizados, em meio aos quais está a sorologia, que detecta anticorpos contra um antígeno específico da parede do Mycobacterium leprae, o glicolipídio fenólico (PGL-I. OBJETIVOS: Conhecer a taxa de infecção em contatos intra e peridomiciliares, e a relação de soropositividade com sexo, idade e grupo multibacilar/paucibacilar. MATERIAIS E MÉTODOS: Inquérito soroepidemiológico em contatos domiciliares e peridomiciliares dos casos notificados como hanseníase entre 1998 e 2002, no segundo distrito do Município de Duque de Caxias, RJ, utilizando o teste sorológico rápido de fluxo lateral ou ML Flow. RESULTADOS: Em 390 domicílios de casos de hanseníase foram identificados 2.130 contatos, e submetidos à sorologia 1.866 (12,4% de perda. A soropositividade foi de 15,7% (292/1.866, sendo 15,8% no domicílio e 15,6% no peridomicílio. Também não houve diferença na relação entre soropositividade e sexo e em maiores e menores de 15 anos. Observou-se diferença significativa na soropositividade de contatos de casos de hanseníase MB (67,5%, duas vezes maior do que a dos casos de PB (32,5%. DISCUSSÃO / CONCLUSÃO: Nas condições de moradia da periferia urbana de área endêmica devem ser submetidos igualmente à vigilância epidemiológica os contatos domiciliares e peridomiciliares.BACKGROUND: Actually many studies have been made to evaluate the predictive value of tests that identify patients infected by Mycobacterium leprae. Among then, the serology that determinates the presence o M. leprae specific antibody. OBJECTIVES: To know the infections tax among households and direct neighbours contacts, establish soropositivity relationship according to sex, household/ neighbour, age and classification of leprosy of the index case (paucibacillary x multibacillary. PATIENTS AND METHODS: seroepidemiological

Infrequent detection of germline allele-specific expression of TGFBR1 in lymphoblasts and tissues of colon cancer patients.

LENUS (Irish Health Repository)

Guda, Kishore

2009-06-15

Recently, germline allele-specific expression (ASE) of the gene encoding for transforming growth factor-beta type I receptor (TGFBR1) has been proposed to be a major risk factor for cancer predisposition in the colon. Germline ASE results in a lowered expression of one of the TGFBR1 alleles (>1.5-fold), and was shown to occur in approximately 20% of informative familial and sporadic colorectal cancer (CRC) cases. In the present study, using the highly quantitative pyrosequencing technique, we estimated the frequency of ASE in TGFBR1 in a cohort of affected individuals from familial clusters of advanced colon neoplasias (cancers and adenomas with high-grade dysplasia), and also from a cohort of individuals with sporadic CRCs. Cases were considered positive for the presence of ASE if demonstrating an allelic expression ratio <0.67 or >1.5. Using RNA derived from lymphoblastoid cell lines, we find that of 46 informative Caucasian advanced colon neoplasia cases with a family history, only 2 individuals display a modest ASE, with allelic ratios of 1.65 and 1.73, respectively. Given that ASE of TGFBR1, if present, would likely be more pronounced in the colon compared with other tissues, we additionally determined the allele ratios of TGFBR1 in the RNA derived from normal-appearing colonic mucosa of sporadic CRC cases. We, however, found no evidence of ASE in any of 44 informative sporadic cases analyzed. Taken together, we find that germline ASE of TGFBR1, as assayed in lymphoblastoid and colon epithelial cells of colon cancer patients, is a relatively rare event.

Adverse Side Effects of Psychotropic Medication and Challenging Behavior: Pilot Work Assessing Impact.

Science.gov (United States)

Valdovinos, Maria G; Schieber, Elizabeth; McMahon, Meara; Beard, Lisa; Wilkinson, Alyssa; Carpenter, Jaimie

2017-12-01

Psychotropic medications are often prescribed to reduce challenging behavior in individuals with intellectual and developmental disabilities (IDD). Functional analyses (FAs) have demonstrated utility in assessing medication impact on behavior; however, the impact of adverse side effects (ASE) on challenging behavior is under-assessed. The purpose of this study was to develop a methodology, similar to FAs, to explore potential medication ASE impact on challenging behavior in seven individuals with IDD. Results revealed response rate differences in designed ASE conditions for most participants. Outcomes support further development and use of this methodology to assess the presence and impact of ASEs.

On the possibility of laser diagnostics of anisotropically superheated electrons in magnetic fusion systems

International Nuclear Information System (INIS)

Kukushkin, A.B.

1990-01-01

The anisotropically superheated electrons (ASE) are known to be generated by a resonance interaction of high-frequency electromagnetic waves with electron plasma. Under definite conditions the ASE energy may essentially exceed (by the order of magnitude or even more) thermal energies of background electron plasma, the ASE distribution in pitch-angle being concentrated around definite directions. This situation is typical for, e.g. electron cyclotron heating of magnetic mirror plasmas (generation of 'sloshing' electrons) and for current drive in tokamaks by means of lower-hybrid or, sometimes, electron cyclotron waves. In this work, an analysis of the possibility of the ASE laser diagnostics is based on the calculations of Thomson scattering of laser radiation by plasma electrons. The model electron velocity distribution functions, which provide qualitative description of the ASE peculiar features, were used in calculations. (author) 4 refs., 1 fig

Role of Academic Self-efficacy and Social Support on Nursing Students' Test Anxiety.

Science.gov (United States)

Warshawski, Sigalit; Bar-Lev, Oshra; Barnoy, Sivia

2018-05-25

Associations between test anxiety, academic self-efficacy (ASE), and social support through social media have not been fully explored. The purposes were to explore associations between test anxiety, ASE, and social support from social media and to examine differences in test anxiety by students' year of studies and cultural background. This study used a cross-sectional, descriptive design. The sample comprised first- and fourth-year nursing students (n = 240) attending a baccalaureate nursing program in Israel. Higher ASE and support through social media were related to lower test anxiety. Fourth-year students and Jewish students had higher ASE than first-year and Arab students, who received more support on social media than Jewish students. Developing learning strategies designed to increase students' ASE and reduce test anxiety is warranted. Social media as an educational tool can be adopted for this purpose.

Kasus Serial : Aspirasi Peluit pada Anak

Directory of Open Access Journals (Sweden)

Aci Mayang Sari

2015-01-01

Full Text Available AbstrakKasus aspirasi benda asing selalu memberikan tantangan bagi dokter spesialis Telinga Hidung TenggorokKepala dan Leher (THT-KL. Aspirasi benda asing lebih sering terjadi pada anak-anak khususnya pada umur 1-3tahun dan jarang terjadi pada dewasa. Aspirasi peluit pada anak merupakan kasus yang banyak terjadi pada golonganbenda asing anorganik. Untuk menegakkan diagnosis aspirasi benda asing diperlukan ketajaman anamnesis,pemeriksaan fisik dan hasil radiografi. Bronkoskopi merupakan teknik yang digunakan sebagai alat diagnostik danterapeutik pada kasus aspirasi benda asing. Kasus aspirasi peluit pada tiga orang anak (2 laki-laki dan 1 perempuantelah dilaporkan dan ditatalaksana menggunakan teknik bronkoskopi kaku.Kata kunci: Aspirasi benda asing, benda asing peluit, bronkoskopiAbstractForeign body aspiration continues to provide challenges for otorhinolaryngologists. Foreign body aspiration ismore common in children, especially at the age of 1-3 years and rarely occurs in adults. Whistle aspiration in childrenis a case that occurs in many inorganic foreign body type. The diagnosis of foreign body aspiration based ondiscernment anamnesis, physical examination and radiographic results. Bronchoscopy is a technique that is used as adiagnostic and therapeutic tool in cases of foreign body aspiration.Cases of whistle aspiration in 3 children (2 malesand 1 femalewas reported and treated using rigid bronchoscopy technique. Arial 9 italicKeywords: foreign body aspiration, a whistle foreign body, bronchoscopy.

Avaliação do programa de controle da hanseníase em um município hiperendêmico do Estado do Maranhão, Brasil, 1991-1995 Assessment of a leprosy control program in a hyperendemic county in the State of Maranhão, Brazil, 1991-1995

Directory of Open Access Journals (Sweden)

Dorlene Maria Cardoso de Aquino

2003-02-01

Full Text Available Estudo descritivo, objetivando avaliar o programa de controle da hanseníase do Município de Buriticupu, Maranhão. Foram analisados 214 prontuários de pacientes portadores das diversas formas clínicas de hanseníase, atendidos na unidade de saúde da Universidade Federal do Maranhão, localizada no referido município. A população de estudo foi constituída de 110 casos de hanseníase das formas paucibacilares (PB e 104 das formas multibacilares (MB registrados no período de janeiro de 1991 a dezembro de 1995. As informações referentes à forma clínica, número de contatos registrados, examinados e avaliados, grau de incapacidade no início e final do tratamento e situação de registro, foram coletadas num formulário específico. A análise dos resultados foi baseada nos parâmetros dos indicadores operacionais definidos pelo Ministério da Saúde. Houve um discreto predomínio da forma PB da doença. Observou-se baixos percentuais em relação aos pacientes com grau de incapacidade física avaliada no início e final do tratamento, a alta por cura e contatos examinados. O percentual de abandono foi elevado. O programa foi considerado "precário" em todos os indicadores utilizados para o estudo.This is a descriptive study to assess the leprosy control program in the municipality of Buriticupu in Maranhão State, Brazil. The records of 214 patients with different forms of leprosy were studied. Patients were treated at a health center of the Federal University in Maranhão located in the above-mentioned municipality. The study population was comprised of 110 cases with paucibacillary leprosy (PB and 104 with multibacillary leprosy (MB. The patients were registered between January 1991 and December 1995. Data on the form of the disease, number of contacts registered, examined, and assessed, degree of disability at the beginning and end of treatment, and the register's status were collected on a form designed specifically for this

Psoríase eritrodérmica com regressão após profilaxia com isoniazida e terapia antidepressiva: relato de caso Erythrodermic psoriasis with regression after prophylaxis with isoniazid and antidepressant therapy: case report

Directory of Open Access Journals (Sweden)

Isabella Portela Redighieri

2011-08-01

Full Text Available Mulher idosa apresentou psoríase em placas do tipo grave, com tendência eritrodérmica, e foi submetida a tratamento de acordo com o algoritmo consensual (fototerapia, acitretina, ciclosporina. Resultados clínicos insuficientes, recorrência e agravamento do quadro laboratorial orientaram no sentido da introdução de terapia biológica. A avaliação preliminar revelou PPD de 30mm. A resolução completa das lesões se verificou quando realizada profilaxia antituberculose e administrado antidepressivoAn 83 year old woman, exhibiting severe psoriasis, was treated conventionally (phototherapy, acitretin, and cyclosporine. After poor clinical results and significant changes in laboratory procedures, those treatments were suspended. She was then being prepared to be submitted to biological treatment, when preliminary results disclosed a 30mm PPD. Complete improvement occurred [only] after introducing prophylactic therapy for tuberculosis and anti-depressive medication

Mediated, moderated and direct effects of country of residence, age, and gender on the cognitive and social determinants of adolescent smoking in Spain and the UK: a cross-sectional study.

Science.gov (United States)

Markham, Wolfgang A; Lopez, Maria Luisa; Aveyard, Paul; Herrero, Pablo; Bridle, Christopher; Comas, Angel; Charlton, Anne; Thomas, Hywel

2009-06-04

European trans-national adolescent smoking prevention interventions based on social influences approaches have had limited success. The attitudes-social influences-efficacy (ASE) model is a social cognition model that states smoking behaviour is determined by smoking intention which, in turn, is predicted by seven ASE determinants; disadvantages, advantages, social acceptance, social norms, modelling, perceived pressure, self-efficacy. Distal factors such as country of residence, age and gender are external to the model. The ASE model is, thus, closely related to the Theory of Planned Behaviour. This study assessed the utility of the ASE model using cross-sectional data from Spanish and UK adolescents. In 1997, questionnaires were simultaneously administered to Spanish (n = 3716) and UK adolescents (n = 3715) who were considered at high risk of smoking. Participants' age, gender, smoking intentions and ASE determinant scores were identified and linear regression analysis was used to examine the mediated, moderated and direct effects of country of residence, age and gender on participants' smoking intentions. All UK participants were aged 12 or 13 and most Spanish participants were aged between 12 and 14 (range 12-16 years). Amongst 12 and 13 year olds, regular smoking was more common in Spain. Almost half the participants were female (47.2% in Spain; 49.9% in the UK). Gender did not vary significantly according to age. The distribution of ASE determinant scores varied by country and predicted intention. The influence of each ASE determinant on intention was moderated by country. Country had a large direct influence on intention (1.72 points on a 7 point scale) but the effects of age and gender were mediated by the ASE determinants. The findings suggest resisting peer pressure interventions could potentially influence smoking amongst UK adolescents but not Spanish adolescents. Interventions that promote self-efficacy, on the other hand, would possibly have a greater

Mediated, moderated and direct effects of country of residence, age, and gender on the cognitive and social determinants of adolescent smoking in Spain and the UK: a cross-sectional study

Directory of Open Access Journals (Sweden)

Markham Wolfgang A

2009-06-01

Full Text Available Abstract Background European trans-national adolescent smoking prevention interventions based on social influences approaches have had limited success. The attitudes-social influences-efficacy (ASE model is a social cognition model that states smoking behaviour is determined by smoking intention which, in turn, is predicted by seven ASE determinants; disadvantages, advantages, social acceptance, social norms, modelling, perceived pressure, self-efficacy. Distal factors such as country of residence, age and gender are external to the model. The ASE model is, thus, closely related to the Theory of Planned Behaviour. This study assessed the utility of the ASE model using cross-sectional data from Spanish and UK adolescents. Methods In 1997, questionnaires were simultaneously administered to Spanish (n = 3716 and UK adolescents (n = 3715 who were considered at high risk of smoking. Participants' age, gender, smoking intentions and ASE determinant scores were identified and linear regression analysis was used to examine the mediated, moderated and direct effects of country of residence, age and gender on participants' smoking intentions. Results All UK participants were aged 12 or 13 and most Spanish participants were aged between 12 and 14 (range 12–16 years. Amongst 12 and 13 year olds, regular smoking was more common in Spain. Almost half the participants were female (47.2% in Spain; 49.9% in the UK. Gender did not vary significantly according to age. The distribution of ASE determinant scores varied by country and predicted intention. The influence of each ASE determinant on intention was moderated by country. Country had a large direct influence on intention (1.72 points on a 7 point scale but the effects of age and gender were mediated by the ASE determinants. The findings suggest resisting peer pressure interventions could potentially influence smoking amongst UK adolescents but not Spanish adolescents. Interventions that promote self

Theoretical analysis of experimental results on SG-1 FEL

International Nuclear Information System (INIS)

Yang Zhenhua; Wu Shangqing; Tian Shihong; Dong Zhiwei; Wu Yupu

1994-01-01

In order to study the SG-1 FEL and the beam transport thoroughly, and draw certain quantitative conclusions, we developed 3-D WAGFEL code to describe the FEL evolution and 3-D CEBQ code to describe the beam transport. The CEBQ code can simulate the 3-D transport of the electron beam in the modulation section with linear approximation of space charge. According to the first ASE experiments results, the LIA provided a 2 kA, 3.0 MeV beam with a normalized emittance of 0.6 πrad·cm, an energy spread (FWHM) of 4%, resulting in a beam brightness nearly 10 8 A/(πm·rad) 2 . The numerical simulation showed that the quality of the beam was good enough to abandon the 9-m long beam line and substitute it with a 2-m long drifting and focusing region. The second series of ASE and amplifier experiments began in October 1992. The beam transport section was modified. The ASE output power, the amplifier output power and detuning curve was measured. We analysed the experimental results using the WAGFEL and CEBQ codes with parameters equal to those of experiments. Firstly we followed 4096 electrons to simulate the transport process of the beam in the beam line under the condition of I = 2 kA, r b = 1 cm, γ = 6.8, Δγ/γ 4%, ε rms = 0.6 (πrad·cm). Through the simulation, we predicted that the beam current injected into the wiggler was about 611 A. Based on these beam parameters at the entrance of the wiggler, we simulated the FEL process with P in = 300 W. The results are also in Fig.7,8,9

Colombian experience in applying rules concerning agricultural biosecurity

Directory of Open Access Journals (Sweden)

Carlos Silva C.

2001-07-01

Full Text Available Genetic engineering has made possible the creation of Genetic Modified Organisms (GMOs, or transgenic crops. The growth around the world of transgenic crops areas for commercial purposes, such as soybean, maize, canola and cotton is being amazing: from 1.7 million hectares in 1996 to 52.6 million in 2001. Historically, not many technologies have reached, in such a short period of time, such a higher adoption. The use of these technologies, nevertheless their well-known benefits, has brought some worries related with biosafety. In Colombia the Colombian Institute for Agriculture and Cattle (ICA, its Spanish acronym in order to introduce GMOs to the country and prevent or minimize the potential risk for agriculture generated by this kind of organisms, has established two instruments: the Agreement 013/98, creating the National Technical Biosafety Committee (CTN, its Spanish acronym, intersectorial adviser organism; and the Resolution 3492/98, establishing procedures for introduction, production, reléase and marketing of GMOs for agricultural purposes. Under this regulations, ICA has approved five different requests involving eight events with GMOs: carnation for commercial multiplicación purposes; cotton and rice for evaluation genotype in field at a small scale; cassava, brachiaria, stylozantes, coffee and sugar cane for research in genetic improvement throughout genetic engineering techniques in confined handling. Based on the accomplished experience, the future will make improve the legal and institutional instruments, as well as technical and scientific capacity of the country in biosafety.

Prednisolone multicomponent nanoparticle preparation by aerosol solvent extraction system.

Science.gov (United States)

Moribe, Kunikazu; Fukino, Mika; Tozuka, Yuichi; Higashi, Kenjirou; Yamamoto, Keiji

2009-10-01

Prednisolone nanoparticles were prepared in the presence of a hydrophilic polymer and a surfactant by the aerosol solvent extraction system (ASES). A ternary mixture of prednisolone, polyethylene glycol (PEG), and sodium dodecyl sulfate (SDS) dissolved in methanol was sprayed through a nozzle into the reaction vessel filled with supercritical carbon dioxide. After the ASES process was repeated, precipitates of the ternary components were obtained by depressurizing the reaction vessel. When a methanolic solution of prednisolone/PEG 4000/SDS at a weight ratio of 1:6:2 was sprayed under the optimized ASES conditions, the mean particle size of prednisolone obtained after dispersing the precipitates in water was observed to be ca. 230 nm. Prednisolone nanoparticles were not obtained by the binary ASES process for prednisolone, in the presence of either PEG or SDS. Furthermore, ternary cryogenic cogrinding, as well as solvent evaporation, was not effective for the preparation of prednisolone nanoparticles. As the ASES process can be conducted under moderate temperature conditions, the ASES process that was applied to the ternary system appeared to be one of the most promising methods for the preparation of drug nanoparticles using the multicomponent system.

Resonant stimulation of Raman scattering from single-crystal thiophene/phenylene co-oligomers

International Nuclear Information System (INIS)

Yanagi, Hisao; Marutani, Yusuke; Matsuoka, Naoki; Hiramatsu, Toru; Ishizumi, Atsushi; Sasaki, Fumio; Hotta, Shu

2013-01-01

Amplified Raman scattering was observed from single crystals of thiophene/phenylene co-oligomers (TPCOs). Under ns-pulsed excitation, the TPCO crystals exhibited amplified spontaneous emission (ASE) at resonant absorption wavelengths. With increasing excitation wavelength to the 0-0 absorption edge, the stimulated resonant Raman peaks appeared both in the 0-1 and 0-2 ASE band regions. When the excitation wavelength coincided with the 0-1 ASE band energy, the Raman peaks selectively appeared in the 0-2 ASE band. Such unusual enhancement of the 0-2 Raman scattering was ascribed to resonant stimulation via vibronic coupling with electronic transitions in the uniaxially oriented TPCO molecules

Distribution and behaviour of isoselenouronium salts in the body. Pt. 5

International Nuclear Information System (INIS)

Kozak, I.; Dienstbier, Z.

1976-01-01

The acute toxicity of AESe, 2-ASe, and Se-MEG was estimated in mice after i.v., i.p. and s.c. application. In all forms of application, 2-ASe was found to have the lowest toxicity. The study of excretion showed that administered compounds are excreted practically completely within seven days, mostly by urine. The excretion by faeces is very low and by exhalation is under the threshold of demonstrability. The metabolism of 2-ASe is slow, most of it is excreted without any change; AESe is transformed into a mixture of 2-ASe and Se-MEG. Se-MEG is excreted by urine totally metabolized as trimethylselenium ion. (orig.) [de

Amplified spontaneous emission from the exciplex state of a conjugated polymer "PFO" in oleic acid

Science.gov (United States)

Idriss, Hajo; Taha, Kamal K.; Aldaghri, O.; Alhathlool, R.; AlSalhi, M. S.; Ibnaouf, K. H.

2016-09-01

The amplified spontaneous emission (ASE) characteristics of a conjugated polymer poly (9, 9-dioctylfluorenyl-2, 7-diyl) (PFO) in oleic acid have been studied under different concentrations and temperatures. Here, the ASE spectra of PFO in oleic acid have been obtained using a transverse cavity configuration where the conjugated PFO was pumped by laser pulses from the third harmonic of Nd: YAG laser (355 nm). The PFO in oleic acid produces ASE from an exciplex state - a new molecular species. The obtained results were compared with the PFO in benzene. Such ASE spectra from the exciplex state have not been observed for the PFO in benzene.

Evaluation of cellular immune response in patients with recurrent candidiasis

OpenAIRE

Carvalho, Lucas P.; Bacellar, Olívia; Neves, Nilma A.; Carvalho, Edgar M.; Jesus, Amélia R. de

2003-01-01

A candidíase recorrente cutânea ou mucosa é caracterizada pela ocorrência de, no mínimo, 4 episódios de candidíase no período de um ano. Não são conhecidos os fatores que levam à recorrência desta infecção. O presente estudo avaliou a resposta linfoproliferativa e a produção de IFN-g de pacientes com candidíase recorrente. Os índices de estimulação da resposta linfoproliferativa em culturas de células de pacientes com candidíase recorrente estimuladas com antígeno de Candida albicans, PPD e T...

Three nucleon results for one boson exchange potential

International Nuclear Information System (INIS)

Birrell, N.D.; Afnan, I.R.

1977-06-01

The binding energy of 3 H, percentage S-, S'-, and D-state probabilities and charge form factor of 3 He are calculated using the Adhikari-Sloan separable expansion (ASE) to the Holinde and Machleidt one boson exchange potential. The results show that the ASE has good convergence for the binding energy, and the lowest order ASE considered gives excellent results for the form factor. (Author)

Achados neurológicos e laboratoriais em população de área endêmica para teníase-cisticercose, Lagamar, MG, Brasil (1992-1993 Neurologic and laboratory findings in population of endemic area for teniasis-cysticercosis, Lagamar, MG, Brazil (1992-1993

Directory of Open Access Journals (Sweden)

Mario León Silva-Vergara

1994-08-01

Full Text Available Realizou-se um inquérito clínico-epidemiológico em área endêmica para teníase-cisticercose. Foram examinados 1080 (32,2% indivíduos da população total, encontrando-se 198 (18,3% indivíduos referindo antecedente de teníase, e 103 (9,5% apresentaram história anterior ou atual de convulsões. Destes últimos, 39 (37,8% referiram início das crises na vida adulta, e 62 (60% foram avaliados laboratorialmente. Em 21 (33,8% casos, o resultado da tomografia mostrou calcificações intracranianas compatíveis com neurocisticercose, em número e localização variáveis, mas sem evidência de atividade da doença. Traçados eletroencefalográficos anormais foram lidos em 21 (33,8% pacientes e alterações no exame do líquido cefalorraquiano (LCR detectadas em 27 (43,5%, em 3 (4,8% foi verificada presença de eosinófilos. Somente LCR de 26 (41,9% pacientes foram submetidos a pesquisa de anticorpos para cisticerco, obtendo-se positividade em 6 (23% deles, por ensaio imunoenzimático (ELISA ou reação de imunofluorescência indireta. Outras alterações do LCR foram devidas a aumento variável das proteínas. Considerando-se os fatores epidemiológicos de risco para teníase-cisticercose na região estudada e sua correlação com as alterações laboratoriais mencionadas acima com as crises convulsivas, encontra-se uma provável prevalência de 1,9% para a neurocisticercose.A clinic-epidemiological enquiry was conducted on in an endemic area for teniasis-cysticercosis. From the whole population 1080 (32.2% individuals were examined. We found 198 (18.3% individuals refering teniasis-bearing in the past, and 103 (9.5% affirming to have had convulsions, either in the past or present. From the last group, 39 (37.8% indicated that the crisis had begun in adulthood. From the group of patients presenting convulsions, 62 (62% had laboratory tests performed. Computed tomography showed intracranial calcifications in 21 (33.8% patients, variable in

Influenza virus-induced alterations of cytochrome P-450 enzyme activities following exposure of mice to coal and diesel particulates

Energy Technology Data Exchange (ETDEWEB)

Rabovsky, J.; Judy, D.J.; Rodak, D.J.; Petersen, M.

1986-06-01

We have investigated a relationship between two detoxication systems, metabolic detoxication through the cytochrome P-450 (P-450) pathway and resistance to infection through interferon (IFN), in mice infected with influenza virus following exposure to coal dust (CD) and diesel exhaust (DE) particulates. Mice were exposed by inhalation to filtered air (FA; control), CD, or DE for 1 month and then inoculated intranasally (IN) with influenza virus. During infection, 7-ethoxycoumarin deethylase (7ECdeEt'ase) and ethylmorphine demethylase (EMdeMe'ase) (monooxygenases), and NADPH cytochrome c reductase (NADPH c red'ase) were measured in liver microsomes. Temporal patterns of enzyme activities were observed with control animals. EMdeMe'ase and NADPH c red'ase exhibited peak values at Day 4 postinfection (27.6 and 482 nmole/min/mg protein, respectively), compared to initial activities (9.1 and 307 nmole/min/mg protein, respectively). 7ECdeEt'ase activity decreased between Days 1-3 postvirus infection and thereafter returned to the original value (1.7 nmole/min/mg protein). When the mice were first exposed to CD or DE particulates for 1 month prior to influenza infection, changes in enzyme temporal patterns were observed. The increased EMdeMe'ase activity at Day 4 was not observed in mice exposed to CD and was reduced in mice exposed to DE. Preexposure to either particulate resulted in the abolition of the increased Day 4 activity of NADPH c red'ase. The 7ECdeEt'ase postinfection temporal pattern was not affected by a preexposure to either particulate. Estimates of the enzyme activities after the 1-month exposure to FA, CD, or DE but before virus infection indicated no changes due to particulate exposure alone. Under conditions of particulate exposure and virus infection, serum IFN levels peaked at Days 4-5 and were unaffected by the 1-month preexposure to CD or DE.

TU-F-18C-02: Increasing Amorphous Selenium Thickness in Direct Conversion Flat-Panel Imagers for Contrast-Enhanced Dual-Energy Breast Imaging

International Nuclear Information System (INIS)

Scaduto, DA; Hu, Y-H; Zhao, W

2014-01-01

Purpose: Contrast-enhanced (CE) breast imaging using iodinated contrast agents requires imaging with x-ray spectra at energies greater than those used in mammography. Optimizing amorphous selenium (a-Se) flat panel imagers (FPI) for this higher energy range may increase lesion conspicuity. Methods: We compare imaging performance of a conventional FPI with 200 μm a-Se conversion layer to a prototype FPI with 300 μm a-Se layer. Both detectors are evaluated in a Siemens MAMMOMAT Inspiration prototype digital breast tomosynthesis (DBT) system using low-energy (W/Rh 28 kVp) and high-energy (W/Cu 49 kVp) x-ray spectra. Detectability of iodinated lesions in dual-energy images is evaluated using an iodine contrast phantom. Effects of beam obliquity are investigated in projection and reconstructed images using different reconstruction methods. The ideal observer signal-to-noise ratio is used as a figure-of-merit to predict the optimal a-Se thickness for CE lesion detectability without compromising conventional full-field digital mammography (FFDM) and DBT performance. Results: Increasing a-Se thickness from 200 μm to 300 μm preserves imaging performance at typical mammographic energies (e.g. W/Rh 28 kVp), and improves the detective quantum efficiency (DQE) for high energy (W/Cu 49 kVp) by 30%. While the more penetrating high-energy x-ray photons increase geometric blur due to beam obliquity in the FPI with thicker a-Se layer, the effect on lesion detectability in FBP reconstructions is negligible due to the reconstruction filters employed. Ideal observer SNR for CE objects shows improvements in in-plane detectability with increasing a-Se thicknesses, though small lesion detectability begins to degrade in oblique projections for a-Se thickness above 500 μm. Conclusion: Increasing a-Se thickness in direct conversion FPI from 200 μm to 300 μm improves lesion detectability in CE breast imaging with virtually no cost to conventional FFDM and DBT. This work was partially

Safety and efficacy of autologous serum eye drop for treatment of dry eyes in graft-versus-host disease.

Science.gov (United States)

Azari, Amir A; Karadag, Remzi; Kanavi, Mozhgan Rezaei; Nehls, Sarah; Barney, Neal; Kim, Kyungmann; Longo, Walter; Hematti, Peiman; Juckett, Mark

2017-06-01

To evaluate the treatment of autologous serum eye drops (ASED) on dry eyes in patients with graft-versus-host disease (GVHD). A retrospective chart review of 35 patients with a history of ocular GVHD following hematopoietic stem cell transplantation that used ASED to alleviate dry eye symptoms was performed. Patients were categorized into three different groups. If patients had available ophthalmic data before and after starting treatment was group 1 (n = 14), had available ophthalmic data after starting treatment in group 2 (n = 10) and had available ophthalmic data before treatment or did not have any data after starting treatment in group 3 (n = 11). Data were collected on patient's age, gender, primary diagnosis, visual acuity and fluorescein corneal staining were collected on individual eyes in order to evaluate the efficacy of the ASED on alleviating dry eye-related signs and symptoms. No adverse ocular effect from the ASED was found in our series (except one fungal keratitis). All patients reported either improvement (55%) or stability (45%) in their ocular symptoms upon the use of ASED. In patients with available data before and after starting treatment, the corneal staining score improved by a median of 1 (p = 0.003) and the LogMAR visual acuity had a non-significant improvement. In our study, ASED used by patients with ocular GVHD were both safe and effective. ASED should be considered in patients with GVHD who suffer from dry eyes.

Phase transformations in lead zirconate-titanate doped with lanthanum

Energy Technology Data Exchange (ETDEWEB)

Ishchuk, V M; Morozov, E M

1979-07-01

Presented are the results of studies on the character of phase transitions of the lead-lanthanum zirconate-titanate (LLZT) system. The replacement of lead by lanthanum leads to the expansion of the region of antisegnetoelectric (ASE) states of solid solutions of lead zirconate-titanate (LZT) in the direction of PbTiO/sub 3/ concentration growth. An intermediate region is revealed between segnetoelectric (SE) and ASE states, material properties in which depend on their prehistory: annealed samples are in the ASE state, whereas the application of electric field exceeding some critical value induces the SE state. A family of phase diagrams obtained at consequent replacement of lead by lanthanum permits to identify phase states in any series of LLZT with a constant ratio of Zr:Ti, in the x/65/35 series in particular. Thermally depolarized state of materials of this series at x<6.5 is shown to be antisegnetoelectric at all the temperatures below the Curie point Tsub(c), and heating causes phase transition of ASE..-->..PE (paraelectric state) at Tsub(c). Polarized samples being heated, a successiveness of phase transitions of SE..-->..ASE takes place at T/sub 0/, and that of ASE reversible PE at Tsub(C) (Tsub(0)..ASE phase transition in the LZT system.

Perfil epidemiológico da hanseníase no município de Teresina, no período de 2001-2008 Epidemiologic profile of the leprosy of the city of Teresina, in the period of 2001-2008

Directory of Open Access Journals (Sweden)

Elizane Viana Eduardo Pereira

2011-04-01

Full Text Available FUNDAMENTOS: A hanseníase é uma doença infectocontagiosa que pode levar a incapacidade física e funcional. É um importante problema de saúde pública em algumas regiões, sendo necessário o conhecimento das variações epidemiológicas para subsidiar estratégias de controle da doença. OBJETIVO: Descrever o perfil epidemiológico do município de Teresina de 2001-2008. MÉTODO: Foram avaliados dados de hanseníase de Teresina entre 2001-2008, presentes no banco de dados oficial do Sistema de Informação de Agravos de Notificação, da Fundação Municipal de Saúde. RESULTADOS: Os dados revelam um coeficiente de detecção de casos novos com média de 96,21 casos por 100.000 hab. Entre os menores que 15 anos, houve um pico de 40 casos em 100.000 hab. em 2003. O grau de incapacidade II avaliado no momento do diagnóstico variou de 5%-7% e no momento da alta de 2,77%- 0,14%. A prevalência é alta, variando entre 8-11 casos em 10.000 hab. Em relação à forma clínica no final da série há uma predominância das formas I com 30% dos casos e D com 28% dos casos. Quanto à classificação operacional a média é de 62% de casos paucibacilares e 37,86% multibacilares. Entre os casos registrados há uma discreta predominância no sexo feminino no final da série. CONCLUSÃO: A hanseníase é hiperendêmica em Teresina e pode levar à inatividade pessoas em idade produtiva.BACKGROUND: Leprosy is an infectious disease that can lead to functional and physical disability. It is a major public health problem in some regions, requiring knowledge of its epidemiological variations so that strategies for disease control can be subsidized. OBJECTIVE: To describe the epidemiological profile of the city of Teresina from 2001 to 2008. METHODS: Data on leprosy in the city of Teresina from 2001 to 2008, which were present on the official database of the Information System for Notifiable Diseases of the City Health Foundation, were analyzed. RESULTS: The

Moderating role of firms’ rank in ASEAN corporate governance scorecard on effect of foreign ownership on firm value

Directory of Open Access Journals (Sweden)

Dormauli Justina

2017-09-01

Full Text Available Penelitian ini bertujuan untuk menguji peringkat perusahaan berdasarkan ASEAN corporate governance scorecard, sebagai variabel pemoderasi, atas pengaruh kepemilikan asing terhadap nilai perusahaan di ASEAN. Sample penelitian terdiri dari 491 perusahaan manufaktur yang terdaftar di pasar modal Thailand, Singapore, Philippines, Indonesia, and Malaysia tahun 2012-2013. Dengan analisis white-regression, penelitian ini menemukan bahwa peringkat 50 tertinggi ASEAN corporate governance scorecard memoderasi pengaruh kepemilikan asing terhadap nilai perusahaan. Skor tinggi ASEAN corporate governance scorecard; sebagai peningkatan hak pemegang saham, kesetaran pemegang saham, peran pemangku kepentingan, pengungkapan dan transparansi, serta tanggung jawab dewan; meningkatkan peran pemegang saham asing dalam meningkatkan nilai perusahaan. Manajemen dapat membuat kebijakan mengenai kepemilikan asing juga corporate governance yang optimal, sehingga manajemen dapat meningkatkan kesejahteraan pemegang saham melalui peningkatan nilai perusahaan. Investor yang tertarik berinvestasi di luar negeri, khususnya di ASEAN, harus memperhatikan kondisi corporate governance perusahaan, sehingga kesejahteraan investor dapat meningkat. Kata Kunci: ASEAN corporate governance scorecard, kepemilikan asing, nilai perusahaan.

Managing knee osteoarthritis with yoga or aerobic/strengthening exercise programs in older adults: a pilot randomized controlled trial.

Science.gov (United States)

Cheung, Corjena; Wyman, Jean F; Bronas, Ulf; McCarthy, Teresa; Rudser, Kyle; Mathiason, Michelle A

2017-03-01

Although exercise is often recommended for managing osteoarthritis (OA), limited evidence-based exercise options are available for older adults with OA. This study compared the effects of Hatha yoga (HY) and aerobic/strengthening exercises (ASE) on knee OA. Randomized controlled trial with three arms design was used: HY, ASE, and education control. Both HY and ASE groups involved 8 weekly 45-min group classes with 2-4 days/week home practice sessions. Control group received OA education brochures and weekly phone calls from study staff. Standardized instruments were used to measure OA symptoms, physical function, mood, spiritual health, fear of falling, and quality of life at baseline, 4 and 8 weeks. HY/ASE adherences were assessed weekly using class attendance records and home practice video recordings. Primary analysis of the difference in the change from baseline was based on intent-to-treat and adjusted for baseline values. Eight-three adults with symptomatic knee OA completed the study (84% female; mean age 71.6 ± 8.0 years; mean BMI 29.0 ± 7.0 kg/m 2 ). Retention rate was 82%. Compared to the ASE group at 8 weeks, participants in the HY group had a significant improvement from baseline in perception of OA symptoms (-9.6 [95% CI -15.3, -4]; p = .001), anxiety (-1.4 [95% CI -2.7, -0]; p = .04), and fear of falling (-4.6 [-7.5, -1.7]; p = .002). There were no differences in class/home practice adherence between HY and ASE. Three non-serious adverse events were reported from the ASE group. Both HY and ASE improved symptoms and function but HY may have superior benefits for older adults with knee OA. Trial registration The full trial protocol is available at clinicaltrials.gov (NCT02525341).

Greedy Sampling and Incremental Surrogate Model-Based Tailoring of Aeroservoelastic Model Database for Flexible Aircraft

Science.gov (United States)

Wang, Yi; Pant, Kapil; Brenner, Martin J.; Ouellette, Jeffrey A.

2018-01-01

This paper presents a data analysis and modeling framework to tailor and develop linear parameter-varying (LPV) aeroservoelastic (ASE) model database for flexible aircrafts in broad 2D flight parameter space. The Kriging surrogate model is constructed using ASE models at a fraction of grid points within the original model database, and then the ASE model at any flight condition can be obtained simply through surrogate model interpolation. The greedy sampling algorithm is developed to select the next sample point that carries the worst relative error between the surrogate model prediction and the benchmark model in the frequency domain among all input-output channels. The process is iterated to incrementally improve surrogate model accuracy till a pre-determined tolerance or iteration budget is met. The methodology is applied to the ASE model database of a flexible aircraft currently being tested at NASA/AFRC for flutter suppression and gust load alleviation. Our studies indicate that the proposed method can reduce the number of models in the original database by 67%. Even so the ASE models obtained through Kriging interpolation match the model in the original database constructed directly from the physics-based tool with the worst relative error far below 1%. The interpolated ASE model exhibits continuously-varying gains along a set of prescribed flight conditions. More importantly, the selected grid points are distributed non-uniformly in the parameter space, a) capturing the distinctly different dynamic behavior and its dependence on flight parameters, and b) reiterating the need and utility for adaptive space sampling techniques for ASE model database compaction. The present framework is directly extendible to high-dimensional flight parameter space, and can be used to guide the ASE model development, model order reduction, robust control synthesis and novel vehicle design of flexible aircraft.

Psoríase pustulosa da gestação (impetigo herpetiforme: relato de dois casos e revisão da literatura Pustular psoriasis of pregnancy (impetigo herpetiformis: a report of two cases and review of the literature

Directory of Open Access Journals (Sweden)

Luna Azulay-Abulafia

2004-03-01

Full Text Available Psoríase pustulosa da gravidez é dermatose pustular rara com erupções que se desenvolvem como pústulas estéreis agrupadas na periferia de placas eritematosas da pele. Os sintomas sistêmicos incluem febre alta, astenia, diarréia, delírio, desidratação, tetania e convulsões. O tratamento com corticosteróide sistêmico, antibiótico, reposição de fluidos e eletrólitos é imperativo. Neste relato, são apresentadas duas primigrávidas com 23 e 28 anos que apresentam psoríase pustulosa da gravidez na 24ª e 28ª semana da gestação. Elas foram tratadas e, na primeira paciente, um feto feminino saudável de 2.500 gramas nasceu de parto vaginal, após indução do trabalho de parto na 35ª semana de gestação; na segunda paciente, na 37ª semana de gestação, após se notarem sangramento vaginal moderado e ausência da percepção dos movimentos fetais por 12 horas, um natimorto do sexo feminino, 2.700 gramas, nasceu por indução do parto com prostaglandina.Pustular psoriasis of pregnancy is a rare pustular dermatosis with eruptions that develop in groups of sterile pustules at the periphery of erythematous patches of the skin. Systemic symptoms include high fever, malaise, diarrhea, delirium, dehydration, tetany, and convulsions. Therapy with systemic corticosteroids, antibiotics, replacement of fluid and electrolytes is mandatory. In this report, we present the cases of two primigravidas, 23 and 28 years old, who presented pustular psoriasis of pregnancy at the 24th and 28th week of gestation. They were treated and, in the first case, a healthy 2,500-g female fetus was born vaginally, after labor induction with oxytocin at the 35th week of gestation; in the second patient, at the 37th week of gestation, after a moderate vaginal bleeding and no perception of fetal movements for 12 hours, a stillborn 2,700-g female was born after labor induction with prostaglandin.

Your Lung Operation: After Your Operation

Medline Plus

Full Text Available ... Patient Safety Resources About the Patient Education Program The Recovery Room ... ACS/ASE Medical Student Core Curriculum ACS/ASE Medical Student Simulation-Based Surgical ...

Ostomy Home Skills Program

Medline Plus

Full Text Available ... Patient Safety Resources About the Patient Education Program The Recovery Room ... ACS/ASE Medical Student Core Curriculum ACS/ASE Medical Student Simulation-Based Surgical ...

The effects of multiple features of alternatively spliced exons on the KA/KS ratio test

Directory of Open Access Journals (Sweden)

Chen Feng-Chi

2006-05-01

Full Text Available Abstract Background The evolution of alternatively spliced exons (ASEs is of primary interest because these exons are suggested to be a major source of functional diversity of proteins. Many exon features have been suggested to affect the evolution of ASEs. However, previous studies have relied on the KA/KS ratio test without taking into consideration information sufficiency (i.e., exon length > 75 bp, cross-species divergence > 5% of the studied exons, leading to potentially biased interpretations. Furthermore, which exon feature dominates the results of the KA/KS ratio test and whether multiple exon features have additive effects have remained unexplored. Results In this study, we collect two different datasets for analysis – the ASE dataset (which includes lineage-specific ASEs and conserved ASEs and the ACE dataset (which includes only conserved ASEs. We first show that information sufficiency can significantly affect the interpretation of relationship between exons features and the KA/KS ratio test results. After discarding exons with insufficient information, we use a Boolean method to analyze the relationship between test results and four exon features (namely length, protein domain overlapping, inclusion level, and exonic splicing enhancer (ESE frequency for the ASE dataset. We demonstrate that length and protein domain overlapping are dominant factors, and they have similar impacts on test results of ASEs. In addition, despite the weak impacts of inclusion level and ESE motif frequency when considered individually, combination of these two factors still have minor additive effects on test results. However, the ACE dataset shows a slightly different result in that inclusion level has a marginally significant effect on test results. Lineage-specific ASEs may have contributed to the difference. Overall, in both ASEs and ACEs, protein domain overlapping is the most dominant exon feature while ESE frequency is the weakest one in affecting

Your Lung Operation: After Your Operation

Medline Plus

Full Text Available ... ACS/ASE Medical Student Core Curriculum ACS/ASE Medical Student Simulation-Based Surgical Skills Curriculum Cancer Education Cancer Education Cancer Education Cancer Programs Conference: Learn. ...

Ostomy Home Skills Program

Medline Plus

Full Text Available ... ACS/ASE Medical Student Core Curriculum ACS/ASE Medical Student Simulation-Based Surgical Skills Curriculum Cancer Education Cancer Education Cancer Education Cancer Programs Conference: Learn. ...

Perspectives for utilization of the experience from the electrical equipment modernization of Kozloduy NPP units 5 and 6 in case of construction of new NPP

International Nuclear Information System (INIS)

Bogdanov, D.

2005-01-01

In 2005 a governmental decision for continue the project for construction of Belene NPP was adopted. In case of start of this significant project in short terms, a good option will be to utilize the already achieved experience by the modernization program of units 5 and 6 of Kozloduy NPP. The process of construction of new NPP is associated with significant amount of engineering, civil construction works, equipment order and delivery, installation works, testing and commissioning activities. It is vital necessity to have optimal technology, strict organization for project implementation and excellent documentation. From technical point of view the experience from the modernization of units 5 and 6 of Kozloduy NPP will be very important in case of utilization of similar types of WWER 1000 units. According to the 'Feasibility study for construction of Belene NPP', the most favorable option is to accomplish the already partially constructed Unit 1 on the basis of upgraded WWER B-320 design - WWER 1000 B-392, in order to fulfill IEC 331-3A, IEC 332-3A, and of US NRC Regulatory Guide 1.70 and to construct the second unit on the basis of ASE WWER/1000 B-466. However, for any type of unit selected, the achieved experience will be an important basis. This article is focused mostly on the modernization aspects of some electrical systems of Kozloduy NPP

Influenza virus-induced alterations of cytochrome P-450 enzyme activities following exposure of mice to coal and diesel particulates.

Science.gov (United States)

Rabovsky, J; Judy, D J; Rodak, D J; Petersen, M

1986-06-01

We have investigated a relationship between two detoxication systems, metabolic detoxication through the cytochrome P-450 (P-450) pathway and resistance to infection through interferon (IFN), in mice infected with influenza virus following exposure to coal dust (CD) and diesel exhaust (DE) particulates. Mice were exposed by inhalation to filtered air (FA; control), CD, or DE for 1 month and then inoculated intranasally (IN) with influenza virus. During infection, 7-ethoxycoumarin deethylase (7ECdeEt'ase) and ethylmorphine demethylase (EMdeMe'ase) (monooxygenases), and NADPH cytochrome c reductase (NADPH c red'ase) were measured in liver microsomes. Temporal patterns of enzyme activities were observed with control animals. EMdeMe'ase and NADPH c red'ase exhibited peak values at Day 4 postinfection (27.6 and 482 nmole/min/mg protein, respectively), compared to initial activities (9.1 and 307 nmole/min/mg protein, respectively). 7ECdeEt'ase activity decreased between Days 1-3 postvirus infection and thereafter returned to the original value (1.7 nmole/min/mg protein). When the mice were first exposed to CD or DE particulates for 1 month prior to influenza infection, changes in enzyme temporal patterns were observed. The increased EMdeMe'ase activity at Day 4 was not observed in mice exposed to CD and was reduced in mice exposed to DE. Preexposure to either particulate resulted in the abolition of the increased Day 4 activity of NADPH c red'ase. The 7ECdeEt'ase postinfection temporal pattern was not affected by a preexposure to either particulate. Estimates of the enzyme activities after the 1-month exposure to FA, CD, or DE but before virus infection indicated no changes due to particulate exposure alone. Under these conditions of particulate exposure and virus infection, serum IFN levels in the mice used in this study peaked at Days 4-5 and were unaffected by the 1-month preexposure to CD or DE (Hahon et al., (1985). The data suggest the relationship that exists

Concrete characterization for the 300 Area Solvent Evaporator Closure Site

International Nuclear Information System (INIS)

Prignano, A.L.

1995-01-01

This report summarizes the sampling activities undertaken and the analytical results obtained in a concrete sampling and analyses study performed for the 300 Area Solvent Evaporator (300 ASE) closure site. The 300 ASE is identified as a Resource Conservation and Recovery Act (RCRA) treatment, storage, or disposal (TSD) unit that will be closed in accordance with the applicable laws and regulations. No constituents of concern were found in concentrations indicating contamination of the concrete by 300 ASE operations

Amplified spontaneous emission spectrum and gain characteristic of a two-electrode semiconductor optical amplifier

International Nuclear Information System (INIS)

Wang Hanchao; Huang Lirong; Shi Zhongwei

2011-01-01

A two-electrode multi-quantum-well semiconductor optical amplifier is designed and fabricated. The amplified spontaneous emission (ASE) spectrum and gain were measured and analyzed. It is shown that the ASE spectrum and gain characteristic are greatly influencedby the distribution of the injection current density. By changing the injection current density of two electrodes, the full width at half maximum, peak wavelength, peak power of the ASE spectrum and the gain characteristic can be easily controlled. (semiconductor devices)

Theoretical study of amplified spontaneous emission intensity and bandwidth reduction in polymer

International Nuclear Information System (INIS)

Hariri, A.; Sarikhani, S.

2015-01-01

Amplified spontaneous emission (ASE), including intensity and bandwidth, in a typical example of BuEH-PPV is calculated. For this purpose, the intensity rate equation is used to explain the reported experimental measurements of a BuEH-PPV sample pumped at different pump intensities from I p = 0.61 MW/cm 2 to 5.2 MW/cm 2 . Both homogeneously and inhomogeneously broadened transition lines along with a model based on the geometrically dependent gain coefficient (GDGC) are examined and it is confirmed that for the reported measurements the homogeneously broadened line is responsible for the light–matter interaction. The calculation explains the frequency spectrum of the ASE output intensity extracted from the sample at different pump intensities, unsaturated and saturated gain coefficients, and ASE bandwidth reduction along the propagation direction. Both analytical and numerical calculations for verifying the GDGC model are presented in this paper. Although the introduced model has shown its potential for explaining the ASE behavior in a specific sample it can be universally used for the ASE study in different active media. (paper)

Spatial variation in carrier dynamics along a single CdSSe nanowire

International Nuclear Information System (INIS)

Blake, Jolie C.; Eldridge, Peter S.; Gundlach, Lars

2014-01-01

Highlights: • Femtosecond Kerr-gate microscopy allows ultrafast fluorescence measurements along different positions of a single nanowire. • Amplified spontaneous emission observed at high fluences can be used to calculate recombination rates. • Observation of ASE at different locations along a single CdSSe nanowire provides the ability to extract defect densities. - Abstract: Ultrafast charge carrier dynamics along individual CdS x Se 1−x nanowires has been measured. The use of an improved ultrafast Kerr-gated microscope allows for spatially resolved luminescence measurements along a single nanowire. Amplified spontaneous emission (ASE) was observed at high excitation fluences. Position dependent variations of ultrafast ASE dynamics were observed. SEM and colorimetric measurements showed that the difference in dynamics can be attributed to variations in non-radiative recombination rates along the wire. The dominant Shockley-Read recombination rate can be extracted from ASE dynamics and can be directly related to charge carrier mobility and defect density. Employing ASE as a probe for defect densities provides a new sub-micron spatially resolved, contactless method for measurements of charge carrier mobility

Nitrogenase and nitrate reductase activities in young Alnus glutinosa, relationship and effect of light-dark treatments

International Nuclear Information System (INIS)

Benamar, S.; Thiery, G.; Pizelle, G.

1995-01-01

Relations between in vivo nitrogenase (N-2-ase; EC 1.18.6.1) and nitrate reductase (NR; EC 1.6.6.1) activities were studied in young nodulated Alnus glutinosa (L. ) Gaertn. Positive correlations linked N-2-ase activity, constitutive (non-inducible by nitrate) leaf NR activity and plant growth. Light/dark treatments applied to the whole shoot or, separately, to the upper and lower part of shoot led to the finding that(a) the constitutive leaf NR activity depended on direct illumination of the leaf and did not appear subordinate to the N-2-ase activity; (b) the N-2-ase activity was much more efficiently supported by the illumination of the upper (young) leaves than by that of the lower (mature) leaves; (c) the maintenance of nitrate-inducible root NR activity required leaf illumination. The variations of both N-2-ase and root NR activities in response to light/dark treatments emphasize the importance of the photosynthesis for the reduction of dinitrogen and nitrate in nodulated roots of Alnus glutinosa

Multi-format all-optical processing based on a large-scale, hybridly integrated photonic circuit.

Science.gov (United States)

Bougioukos, M; Kouloumentas, Ch; Spyropoulou, M; Giannoulis, G; Kalavrouziotis, D; Maziotis, A; Bakopoulos, P; Harmon, R; Rogers, D; Harrison, J; Poustie, A; Maxwell, G; Avramopoulos, H

2011-06-06

We investigate through numerical studies and experiments the performance of a large scale, silica-on-silicon photonic integrated circuit for multi-format regeneration and wavelength-conversion. The circuit encompasses a monolithically integrated array of four SOAs inside two parallel Mach-Zehnder structures, four delay interferometers and a large number of silica waveguides and couplers. Exploiting phase-incoherent techniques, the circuit is capable of processing OOK signals at variable bit rates, DPSK signals at 22 or 44 Gb/s and DQPSK signals at 44 Gbaud. Simulation studies reveal the wavelength-conversion potential of the circuit with enhanced regenerative capabilities for OOK and DPSK modulation formats and acceptable quality degradation for DQPSK format. Regeneration of 22 Gb/s OOK signals with amplified spontaneous emission (ASE) noise and DPSK data signals degraded with amplitude, phase and ASE noise is experimentally validated demonstrating a power penalty improvement up to 1.5 dB.

Parametric amplification and cascaded-nonlinearity processes in common atomic system.

Science.gov (United States)

Zheng, Huaibin; Zhang, Xun; Zhang, Zhaoyang; Tian, Yaling; Chen, Haixia; Li, Changbiao; Zhang, Yanpeng

2013-01-01

For the first time, we study the parametric amplification process of multi-wave mixing (PA-MWM) signal and cascaded-nonlinearity process (CNP) in sodium vapors both theoretically and experimentally, based on a conventional phase-conjugate MWM and a self-diffraction four-wave mixing (SD-FWM) processes, which are pumped by laser or amplified spontaneous emission (ASE), respectively. For laser pumping case, SD-FWM process serves as a quantum linear amplifier (a CNP) out (inside) of the resonant absorption region. While for ASE case, only the CNP occurs and the output linewidth is much narrower than that of the MWM signal due to the second selected effect of its electromagnetically induced transparency window. In addition, the phase-sensitive amplifying process seeded by two MWM processes is discussed for the first time. Theoretical fittings agree well with the experiment. The investigations have important potential applications in quantum communication.

Influence of extraction methodologies on the analysis of five major volatile aromatic compounds of citronella grass (Cymbopogon nardus) and lemongrass (Cymbopogon citratus) grown in Thailand.

Science.gov (United States)

Chanthai, Saksit; Prachakoll, Sujitra; Ruangviriyachai, Chalerm; Luthria, Devanand L

2012-01-01

This paper deals with the systematic comparison of extraction of major volatile aromatic compounds (VACs) of citronella grass and lemongrass by classical microhydrodistillation (MHD), as well as modern accelerated solvent extraction (ASE). Sixteen VACs were identified by GC/MS. GC-flame ionization detection was used for the quantification of five VACs (citronellal, citronellol, geraniol, citral, and eugenol) to compare the extraction efficiency of the two different methods. Linear range, LOD, and LOQ were calculated for the five VACs. Intraday and interday precisions for the analysis of VACs were determined for each sample. The extraction recovery, as calculated by a spiking experiment with known standards of VACs, by ASE and MHD ranged from 64.9 to 91.2% and 74.3 to 95.2%, respectively. The extraction efficiency of the VACs was compared for three solvents of varying polarities (hexane, dichloromethane, and methanol), seven different temperatures (ranging from 40 to 160 degrees C, with a gradual increment of 20 degrees C), five time periods (from 1 to 10 min), and three cycles (1, 2, and 3 repeated extractions). Optimum extraction yields of VACs were obtained when extractions were carried out for 7 min with dichloromethane and two extraction cycles at 120 degrees C. The results showed that the ASE technique is more efficient than MHD, as it results in improved yields and significant reduction in extraction time with automated extraction capabilities.

High-pressure behavior of amorphous selenium from ultrasonic measurements and Raman spectroscopy

Energy Technology Data Exchange (ETDEWEB)

He, Z.; Liu, X. R.; Hong, S. M., E-mail: hpswjtu@gmail.com, E-mail: smhong@home.swjtu.edu.cn [Laboratory of High Pressure Physics, Southwest Jiaotong University, Key Laboratory of Advanced Technologies of Materials, Ministry of Education of China, Chengdu 610031 (China); Wang, Z. G. [National Key Laboratory for Shock Wave and Detonation Physics Research, Institute of Fluid Physics, Chinese Academy of Engineering Physics, Mianyang 621900 (China); Zhu, H. Y. [State Key Laboratory of Superhard Materials, Jilin University, Changchun 130012 (China); Peng, J. P. [School of Physical Science and Technology, Southwest Jiaotong University, Chengdu 610031 (China)

2014-07-07

The high-pressure behavior of melt-quenched amorphous selenium (a-Se) has been investigated via ultrasonic measurements and Raman scattering at room temperature. The ultrasonic measurements were conducted on a-Se in a multi-anvil apparatus with two different sample assemblies at pressures of up to 4.5 and 4.8 GPa. We discovered that similar kinks occur in the slopes of the pressure dependence characteristics of the travel time and the sound velocity in both shear and longitudinal waves in the 2.0–2.5 GPa range. These kinks are independent of the sample assemblies, indicating an intrinsic transformation of the a-Se. Additionally, we deduced the pressure-volume relationship of a-Se from the sound velocity characteristics using the Birch–Murnaghan equation of state, and the results agreed well with those of previous reports. In situ high-pressure Raman scattering measurements of a-Se were conducted in a diamond anvil cell with an 830 nm excitation line up to a pressure of 4.3 GPa. We found that the characteristic band of a-Se at ∼250 cm{sup −1} experienced a smooth shift to a lower frequency with pressure, but a sharp slope change in the band intensity versus pressure occurred near 2.5 GPa. The results of X-ray diffraction and differential scanning calorimetry measurements indicate that the samples remain in their amorphous states after decompression. Thus, we proposed that the abnormal compression behavior of a-Se in the 2.0–2.5 GPa range can be attributed to pressure-induced local atomic reconfiguration, implying an amorphous-amorphous transition of the elementary selenium.

Application of a simplified definition of diastolic function in severe sepsis and septic shock.

Science.gov (United States)

Lanspa, Michael J; Gutsche, Andrea R; Wilson, Emily L; Olsen, Troy D; Hirshberg, Eliotte L; Knox, Daniel B; Brown, Samuel M; Grissom, Colin K

2016-08-04

Left ventricular diastolic dysfunction is common in patients with severe sepsis or septic shock, but the best approach to categorization is unknown. We assessed the association of common measures of diastolic function with clinical outcomes and tested the utility of a simplified definition of diastolic dysfunction against the American Society of Echocardiography (ASE) 2009 definition. In this prospective observational study, patients with severe sepsis or septic shock underwent transthoracic echocardiography within 24 h of onset of sepsis (median 4.3 h). We measured echocardiographic parameters of diastolic function and used random forest analysis to assess their association with clinical outcomes (28-day mortality and ICU-free days to day 28) and thereby suggest a simplified definition. We then compared patients categorized by the ASE 2009 definition and our simplified definition. We studied 167 patients. The ASE 2009 definition categorized only 35 % of patients. Random forest analysis demonstrated that the left atrial volume index and deceleration time, central to the ASE 2009 definition, were not associated with clinical outcomes. Our simplified definition used only e' and E/e', omitting the other measurements. The simplified definition categorized 87 % of patients. Patients categorized by either ASE 2009 or our novel definition had similar clinical outcomes. In both definitions, worsened diastolic function was associated with increased prevalence of ischemic heart disease, diabetes, and hypertension. A novel, simplified definition of diastolic dysfunction categorized more patients with sepsis than ASE 2009 definition. Patients categorized according to the simplified definition did not differ from patients categorized according to the ASE 2009 definition in respect to clinical outcome or comorbidities.

Quantitative comparison using Generalized Relative Object Detectability (G-ROD) metrics of an amorphous selenium detector with high resolution Microangiographic Fluoroscopes (MAF) and standard flat panel detectors (FPD).

Science.gov (United States)

Russ, M; Shankar, A; Jain, A; Setlur Nagesh, S V; Ionita, C N; Scott, C; Karim, K S; Bednarek, D R; Rudin, S

2016-02-27

A novel amorphous selenium (a-Se) direct detector with CMOS readout has been designed, and relative detector performance investigated. The detector features include a 25 μ m pixel pitch, and 1000 μ m thick a-Se layer operating at 10V/ μ m bias field. A simulated detector DQE was determined, and used in comparative calculations of the Relative Object Detectability (ROD) family of prewhitening matched-filter (PWMF) observer and non-prewhitening matched filter (NPWMF) observer model metrics to gauge a-Se detector performance against existing high resolution micro-angiographic fluoroscopic (MAF) detectors and a standard flat panel detector (FPD). The PWMF-ROD or ROD metric compares two x-ray imaging detectors in their relative abilities in imaging a given object by taking the integral over spatial frequencies of the Fourier transform of the detector DQE weighted by an object function, divided by the comparable integral for a different detector. The generalized-ROD (G-ROD) metric incorporates clinically relevant parameters (focal-spot size, magnification, and scatter) to show the degradation in imaging performance for detectors that are part of an imaging chain. Preliminary ROD calculations using simulated spheres as the object predicted superior imaging performance by the a-Se detector as compared to existing detectors. New PWMF-G-ROD and NPWMF-G-ROD results still indicate better performance by the a-Se detector in an imaging chain over all sphere sizes for various focal spot sizes and magnifications, although a-Se performance advantages were degraded by focal spot blurring. Nevertheless, the a-Se technology has great potential to provide breakthrough abilities such as visualization of fine details including of neuro-vascular perforator vessels and of small vascular devices.

Distribution and behaviour of isoselenouronium salts in the body. Pt. 6

International Nuclear Information System (INIS)

Kozak, I.; Dienstbier, Z.

1976-01-01

The protective effect of AESe, 2-ASe, and Se-MEG during irradiation with a dose rate of 500 R/min was followed. The protective effect of 2-ASe is substantially lower during the dose rate of 20 R/min and even during an increased dose. AESe and Se-MEG are noneffective. The time of duration of the protective effect of 2-ASe corresponds to the period of its high concentration in the organism after the administration, i.e. ca. 45 min. (orig.) [de

Avanços e desafios da enfermagem na produção científica sobre psoríase Avances y desafíos de la enfermería en la producción científica acerca de psoriasis Advances and challenges of nursing in the scientific production on psoriasis

Directory of Open Access Journals (Sweden)

Cristina Silva Arruda

2011-02-01

Full Text Available A Psoríase, doença crônica de causa ainda incerta, atinge 1 a 3% da população mundial e gera grande impacto psicológico e modificações na qualidade de vida, constituindo desafiadora realidade. Objetivou-se analisar a produção científica de enfermagem sobre Psoríase, entre 1997/2008, examinando-se abordagens e contribuições para o cuidado. Estudo bibliográfico em base virtual de dados Medline, utilizando-se os termos "Psoríase" e "Enfermagem". Dos 21 artigos selecionados, 19% enfocam a fisiopatologia e diagnóstico diferencial, 48% tratamento, 28% aspectos psicológicos e 42% cuidados de enfermagem. O resgate desse saber científico reforça o desafio de maximização da produção acerca da temática, trazendo contribuições para avanços mais expressivos que visem uma intervenção mais holística e de maior qualidade junto a essa clientelaLa Psoriasis, enfermedad crónica de causa incierta aflige 1 a 3% de la población mundial, produce varios efectos psicológicos y los cambios en la calidad de vida, una realidad desafiante. El objetivo es analizar la producción científica de la enfermería en la Psoriasis en 1997/2008, los enfoques y las contribuciones a la atención. Estudio bibliográfico por base de datos virtual Medline con los termos "Psoriasis" e "Enfermería". De los 21 artículos seleccionados, 19% se centran en la fisiopatología y el diagnóstico diferencial, 48% tratamiento, 28% psicológica y 42% atención de enfermería. El rescate del conocimiento científico aumenta el desafío de maximizar esta producción científica, ofreciendo importantes contribuciones a los avances del conocimiento para una intervención más global y de mayor calidad con esta clientelaThe Psoriasis, chronic disease with uncertain cause, affects 1 to 3% of world population, produces great psychological impact and changes in quality of life, a challenging reality. The objective is to analyze the scientific production of nursing on

Avanços e desafios da enfermagem na produção científica sobre psoríase Avances y desafíos de la enfermería en la producción científica acerca de psoriasis Advances and challenges of nursing in the scientific production on psoriasis

Directory of Open Access Journals (Sweden)

Cristina Silva Arruda

2010-04-01

Full Text Available A psoríase, doença crônica de causa ainda incerta, atinge 1 a 3% da população mundial e gera grande impacto psicológico e modificações na qualidade de vida, constituindo desafiadora realidade. Objetiva-se analisar a produção científica de enfermagem sobre psoríase, examinando-se abordagens e contribuições para o cuidado. Estudo bibliográfico em base virtual de dados Medline, utilizando-se os termos psoríase e enfermagem. Dos 21 artigos selecionados, entre 1997/2008, 19% enfocam a fisiopatologia e diagnóstico diferencial, 48% tratamento, 28% aspectos psicológicos e 42% cuidados de enfermagem. O resgate desse saber científico reforça o desafio de maximização da produção acerca da temática, trazendo contribuições para avanços mais expressivos que visem uma intervenção mais holística e de maior qualidade junto a essa clientela.La psoriasis, enfermedad crónica de causa incierta aflige 1 a 3% de la población mundial, produce varios efectos psicológicos y los cambios en la calidad de vida, una realidad desafiante. El objetivo es analizar la producción científica de la enfermería en la psoriasis los enfoques y las contribuciones a la atención. Estudio bibliográfico por base de datos virtual Medline con los termos psoriasis e enfermería. De los 21 artículos seleccionados en 1997/2008, el 19% se centran en la fisiopatología y el diagnóstico diferencial, 48% tratamiento, 28% psicológica y 42% atención de enfermería. El rescate del conocimiento científico aumenta el desafío de maximizar esta producción científica, ofreciendo importantes contribuciones a los avances del conocimiento para una intervención más global y de mayor calidad con esta clientela.The psoriasis, chronic disease with uncertain cause, affects 1 to 3% of world population, produces great psychological impact and changes in quality of life, a challenging reality. The objective is to analyze the scientific production of nursing on psoriasis

Computational analysis of the amplified spontaneous emission in quantum dot doped plastic optical fibers

International Nuclear Information System (INIS)

Peng, Xuefeng; Han, Yinxia; Hu, Guoqiang; Wu, Pinghui

2014-01-01

The properties of amplified spontaneous emission (ASE) in CdSe/ZnS quantum dot (QD) doped step-index polymer optical fibers (POFs) were computationally analyzed in this paper. A theoretical model based on the rate equations between two main energy levels of CdSe/ZnS QD was built in terms of time (t), distance traveled by light (z) and wavelength (λ), which can describe the ASE successfully. Through analyzing the spectral evolution with distance of the pulses propagating along the CdSe/ZnS QD doped POFs, dependences of the ASE threshold and the slope efficiency on the numerical aperture were obtained. Compared to the ASE in common dye-doped POFs, the pump threshold was just about 1/1000, but the slope efficiency was much higher. (paper)

ASPECTOS EPIDEMIOLÓGICOS DE UM FOCO DE TUNGÍASE (Tunga penetrans, SIPHONAPTERA EM UM SISTEMA INTENSIVO DE SUÍNOS CRIADOS AO AR LIVRE EPIDEMIOLOGICAL ASPECTS OF A FOCUS OF Tunga penetrans INFESTATION IN OUTDOOR PIG PRODUCTION

Directory of Open Access Journals (Sweden)

Osmar Antônio Dalla Costa

2007-09-01

Full Text Available

O sistema intensivo de produção de suínos criados ao ar livre (SISCAL é caracterizado por manter os suínos em piquetes com cobertura vegetal, nas fases de reprodução, maternidade e creche, cercados com tela e/ou fios de arame eletrificado. Este trabalho teve por objetivo relatar aspectos epidemiológicos de um foco de tungíase ocorrido em um SISCAL. Foram examinados clinicamente 72 animais, sendo 6 cachaços, 9 fêmeas lactantes, 13 em gestação e 6 em cobrição, 20 leitões lactantes e 34 leitões desmamados e transferidos para unidades de terminação. Verificou-se que nenhum dos cachaços estava infestado (granja 1= 48 e que em 50% do total de fêmeas examinadas ocorreram lesões com maior freqüência nos tetos, o que nas porcas lactantes deu origem à agalaxia por obstrução do canal galactóforo ocasionando involução da glândula mamária. Em 90% dos leitões lactantes constatou-se dificuldade de locomoção causada pela presença do parasito na região plantar do casco e 25% apresentavam, além disto, lesões no jarrete. Dos leitões desmamados transferidos para unidades de terminação em confinamento, com 40-47 dias (granja 2, n=24 e com 70 dias (granja 3, n= 10 de idade 100% e 80%, respectivamente. ainda apresentavam lesões semelhantes às observadas em leitões lactantes. Conclui-se que a tungíase pode afetar suínos criados ao ar livre podendo causar agalaxia em porcas lactantes e dificuldade de locomoção em leitões lactantes e desmamados.

PALAVRAS-CHAVE: Tunga penetrans; bicho-de-pé; tungíase; sistema intensivo de suínos criados ao ar livre; agalaxia.

The outdoors intensive-type pig production is characterized by maintaining swine during

To danske tilfælde af autoimmun synaptisk encefalitis

DEFF Research Database (Denmark)

Nielsen, Signe Modvig; Høi-Hansen, Christina Engel; Uldall, Peter

2012-01-01

Autoimmune synaptic encephalitis (ASE) is a recently recognized disease entity. The early and correct diagnosis of ASE is of importance, since the prognosis depends on the early onset of treatment. We present two Danish case reports of ASE: a 15-year-old boy presenting with a severe course of N-m......-methyl-D-aspartate-encephalitis including persistent cognitive deficits, and a 59-year-old woman with coeliac disease presenting with leucine-rich glioma inactivated 1-encephalitis including dyskinesia, epilepsy, psychiatric features and vocal tics....

Fatores associados à soropositividade do teste ML Flow em pacientes e contatos de pacientes com hanseníase menores de 18 anos Factors associated with ML Flow test seropositivity in leprosy patients and household contacts under the age of 18

Directory of Open Access Journals (Sweden)

Maria Aparecida Alves Ferreira

2008-01-01

Full Text Available Estudo transversal em menores de 18 anos, sendo 115 casos novos de hanseníase e 1.011 contatos intradomiciliares. Determinaram-se as proporções da soropositividade do ML Flow e fatores associados ao teste positivo. Observou-se soropositividade em 21,7% dos pacientes e 19,7% dos contatos. Nos pacientes, a regressão logística indicou associação com baciloscopia positiva e número de lesões cutâneas maior que cinco. A análise por árvore de decisão mostrou associação com baciloscopia, classificação de Madri, número de nervos acometidos e idade. Nos contatos, as duas análises indicaram as mesmas associações: classificação do caso-índice, idade e tipo de serviço de saúde. As variáveis que explicaram melhor a soropositividade, em menores de 18 anos, são aquelas associadas à maior carga bacilar. Assim, o teste ML Flow poderia ser utilizado também na infância para ajudar na correta classificação dos pacientes para tratamento e na identificação dos contatos com maior risco de desenvolver hanseníase.This article presents the results of a cross-sectional study involving 115 newly-diagnosed leprosy patients and 1,011 household contacts, all under the age of 18. Seropositivity ratios and factors associated with a positive ML Flow were determined. The test was positive in 21.7% of patients and in 19.7% of contacts. Among patients, logistic regression indicated the association of seropositivity with positive slit skin smear and having more than five skin lesions. The tree method analysis indicated associations with skin smear, Madrid classification, number of nerves affected and age. In the contact group, index case classification, age and type of health service were associated with seropositivity in both analyses. The variables that best explained seropositivity are those associated with higher bacterial load. Therefore, the ML Flow test could be used in children to aid correct classification of patients for treatment and to

Distribuição espacial da hanseníase na população escolar em Paracatu - Minas Gerais, realizada por meio da busca ativa (2004 a 2006 Spatial distribution of leprosy among schoolchildren in Paracatu, State of Minas Gerais, through active case finding (2004 to 2006

Directory of Open Access Journals (Sweden)

Isaias Nery Ferreira

2007-12-01

Full Text Available A detecção da hanseníase no município de Paracatu é elevada em menores de quinze anos, abrangendo cerca de 6,8/10.000 hab. em 2003, e classificada como hiperendêmica. O estudo objetiva distribuir territorialmente os casos de hanseníase em adolescentes e crianças escolares menores de 20 anos, utilizando a estratégia da busca ativa de casos. Realizou-se um estudo de coorte prospectivo e ecológico com 16.623 escolares entre janeiro de 2004 a junho de 2006. No banco de dados utilizou-se o software Excel e na análise o chi2, Intervalo de Confiança - (IC 95% e Risco Relativo - (RR. Para o geoprocessamento das informações, aplicou-se o Auto CAD - release 2000. Foram diagnosticados 68 casos da doença, sendo 25,1%, multibacilares. Cerca de 85,2% residiam na área urbana, 55,8% eram mulheres e a doença predominava no grupo de 10 a 14 anos (IC95%: 0,49-0,89% e chi2 = 7,376. Houve um incremento de 38,2% na detecção dos casos no período, com visibilidade à prevalência oculta. Ao considerar a busca ativa em 2004, as microrregiões do Alto do Açude e Vista Alegre apresentaram maior detecção de casos com 41,5/10.000 habitantes, e RR = 10,9 vezes maior do que o Centro de Paracatu, com detecção de 3,8/10.000 habitantes. Em 2005, destacaram-se Paracatuzinho, Chapadinha, São João Evangelista I e II, Bandeirantes, Aeroporto e Bom Pastor, com detecção de 21,8/10000 habitantes, e RR = 8,7 vezes maior do que Nossa Senhora de Fátima e JK com detecção de 2,5/10.000 habitantes. A hanseníase entre escolares foi predominante nas áreas norte, leste, sudeste e central de Paracatu. O geoprocessamento das informações, por meio da busca ativa nas escolas, permitiu a visibilidade da hiperendemia da hanseníase por região, possibilitando aperfeiçoamento da vigilância da enfermidade.The detection rate of leprosy in the district of Paracatu is high in people younger than fifteen years of age, with about 6.8/10,000 inhabitants in 2003

Treatment of pityriasis versicolor with topical application of essential oil of Cymbopogon citratus (DC Stapf - therapeutic pilot study Tratamento de pitiríase versicolor com aplicação tópica do óleo essencial de Cymbopogon citratus (DC Stapf - estudo terapêutico piloto

Directory of Open Access Journals (Sweden)

Egberto Santos Carmo

2013-06-01

Full Text Available BACKGROUND: Pityriasis versicolor is a fungal infection caused by Malassezia spp. that has frequent relapses. OBJECTIVES: The main objective of this research was to perform phase I and II clinical studies, using formulations containing essential oil of Cymbopogon citratus in patients with pityriasis versicolor. METHODS: Phase I study included twenty volunteers to ascertain the safety of the formulations. In phase II, 47 volunteers randomly received essential oil formulations at 1.25 μL/mL concentration, for forty days. The shampoo should be applied three times a week and the cream twice a day. A control group in phase II, consisting of 29 volunteers, received the same formulations but with 2% ketoconazole as the active ingredient. RESULTS: No significant adverse events were observed in volunteers during Phase I. In Phase II, 30 (63.83% volunteers using essential oil and 18 (62.07% using ketoconazole remained until the end of the study. We observed a predominance of lesions in disseminated form, with M. sympodialis detected as the predominant agent identified in cultures. After 40 days of treatment, the rate of mycological cure was 60% (p FUNDAMENTOS: Pitiríase versicolor é uma micose causada pela Malassezia spp., e que apresenta frequentes recidivas. OBJETIVOS: Este trabalho objetivou realizar estudos clínicos de fase I e II, para essa patologia, com óleo essencial de Cymbopogon citratus. MÉTODOS: Na fase I, participaram vinte voluntários para averiguar a segurança das formulações. Na fase II, 47 voluntários receberam as formulações do óleo essencial a 1,25 μL/mL, as quais deveriam ser utilizadas por quarenta dias, sendo o xampu três vezes por semana e o creme duas vezes ao dia. Um grupo controle na fase II, constituído por 29 voluntários recebeu as mesmas formulações, com cetoconazol a 2%. RESULTADOS: Verificada a segurança das formulações com a finalização da fase I, onde nenhuma reação adversa significativa foi

Prosthesis-patient mismatch in bovine pericardial aortic valves: evaluation using 3 different modalities and associated medium-term outcomes.

Science.gov (United States)

Chacko, Satish Jacob; Ansari, Asimul H; McCarthy, Patrick M; Malaisrie, S Chris; Andrei, Adin-Cristian; Li, Zhi; Lee, Richard; McGee, Edwin; Bonow, Robert O; Puthumana, Jyothy J

2013-09-01

The prevalence of prosthesis-patient mismatch (PPM) and its impact on survival after aortic valve replacement have not been clearly defined. Historically, the presence of PPM was identified from postoperative echocardiograms or preoperative manufacturer-provided charts, resulting in wide discrepancies. The 2009 American Society of Echocardiography (ASE) guidelines proposed an algorithmic approach to calculate PPM. This study compared PPM prevalence and its impact on survival using 3 modalities: (1) the ASE guidelines-suggested algorithm (ASE PPM); (2) the manufacturer-provided charts (M PPM); and (3) the echocardiographically measured, body surface area-indexed, effective orifice area (EOAi PPM) measurement. A total of 614 patients underwent aortic valve replacement with bovine pericardial valves from 2004 to 2009 and had normal preoperative systolic function. EOAi PPM was severe if EOAi was ≤ 0.60 cm(2)/m(2), moderate if EOAi was 0.60 to 0.85 cm(2)/m(2), and absent (none) if EOAi was ≥ 0.85 cm(2)/m(2). ASE PPM was severe in 22 (3.6%), moderate in 6 (1%), and absent (none) in 586 (95.4%). ASE PPM was similar to manufacturer-provided PPM (P=1.00). ASE PPM differed significantly from EOAi PPM (P<0.001), which identified severe mismatch in 170 (29.7%), moderate in 191 (33.4%), and absent (none) in 211 patients (36.9%). Irrespective of the PPM classification method, PPM did not adversely affect midterm survival (average follow-up, 4.1 ± 1.8 years; median, 3.9 years; range, 0.01-8 years). There were no reoperations for PPM. In patients with normal systolic function undergoing bovine pericardial aortic valve replacement, the prevalence of PPM using the algorithmic-ASE approach was low and correlated well with manufacturer-provided PPM. Independent of the method of PPM assessment, PPM was not associated with medium-term mortality.

Hydrogen-producing microflora and Fe-Fe hydrogenase diversities in seaweed bed associated with marine hot springs of Kalianda, Indonesia.

Science.gov (United States)

Xu, Shou-Ying; He, Pei-Qing; Dewi, Seswita-Zilda; Zhang, Xue-Lei; Ekowati, Chasanah; Liu, Tong-Jun; Huang, Xiao-Hang

2013-05-01

Microbial fermentation is a promising technology for hydrogen (H(2)) production. H(2) producers in marine geothermal environments are thermophilic and halotolerant. However, no one has surveyed an environment specifically for thermophilic bacteria that produce H(2) through Fe-Fe hydrogenases (H(2)ase). Using heterotrophic medium, several microflora from a seaweed bed associated with marine hot springs were enriched and analyzed for H(2) production. A H(2)-producing microflora was obtained from Sargassum sp., 16S rRNA genes and Fe-Fe H(2)ase diversities of this enrichment were also analyzed. Based on 16S rRNA genes analysis, 10 phylotypes were found in the H(2)-producing microflora showing 90.0-99.5 % identities to known species, and belonged to Clostridia, Gammaproteobacteria, and Bacillales. Clostridia were the most abundant group, and three Clostridia phylotypes were most related to known H(2) producers such as Anaerovorax odorimutans (94.0 % identity), Clostridium papyrosolvens (98.4 % identity), and Clostridium tepidiprofundi (93.1 % identity). For Fe-Fe H(2)ases, seven phylotypes were obtained, showing 63-97 % identities to known Fe-Fe H(2)ases, and fell into four distinct clusters. Phylotypes HW55-3 and HM55-1 belonged to thermophilic and salt-tolerant H(2)-producing Clostridia, Halothermothrix orenii-like Fe-Fe H(2)ases (80 % identity), and cellulolytic H(2)-producing Clostridia, C. papyrosolvens-like Fe-Fe H(2)ases (97 % identity), respectively. The results of both 16S rRNA genes and Fe-Fe H(2)ases surveys suggested that the thermophilic and halotolerant H(2)-producing microflora in seaweed bed of hot spring area represented previously unknown H(2) producers, and have potential application for H(2) production.

Multiple mesodermal lineage differentiation of Apodemus sylvaticus embryonic stem cells in vitro

Directory of Open Access Journals (Sweden)

Yu Weihua

2010-06-01

Full Text Available Abstract Background Embryonic stem (ES cells have attracted significant attention from researchers around the world because of their ability to undergo indefinite self-renewal and produce derivatives from the three cell lineages, which has enormous value in research and clinical applications. Until now, many ES cell lines of different mammals have been established and studied. In addition, recently, AS-ES1 cells derived from Apodemus sylvaticus were established and identified by our laboratory as a new mammalian ES cell line. Hence further research, in the application of AS-ES1 cells, is warranted. Results Herein we report the generation of multiple mesodermal AS-ES1 lineages via embryoid body (EB formation by the hanging drop method and the addition of particular reagents and factors for induction at the stage of EB attachment. The AS-ES1 cells generated separately in vitro included: adipocytes, osteoblasts, chondrocytes and cardiomyocytes. Histochemical staining, immunofluorescent staining and RT-PCR were carried out to confirm the formation of multiple mesodermal lineage cells. Conclusions The appropriate reagents and culture milieu used in mesodermal differentiation of mouse ES cells also guide the differentiation of in vitro AS-ES1 cells into distinct mesoderm-derived cells. This study provides a better understanding of the characteristics of AS-ES1 cells, a new species ES cell line and promotes the use of Apodemus ES cells as a complement to mouse ES cells in future studies.

American Society of Echocardiography

Science.gov (United States)

American Society of Echocardiography Join Ase Renew Member Portal Log In Membership Member Portal Log In Join ASE Renew Benefits Rates FASE – Fellow of the American Society of Echocardiography Member Referral Program FAQs Initiatives Advocacy Awards, Grants, ...

Your Lung Operation: After Your Operation

Medline Plus

Full Text Available ... ASE Medical Student Core Curriculum ACS/ASE Medical Student Simulation-Based Surgical Skills Curriculum Cancer Education Cancer Education Cancer Education Cancer Programs Conference: Learn. Interact. Transform. CoC Events Quality Education Quality Education Quality Education ...

Ostomy Home Skills Program

Medline Plus

Full Text Available ... ASE Medical Student Core Curriculum ACS/ASE Medical Student Simulation-Based Surgical Skills Curriculum Cancer Education Cancer Education Cancer Education Cancer Programs Conference: Learn. Interact. Transform. CoC Events Quality Education Quality Education Quality Education ...

Violet-to-Blue Gain and Lasing from Colloidal CdS Nanoplatelets: Low-Threshold Stimulated Emission Despite Low Photoluminescence Quantum Yield

Energy Technology Data Exchange (ETDEWEB)

Diroll, Benjamin T.; Talapin, Dmitri V.; Schaller, Richard D.

2017-02-13

Amplified spontaneous emission (ASE) and lasing from solution-processed materials are demonstrated in the challenging violet-to-blue (430–490 nm) spectral region for colloidal nanoplatelets of CdS and newly synthesized core/shell CdS/ZnS nanoplatelets. Despite modest band-edge photoluminescence quantum yields of 2% or less for single excitons, which we show results from hole trapping, the samples exhibit low ASE thresholds. Furthermore, four-monolayer CdS samples show ASE at shorter wavelengths than any reported film of colloidal quantum-confined material. This work underlines that low quantum yields for single excitons do not necessarily lead to a poor gain medium. The low ASE thresholds originate from negligible dispersion in thickness, large absorption cross sections of 2.8 × 10–14 cm–2, and rather slow (150 to 300 ps) biexciton recombination. We show that under higher-fluence excitation, ASE can kinetically outcompete hole trapping. Using nanoplatelets as the gain medium, lasing is observed in a linear optical cavity. This work confirms the fundamental advantages of colloidal quantum well structures as gain media, even in the absence of high photoluminescence efficiency.

Amplified Spontaneous Emission of Organic Pyridinium Dye doped Polymeric Waveguide

International Nuclear Information System (INIS)

Jun, Xi; Li-Hua, Ye; Qiong, Wang; Deng, Xu; Chang-Gui, Lu; Guo-Hua, Hu; Yi-Ping, Cui

2009-01-01

An organic dye salt trans-4-[p-(N-hydroxyethyl-N-methylamino)styryl]-N-methylpyridinium iodide (ASPI) is doped with an electron transport organic molecule tris(8-hydroxyquinoline) aluminium (Alq3) in a host matrix of poly(methylmethacrylate) (PMMA), and the amplified spontaneous emission (ASE) is studied. By efficient Forster energy transfer from Alq3 to ASPI, it is demonstrated that the ASE threshold of ASPI:Alq3:PMMA waveguide (about 11μJ/pulse) is much lower than that of ASPI:PMMA system (about 38μJ/pulse). Meanwhile, the peak position of ASE can be controlled by the effect of film thickness on waveguide modes. We show that the ASE peak position can be tuned over 37nm. These characteristics indicate the ASPI:Alq3 system as a promising gain medium for optical amplifiers and organic semiconductor lasers

Analysis of the suitableness of some enzymatic tests for estimation the degree of radiational injury of skin

International Nuclear Information System (INIS)

Matyushichev, V.B.; Kornikov, V.V.; Taratukhin, V.R.; Timofeeva, O.E.; Vereshchagina, E.M.

1981-01-01

Possibilities to characterize the degree of skin injury of white male-rats on the 14th day after external 85 Kr #betta#-irradiation at 3, 4, 5, 6, 7, 8, 9, 10 krad doses by activity levels of alkali and acid DNA-ases of skin and blood plasma as well as skin and plasma alpha-amylase have been studied using the methods of factor analysis. It has been ascertained that alkali and acid DNA-ases of skin have the best indicating properties. Other tests in the main only supplement the general picture. The combined accounting of properties of alkali and acid DNA-ases of skin as well as acid DNA-ase and alpha-amylase of blood plasma permits to demarkate individuals completely according to the degree (zero - 3d) of skin injuries. These indicators can be used in practical dosimetry

Management of Autoimmune Status Epilepticus

Directory of Open Access Journals (Sweden)

Batool F. Kirmani

2018-05-01

Full Text Available Status epilepticus is a neurological emergency with increased morbidity and mortality. Urgent diagnosis and treatment are crucial to prevent irreversible brain damage. In this mini review, we will discuss the recent advances in the diagnosis and treatment of autoimmune status epilepticus (ASE, a rare form of the disorder encountered in the intensive care unit. ASE can be refractory to anticonvulsant therapy and the symptoms include subacute onset of short-term memory loss with rapidly progressive encephalopathy, psychiatric symptoms with unexplained new-onset seizures, imaging findings, CSF pleocytosis, and availability of antibody testing makes an earlier diagnosis of ASE possible. Neuroimmunomodulatory therapies are the mainstay in the treatment of ASE. The goal is to maximize the effectiveness of anticonvulsant agents and find an optimal combination of therapies while undergoing immunomodulatory therapy to reduce morbidity and mortality.

Enhancing Optically Pumped Organic-Inorganic Hybrid Perovskite Amplified Spontaneous Emission via Compound Surface Plasmon Resonance

Directory of Open Access Journals (Sweden)

Xiaoyan Wu

2018-03-01

Full Text Available Organic-inorganic hybrid perovskite has attracted intensive attention from researchers as the gain medium in lasing devices. However, achieving electrically driven lasing remains a significant challenge. Modifying the devices’ structure to enhance the optically pumped amplified spontaneous emission (ASE is the key issue. In this work, gold nanoparticles (Au NPs are first doped into PEDOT: PSS buffer layer in a slab waveguide device structure: Quartz/PEDOT: PSS (with or w/o Au NPs/CH3NH3PbBr3. As a result, the facile device shows a significantly enhanced ASE intensity and a narrowed full width at half maximum. Based on experiments and theoretical simulation data, the improvement is mainly a result of the compound surface plasmon resonance, including simultaneous near- and far-field effects, both of which could increase the density of excitons excited state and accelerate the radiative decay process. This method is highly significant for the design and development and fabrication of high-performance organic-inorganic hybrid perovskite lasing diodes.

Statistical evaluation of fatty acid profile and cholesterol content in fish (common carp) lipids obtained by different sample preparation procedures.

Science.gov (United States)

Spiric, Aurelija; Trbovic, Dejana; Vranic, Danijela; Djinovic, Jasna; Petronijevic, Radivoj; Matekalo-Sverak, Vesna

2010-07-05

Studies performed on lipid extraction from animal and fish tissues do not provide information on its influence on fatty acid composition of the extracted lipids as well as on cholesterol content. Data presented in this paper indicate the impact of extraction procedures on fatty acid profile of fish lipids extracted by the modified Soxhlet and ASE (accelerated solvent extraction) procedure. Cholesterol was also determined by direct saponification method, too. Student's paired t-test used for comparison of the total fat content in carp fish population obtained by two extraction methods shows that differences between values of the total fat content determined by ASE and modified Soxhlet method are not statistically significant. Values obtained by three different methods (direct saponification, ASE and modified Soxhlet method), used for determination of cholesterol content in carp, were compared by one-way analysis of variance (ANOVA). The obtained results show that modified Soxhlet method gives results which differ significantly from the results obtained by direct saponification and ASE method. However the results obtained by direct saponification and ASE method do not differ significantly from each other. The highest quantities for cholesterol (37.65 to 65.44 mg/100 g) in the analyzed fish muscle were obtained by applying direct saponification method, as less destructive one, followed by ASE (34.16 to 52.60 mg/100 g) and modified Soxhlet extraction method (10.73 to 30.83 mg/100 g). Modified Soxhlet method for extraction of fish lipids gives higher values for n-6 fatty acids than ASE method (t(paired)=3.22 t(c)=2.36), while there is no statistically significant difference in the n-3 content levels between the methods (t(paired)=1.31). The UNSFA/SFA ratio obtained by using modified Soxhlet method is also higher than the ratio obtained using ASE method (t(paired)=4.88 t(c)=2.36). Results of Principal Component Analysis (PCA) showed that the highest positive impact to

Estimated allele substitution effects underlying genomic evaluation models depend on the scaling of allele counts

NARCIS (Netherlands)

Bouwman, Aniek C.; Hayes, Ben J.; Calus, Mario P.L.

2017-01-01

Background: Genomic evaluation is used to predict direct genomic values (DGV) for selection candidates in breeding programs, but also to estimate allele substitution effects (ASE) of single nucleotide polymorphisms (SNPs). Scaling of allele counts influences the estimated ASE, because scaling of

RELASI INTERNET DAN MEDIA SOSIAL DALAM PEMBENTUKAN BRAND AWARENESS, IMAGE DAN EXPERIENCE PRODUK ASING

OpenAIRE

Ina Nur Ratriyana

2016-01-01

The effect of globalization on communication process appears especially in digital media which made communication exchange faster. Cultural process also create homogenization of product choice, when global brand looks more familiar than local brand. Internet and social media give an opportunity for consumer to access the product information and interact with them. Interactivity as part of digital media offers unlimited access and the power of word of mouth in terms of internet and social medi...

Navy-ASEE Summer Faculty Research Program. Navy-ASEE Sabbatical Leave Program.

Science.gov (United States)

1994-09-01

University Arnall Physical Therapy N. Arizona Univ. I Azimi-Sadjadi Elec. Eng. Colorado St. Univ. Baird Chem. Univ. of Alabama in Huntsville I Bandy Mech...provide the framework for the analysis of data in magneto -optics and on tunneling structures for a number of years. Dr. Bilal M. Ayyub Associate

Amplified spontaneous emission in solar-pumped iodine laser

Science.gov (United States)

Cho, Yong S.; Hwang, In H.; Han, Kwang S.; Lee, Ja H.

1992-01-01

The amplified spontaneous emission (ASE) from a long pulse, solar-simulating radiation pumped iodine laser amplifier is studied. The ASE threshold pump intensity is almost proportional to the inverse of the laser gain length when the gas pressure is constant in the laser tube.

Transplantation of bone marrow-derived mesenchymal stem cells rescues partially rachitic phenotypes induced by 1,25-Dihydroxyvitamin D deficiency in mice

OpenAIRE

Zhang, Zengli; Yin, Shaomeng; Xue, Xian; Ji, Ji; Tong, Jian; Goltzman, David; Miao, Dengshun

2016-01-01

To determine whether the transplantation of bone marrow-derived mesenchymal stem cells (BM-MSCs) can improve the 1,25(OH)2D deficiency-induced rachitic phenotype, 2×106 BM-MSCs from wild-type mice or vehicle were transplanted by tail vein injection into mice deficient in 1,25(OH)2D due to targeted deletion of 1α(OH)ase (1α(OH)ase-/-). Our results show that 1α(OH)ase mRNA was expressed in the BM-MSCs derived from wild-type mice, and was detected in long bone, kidney and intestine from BM-MSC-t...

Pilot study on which foods should be avoided by patients with psoriasis

OpenAIRE

Festugato, Moira

2011-01-01

FUNDAMENTOS: Psoríase é uma doença inflamatória crônica, sistêmica, mediada por fatores imunológicos. Serão abordados os alimentos que atuam sobre estes fatores, contribuindo para a psoríase. Como doença sistêmica, que compartilha o mesmo substrato fisiopatológico com outras comorbidades, a dieta alimentar também leva à piora das comorbidades. OBJETIVO: Destacar um grupo de alimentos que pode atuar como um fator de manifestação e/ou agravo da psoríase e ao mesmo tempo viabilizar estratégias i...

Validation of artificial skin equivalents as in vitro testing systems

Science.gov (United States)

Schmitt, Robert; Marx, Ulrich; Walles, Heike; Schober, Lena

2011-03-01

With the increasing complexity of the chemical composition of pharmaceuticals, cosmetics and everyday substances, the awareness of potential health issues and long term damages for humanoid organs is shifting into focus. Artificial in vitro testing systems play an important role in providing reliable test conditions and replacing precarious animal testing. Especially artificial skin equivalents ASEs are used for a broad spectrum of studies like penetration, irritation and corrosion of substances. One major challenge in tissue engineering is the qualification of each individual ASE as in vitro testing system. Due to biological fluctuations, the stratum corneum hornified layer of some ASEs may not fully develop or other defects might occur. For monitoring these effects we developed an fully automated Optical Coherence Tomography device. Here, we present different methods to characterize and evaluate the quality of the ASEs based on image and data processing of OCT B-scans. By analysing the surface structure, defects, like cuts or tears, are detectable. A further indicator for the quality of the ASE is the morphology of the tissue. This allows to determine if the skin model has reached the final growth state. We found, that OCT is a well suited technology for automatically characterizing artificial skin equivalents and validating the application as testing system.

Estudo comparativo preliminar entre os alongamentos proprioceptivo e estático passivo em pacientes com seqüelas de hanseníase Preliminary comparative study between proprioceptive and passive static stretching in patients with leprosy sequelae

Directory of Open Access Journals (Sweden)

Augusto Floricel Diaz

2008-12-01

Full Text Available A proposta deste estudo foi comparar a aplicação de alongamento estático passivo e alongamento proprioceptivo no tratamento de seqüelas de hanseníase. Doze pacientes com essas seqüelas participaram da pesquisa, separados aleatoriamente em dois grupos: o grupo FNP, tratado com facilitação neuromuscular proprioceptiva, e o grupo AEP, com alongamento estático passivo. Ambos realizaram dez sessões de alongamentos, sendo submetidos à avaliação inicial e final nas quais foram aplicados o questionário SF-36, mensuradas a amplitude de movimento (ADM do punho e tornozelo, testados os reflexos e a sensibilidade. No grupo FNP foi observada melhora na ADM do tornozelo e em três domínios do SF-36; no grupo AEP, em cinco domínios do SF-36. Quando comparados os grupos, o FNP obteve melhora significativa na extensão do punho, dorsiflexão e plantiflexão em relação ao AEP. A facilitação neuromuscular proprioceptiva parece ser um método mais eficaz para ganhar alongamento muscular e ADM de tornozelo e punho em pacientes com seqüelas de hanseníase. Não foi observada relação entre acréscimo na ADM e melhora na qualidade de vida relacionada à saúde nos pacientes dos dois grupos.The purpose of this study was to compare the effects of two kinds of stretching - passive, static stretching, and proprioceptive neuromuscular facilitation (PNF - in patients with leprosy sequel. Twelve patients were randomly assigned into two groups: the PNF group and the SS group, that was submitted to static stretching. Both groups attended ten stretching sessions, being submitted to initial and final evaluations in which were assessed: health-related quality of life, by means of he SF-36 questionnaire; ankle and wrist range of motion (ROM; and sensitivity and reflex testing. Improvements in ankle movement and in three SF-36 domains were observed in PNF group; and in five SF-36 domains in SS group. PNF group showed better improvement in wrist extension and

Stades method for surgical correction of upper eyelid trichiasis-entropion: results and follow-up in 21 cases Método de Stades para a correção da triquíase-entrópio da pálpebra superior: resultados e acompanhamento de 21 casos

Directory of Open Access Journals (Sweden)

José Luiz Laus

2000-08-01

Full Text Available Trichiasis is a condition in which lhe cuia and facial hairs grow toward lhe córnea or the conjunctiva. The hairs arising from normal sites are pointed aí an abnormal direction. This condition may be caused by prominent nasal folds, entropion, blepharospasm, slipped facial mask and dermoids. The upper eyelid trichiasis-entropion with lower eyelid entropionectropion frequentiy occurs in oíder English Cocker Spaniels. The ocular signs often are epiphora, blepharospasm, conjunctivitis, keratitis and comeal ulceratíon. Treatment depenas on the severity ofthe condition and must eliminate the ocular contact by misdirected cuia that irritate the eyeball. This report presents a retrospective study of21 patients with bilateral diffüse trichiasis (15 English Cocker Spaniels; 2 Basset hounds; l Bloodhound; l Fila Brasileiro and 2 mongrel dogs. The procedure described by Stades was employed m ali cases. Postoperatively, topical chioramphenicol oiníment (qid was appiied in the conjunctival soe and on the open woundfor 2 weeks. Sutures were removed 10 days after surgery. Correction ofpositioning ofthe upper eyelid was successfúl and its apposition to córnea was normal. In most of the cases the reepithelialiwtion was complete one month after surgery. No signs ofrecurrence werefound and there appeared to be no loss of normal fünction of the eyelid in the 21 dogs available for follow-up examination in a maximum period of 36 months.Triquíase é a condição na qual os cílios e os cabelos faciais crescem em direção à córnea ou conjuntiva. Os pêlos que surgem de locais normais estão apontados em uma direção anormal. Essa condição pode ser causada por dobras nasais proeminentes, entrópio, blefarospasmo, pele facial redundante e dennóides. A triquíase-entrópio da pálpebra superior associada ao entrópio-ectrópio da pálpebra inferior, frequentemente, ocorre em English Cocker Spaniels idosos. Os sinais oculares são frequentemente ep

Atenção básica de saúde e a assistência em Hanseníase em serviços de saúde de um município do Estado de São Paulo La atención básica a la salud y la asistencia a la Lepra en servicios de salud de un municipio del Estado de São Paulo The basic health and assistance to Hansen's Disease in health care services of a municipality of São Paulo State

Directory of Open Access Journals (Sweden)

Adriana Jimenez Pereira

2008-11-01

Full Text Available Este é um estudo descritivo desenvolvido em um município do Estado de São Paulo. Objetivo: identificar e caracterizar as ações do Programa de Controle da Hanseníase nos serviços de saúde municipais. Metodologia: entrevistas gravadas com gestor municipal de saúde e profissionais da assistência à hanseníase. Resultados: a política pública municipal em saúde prioriza o desenvolvimento da atenção básica com ênfase na saúde pública. As ações são realizadas por profissionais capacitados e experientes em hanseníase. Ve rificou-se a não realização da busca ativa dos casos, necessária para o real conhecimento da situação epidemiológica, e das ações de educação em saúde, importante para a redução do estigma e aproximação do sujeito à nova situação de vida e enfrentamento de limitações.Este estudio descriptivo es una investigación que analizó la situación de la atención de la Lepra en un municipio del Estado de Sao Paulo. Objetivo: identificar y caracterizar las acciones del Programa de Control de Lepra de los servicios de salud de ese municipio. Metodología: se entrevistaron a los profesionales encargados de la atención de lepra y al director municipal de políticas de salud. Resultados: las políticas públicas municipales de salud priorizaron el desarrollo de la atención básica, con énfasis en la salud pública tradicional. Las acciones de control de lepra son realizadas por trabajadores capacitados y con significativa experiencia profesional. Se resalta la ausencia de busca activa de los casos, necesaria para un conocimiento real de la situación epidemiológica y la importancia de educación en salud, para reducir el estigma y aproximar el sujeto a las adaptaciones necesarias en la nueva situación de vida para afrontar las limitaciones.This descriptive study was carried out in a municipality of Sao Paulo State. The objective was to identify and to characterize the Leprosy Control Program in

Path trading : fast algorithms, smoothed analysis, and hardness results

NARCIS (Netherlands)

Berger, A.; Röglin, H.; Zwaan, van der G.R.J.; Pardalos, P.M.; Rebennack, S.

2011-01-01

The Border Gateway Protocol (BGP) serves as the main routing protocol of the Internet and ensures network reachability among autonomous systems (ASes). When traffic is forwarded between the many ASes on the Internet according to that protocol, each AS selfishly routes the traffic inside its own

78 FR 49412 - Personal Flotation Devices Labeling and Standards

Science.gov (United States)

2013-08-14

... later notice in the Federal Register. II. Abbreviations ASE Applied Safety and Ergonomics DHS Department... Park Service OMB Office of Management and Budget OSHA Occupational Safety and Health Administration PFD... approved equipment. In 2004, the consultant Applied Safety and Ergonomics (ASE) did a study of the current...

Cholelithiasis with atrophy of the right lateral hepatic lobe in a horse Colelitíase com atrofia do lobo lateral direito em um cavalo

Directory of Open Access Journals (Sweden)

Renato de Lima Santos

2007-04-01

Full Text Available A 22 year-old horse developed cholelithiasis with marked atrophy of the right lateral hepatic lobe. The horse had a history of intermittent colic since three years of age, and one of the first episodes of colic was associated with icterus. The size of the right lateral hepatic lobe was extremely reduced. There was a large choledocholith in the common hepatic duct, and several hepatoliths and choleliths in the intra- and extra-hepatic billiary ducts. Microscopically, there was severe atrophy of the right lobe with diffuse proliferation of connective tissue and billiary ducts. The left lateral lobe had peri-portal fibrosis with proliferation of billiary ducts, and billiary stasis. Chemical analysis of the calculi detected amorphous and triple phosphate, bilirubin, calcium, and iron.Um cavalo de 22 anos de idade desenvolveu quadro de colelitíase severa com atrofia do lobo lateral direito. O animal tinha histórico de cólica recorrente, desde os três anos de idade, sendo que um dos primeiros episódios de cólica foi acompanhado de icterícia. O lobo hepático lateral direito estava extremamente diminuído de volume. Havia um grande coledocólito localizado no ducto hepático comum e inúmeros hepatólitos e colélitos nos ductos biliares intra e extra-hepáticos. Microscopicamente, foi observada atrofia acentuada do lobo direito, com proliferação difusa de tecido conjuntivo fibroso e de ductos biliares. O lobo lateral esquerdo apresentava fibrose periportal difusa associada à proliferação acentuada de ductos biliares e estase biliar. Análise química das concreções detectou fosfato triplo e amorfo, bilirrubina, cálcio e ferro.

Accelerated solvent extraction method with one-step clean-up for hydrocarbons in soil

International Nuclear Information System (INIS)

Nurul Huda Mamat Ghani; Norashikin Sain; Rozita Osman; Zuraidah Abdullah Munir

2007-01-01

The application of accelerated solvent extraction (ASE) using hexane combined with neutral silica gel and sulfuric acid/ silica gel (SA/ SG) to remove impurities prior to analysis by gas chromatograph with flame ionization detector (GC-FID) was studied. The efficiency of extraction was evaluated based on the three hydrocarbons; dodecane, tetradecane and pentadecane spiked to soil sample. The effect of ASE operating conditions (extraction temperature, extraction pressure, static time) was evaluated and the optimized condition obtained from the study was extraction temperature of 160 degree Celsius, extraction pressure of 2000 psi with 5 minutes static extraction time. The developed ASE with one-step clean-up method was applied in the extraction of hydrocarbons from spiked soil and the amount extracted was comparable to ASE extraction without clean-up step with the advantage of obtaining cleaner extract with reduced interferences. Therefore in the developed method, extraction and clean-up for hydrocarbons in soil can be achieved rapidly and efficiently with reduced solvent usage. (author)

Evaluation of Soxhlet extraction, accelerated solvent extraction and microwave-assisted extraction for the determination of polychlorinated biphenyls and polybrominated diphenyl ethers in soil and fish samples

International Nuclear Information System (INIS)

Wang Pu; Zhang Qinghua; Wang Yawei; Wang Thanh; Li Xiaomin; Ding Lei; Jiang Guibin

2010-01-01

Three commonly applied extraction techniques for persistent organic chemicals, Soxhlet extraction (SE), accelerated solvent extraction (ASE) and microwave-assisted extraction (MAE), were applied on soil and fish samples in order to evaluate their performances. For both PCBs and PBDEs, the two more recent developed techniques (ASE and MAE) were in general capable of producing comparable extraction results as the classical SE, and even higher extraction recoveries were obtained for some PCB congeners with large octanol-water partitioning coefficients (K ow ). This relatively uniform extraction results from ASE and MAE indicated that elevated temperature and pressure are favorable to the efficient extraction of PCBs from the solid matrices. For PBDEs, difference between the results from MAE and ASE (or SE) suggests that the MAE extraction condition needs to be carefully optimized according to the characteristics of the matrix and analyte to avoid degradation of higher brominated BDE congeners and improve the extraction yields.

Development of Biopolymer Composite Films Using a Microfluidization Technique for Carboxymethylcellulose and Apple Skin Particles

Directory of Open Access Journals (Sweden)

Inyoung Choi

2017-06-01

Full Text Available Biopolymer films based on apple skin powder (ASP and carboxymethylcellulose (CMC were developed with the addition of apple skin extract (ASE and tartaric acid (TA. ASP/CMC composite films were prepared by mixing CMC with ASP solution using a microfluidization technique to reduce particle size. Then, various concentrations of ASE and TA were incorporated into the film solution as an antioxidant and an antimicrobial agent, respectively. Fourier transform infrared (FTIR, optical, mechanical, water barrier, and solubility properties of the developed films were then evaluated to determine the effects of ASE and TA on physicochemical properties. The films were also analyzed for antioxidant effect on 2,2-diphenyl-1-picrylhydrazyl radical scavenging activity and antimicrobial activities against Listeria monocytogenes, Staphylococcus aureus, Salmonella enterica, and Shigella flexneri. From the results, the ASP/CMC film containing ASE and TA was revealed to enhance the mechanical, water barrier, and solubility properties. Moreover, it showed the additional antioxidant and antimicrobial properties for application as an active packaging film.

Evaluation of Soxhlet extraction, accelerated solvent extraction and microwave-assisted extraction for the determination of polychlorinated biphenyls and polybrominated diphenyl ethers in soil and fish samples

Energy Technology Data Exchange (ETDEWEB)

Wang Pu [State Key Laboratory of Environmental Chemistry and Ecotoxicology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China); Zhang Qinghua, E-mail: qhzhang@rcees.ac.cn [State Key Laboratory of Environmental Chemistry and Ecotoxicology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China); Wang Yawei; Wang Thanh; Li Xiaomin; Ding Lei; Jiang Guibin [State Key Laboratory of Environmental Chemistry and Ecotoxicology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China)

2010-03-17

Three commonly applied extraction techniques for persistent organic chemicals, Soxhlet extraction (SE), accelerated solvent extraction (ASE) and microwave-assisted extraction (MAE), were applied on soil and fish samples in order to evaluate their performances. For both PCBs and PBDEs, the two more recent developed techniques (ASE and MAE) were in general capable of producing comparable extraction results as the classical SE, and even higher extraction recoveries were obtained for some PCB congeners with large octanol-water partitioning coefficients (K{sub ow}). This relatively uniform extraction results from ASE and MAE indicated that elevated temperature and pressure are favorable to the efficient extraction of PCBs from the solid matrices. For PBDEs, difference between the results from MAE and ASE (or SE) suggests that the MAE extraction condition needs to be carefully optimized according to the characteristics of the matrix and analyte to avoid degradation of higher brominated BDE congeners and improve the extraction yields.

Hanseníase em menores de quinze anos no município de Paracatu, MG (1994 a 2001 Leprosy in patients under fifteen years of age in the city of Paracatu-MG (1994 to 2001

Directory of Open Access Journals (Sweden)

Isaias Nery Ferreira

2005-03-01

Full Text Available O Município de Paracatu-MG é considerado prioritário para ações de controle da hanseníase devido às suas taxas de detecção e prevalência desta nosologia, sobretudo em menores de quinze anos. Nos anos de 1998 e 1999, realizou-se um trabalho de esclarecimento sobre sinais e sintomas da doença para uma população de cerca de oito mil escolares, o que contribuiu para o incremento da taxa de detecção da doença em menores de quinze anos, sendo o município classificado como hiperendêmico entre os anos de 1997 e 2001. Realizou-se também um trabalho de desenho descritivo de quarenta e cinco pacientes diagnosticados e tratados no município de Paracatu entre 1994 e 2001. Cinqüenta e três por cento dos diagnósticos foram em crianças do sexo masculino, 75,5% dos casos se situavam entre dez e catorze anos de idade e a escolaridade da população deste estudo está defasada em relação à idade, sendo que 84% da clientela morava em zona urbana. Todos os inscritos (100% foram casos novos, 56,0% de forma multibacilar, forma clínica Dimorfa, e 44% de formas paucibacilares, como a forma clinica Indeterminada (30,8% e a Tuberculóide (13,2%. Todos foram tratados segundo esquema padrão, com 100% de cura. Vinte e quatro por cento dos doentes apresentaram reações no diagnóstico e durante o tratamento, e 9% apresentaram reações no pós-alta. Vinte e dois por cento dos doentes apresentavam algum grau de incapacidade no diagnóstico e 13% apresentavam algum grau de incapacidade na alta (índice considerado alto. Verificou-se que 62% dos pacientes tinham contatos intradomiciliares portadores de hanseníase, sendo que somente em 15,5% destes contatos foram verificadas as duas cicatrizes da vacina BCG. A hanseníase é um sério problema de saúde pública no município estudado, e o trabalho realizado com escolares foi fundamental para o aumento da detecção dos casos.The city of Paracatu-MG is considered a priority for leprosy control

Digital radiography using amorphous selenium: photoconductively activated switch (PAS) readout system.

Science.gov (United States)

Reznik, Nikita; Komljenovic, Philip T; Germann, Stephen; Rowlands, John A

2008-03-01

A new amorphous selenium (a-Se) digital radiography detector is introduced. The proposed detector generates a charge image in the a-Se layer in a conventional manner, which is stored on electrode pixels at the surface of the a-Se layer. A novel method, called photoconductively activated switch (PAS), is used to read out the latent x-ray charge image. The PAS readout method uses lateral photoconduction at the a-Se surface which is a revolutionary modification of the bulk photoinduced discharge (PID) methods. The PAS method addresses and eliminates the fundamental weaknesses of the PID methods--long readout times and high readout noise--while maintaining the structural simplicity and high resolution for which PID optical readout systems are noted. The photoconduction properties of the a-Se surface were investigated and the geometrical design for the electrode pixels for a PAS radiography system was determined. This design was implemented in a single pixel PAS evaluation system. The results show that the PAS x-ray induced output charge signal was reproducible and depended linearly on the x-ray exposure in the diagnostic exposure range. Furthermore, the readout was reasonably rapid (10 ms for pixel discharge). The proposed detector allows readout of half a pixel row at a time (odd pixels followed by even pixels), thus permitting the readout of a complete image in 30 s for a 40 cm x 40 cm detector with the potential of reducing that time by using greater readout light intensity. This demonstrates that a-Se based x-ray detectors using photoconductively activated switches could form a basis for a practical integrated digital radiography system.

Amplified spontaneous emission of an end-pumped cesium vapor laser

International Nuclear Information System (INIS)

An, Guofei; Wang, You; Cai, He; Han, Juhong; Wang, Shunyan; Rong, Kepeng; Yu, Hang; Xue, Liangping; Zhang, Wei; Wang, Hongyuan; Zhou, Jie

2017-01-01

Diode pumped alkali lasers (DPALs) provide a significant potential for construction of high-powered lasers. A series of models have been established to analyze the DPAL’s kinetic process and most of them are based on the algorithms in which the amplified spontaneous emission (ASE) effect has not been considered. However, ASE is harmful in realization of a high-powered DPAL since the gain is very high. Usually, ASE becomes serious when the volume of the gain medium is large and the pump power is high. Basically, the conclusions we obtained in this study can be extended to other kinds of laser configurations. (paper)

Extraction and detection of arsenicals in seaweed via accelerated solvent extraction with ion chromatographic separation and ICP-MS detection

Energy Technology Data Exchange (ETDEWEB)

Gallagher, P.A.; Shoemaker, J.A.; Wei Xinyi; Brockhoff-Schwegel, C.A.; Creed, J.T. [Microbiological and Chemical Exposure Assessment Research Div., Cincinnati, OH (United States)

2001-01-01

An accelerated solvent extraction (ASE) device was evaluated as a semi-automated means of extracting arsenicals from ribbon kelp. The effect of the experimentally controllable ASE parameters (pressure, temperature, static time, and solvent composition) on the extraction efficiencies of arsenicals from seaweed was investigated. The extraction efficiencies for ribbon kelp (approximately 72.6%) using the ASE were fairly independent (< 7%) of pressure, static time and particle size after 3 ASE extraction cycles. The optimum extraction conditions for the ribbon kelp were obtained by using a 3 mL ASE cell, 30/70 (w/w) MeOH/H{sub 2}O, 500 psi (1 psi = 7 KPa), ambient temperature, 1 min heat step, 1 min static step, 90% vol. flush, and a 120 s purge. Using these conditions, two other seaweed products produced extraction efficiencies of 25.6% and 50.5%. The inorganic species present in the extract represented 62.5% and 27.8% of the extracted arsenic. The speciation results indicated that both seaweed products contained 4 different arsenosugars, DMA (dimethylarsinic acid), and As(V). One seaweed product also contained As(III). Both of these seaweed products contained an arsenosugar whose molecular weight was determined to be 408 and its structure was tentatively identified using ion chromatography-electrospray ionization-mass spectrometry/mass spectrometry (IC-ESI-MS/MS). (orig.)

Proteomic and carbonylation profile analysis of rat skeletal muscles following acute swimming exercise.

Directory of Open Access Journals (Sweden)

Francesca Magherini

Full Text Available Previous studies by us and other groups characterized protein expression variation following long-term moderate training, whereas the effects of single bursts of exercise are less known. Making use of a proteomic approach, we investigated the effects of acute swimming exercise (ASE on protein expression and carbonylation patterns in two hind limb muscles: the Extensor Digitorum Longus (EDL and the Soleus, mostly composed of fast-twitch and slow-twitch fibres, respectively. Carbonylation is one of the most common oxidative modifications of proteins and a marker of oxidative stress. In fact, several studies suggest that physical activity and the consequent increase in oxygen consumption can lead to increase in reactive oxygen and nitrogen species (RONS production, hence the interest in examining the impact of RONS on skeletal muscle proteins following ASE. Results indicate that protein expression is unaffected by ASE in both muscle types. Unexpectedly, the protein carbonylation level was reduced following ASE. In particular, the analysis found 31 and 5 spots, in Soleus and EDL muscles respectively, whose carbonylation is reduced after ASE. Lipid peroxidation levels in Soleus were markedly reduced as well. Most of the decarbonylated proteins are involved either in the regulation of muscle contractions or in the regulation of energy metabolism. A number of hypotheses may be advanced to account for such results, which will be addressed in future studies.

Leprosy: an educational approach with high school

Directory of Open Access Journals (Sweden)

Mônica Gisele Costa Pinheiro

2014-03-01

Full Text Available Objetivo: Analisar o conhecimento de escolares do ensino médio sobre hanseníase antes e após a prática da educação em saúde nas salas de aula. Método: Estudo exploratório, descritivo, com população de 358 estudantes do ensino médio e amostra de 200 escolares. Critérios de seleção da amostra: alunos matriculados na escola selecionada para estudo, presentes em sala de aula e que assinaram o TCLE. Para a coleta de dados foi utilizado um questionário contendo questões fechadas sobre a hanseníase. O projeto foi submetido e aprovado pelo CEP da Universidade Federal do Rio Grande do Norte, com número de protocolo 085/08 e CAAE 00780051000-09. Resultados: Em princípio, a hanseníase era pouco conhecida pelos escolares. Entretanto, esta realidade logo se transformou após a realização da palestra como instrumento de educação em saúde. Conclusão: Enfatizou-se a importância de ações de educação em saúde sobre hanseníase realizada pela enfermagem. Descritores: Educação em Saúde, Hanseníase, Enfermagem.

Terapia Expulsiva Medicamentosa na Litíase Ureteral: Revisão de Literatura/ Medicamental Expulsive Therapy in Ureteral Lithiasis: Literature Review

Directory of Open Access Journals (Sweden)

Kenji Maeda Missima

2014-06-01

Full Text Available A terapia expulsiva medicamentosa na litíase ureteral tem ganhado importante espaço na prática clínica, visto que é um método não invasivo e de grande eficácia. Como se trata de uma afecção comum, de alta incidência e custo, a terapia expulsiva possibilita um manejo clínico menos dispendioso e invasivo, quando comparada a procedimentos intervencionistas. Há consenso na literatura que a terapia expulsiva medicamentosa é efetiva e deve ser utilizada em cálculos com cerca de 5 milímetros de diâmetro, visto que as drogas utilizadas aumentam a taxa e diminuem o tempo de expulsão, além de diminuir a dor e o número de internações. O tamanho e localização do cálculo são de extrema relevância para que se possa considerar o manejo conservador. As drogas que obtém as melhores taxas expulsivas são os bloqueadores dos receptores alfa-adrenérgicos e os bloqueadores dos canais de cálcio. Analgésicos também são utilizados para o alívio da dor e o uso de corticoides ainda é questionado. Medicamental expulsive therapy for ureteral stones has gained important place in clinical practice, because it is a noninvasive and highly effective method. As it is a common disorder with high incidence and cost, expulsive therapy provides a less costly and invasive clinical management when compared to interventional procedures. There is a consensus that the medicamental expulsive therapy is effective and should be used in calculations with about 5 millimeters in diameter, since the drugs used increase rate and decrease the time of expulsion, in addition to reducing the pain and the number of hospitalizations. The size and location of the calculi are very important for it to be considered conservative management. The drugs that get the best expulsive rates are alpha - adrenergic receptor blockers and calcium channel blockers. Analgesics are also used for pain relief and the use of corticosteroids is still questioned.

Development of radioimmunoassay methods for plasma T, DHT, A and DHEA and their application to the study of congenital defficiency of critical 21 - OH'ase

International Nuclear Information System (INIS)

Achando, S.S.

1980-01-01

Radioimmunoassay methods have been developed for plasma T, DHT, A and DHEA. Plasma volumes usually employed were: 0,2 ml and 0,5 ml for men and women, respectively for T: 1,0 ml from DHT and 0,5 ml to A and DHEA. After preliminary extraction with diethyl ether, the extracts were applied to Sephadex LH-20 microcolumns to separate T from DHT and to Al 2 O 3 microcolumns purification of DHEA. Following elution, the dried, purified extracts were incubated with specific antisera at temperature 4 0 C overnight, the separation of antibody bound and free fractions being done on activated charcoal-dextrana T-70. The counting was done in liquid scintillations. Specificity studies have shown that the assays for all steroids were specific. The sensitivity was 5 pg for A and DHEA, 6 pg for T and DHT. The interassay coeficient of variation was 5-10% and the interessay precision was 10-15%. The accuracy was satisfactory with a - 8,74% for DHT, 104,82 +- 9,41% for A and 103,66 +- 5,71% for DHEA. The mean +- SD of plasma T, DHT, A and DHEA concentrations in normal men and women determined by these methods were as folows: in men, T:5,2 ng/ml +- 1,3, DHT:0,26 +- 0,18, A:0,9 +- 0,4 and DHEA:4,6 +- 17 and in females: T:0,5 ng/ml +- 0,2, DHT:0,4 +- 0,2, A:0,8 +- 0,5 and DHEA:4,8 +- 1,7. The methodology applied for blood collected simultaneously from peripheral and left and right adrenal vein effluents in basal conditions, after dexamethasone suppression and ACTH stimulation clearly demonstrated direct secretion (presence of a steroid gradient Peripheral/Adrenal vein) of the androgens studied in congenital defficiency of cortical 21-OH'ase. (Author) [pt

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21220505 >1chkA 2 236 70 304 9e-83 ... ref|NP_626284.1| putative chitosan...ase (putative secreted protein) [Streptomyces ... coelicolor A3(2)] emb|CAB52859.1| putative chitosan...ase ... (putative secreted protein) [Streptomyces coelicolor ... A3(2)] pir||T34867 probable chitosan

Human pseudomyiasis caused by Eristalis tenax (Linnaeus (Diptera: Syrphidae in Goiás Pseudomiíase humana causada por Eristalis tenax (Linnaeus (Diptera: Syrphidae em Goiás

Directory of Open Access Journals (Sweden)

Marco Tulio A. Garcia-Zapata

2005-04-01

Full Text Available The objective of the present work was to register the first proven cases of human pseudomyiasis due to Eristalis tenax in Goiás State, Brazil, underscoring their clinical manifestations and direct relationship with hygiene. The taxonomic identification of the instars was done according to the descriptions and keys presented by James (1947, Hartley (1961 and Guimarães & Papavero (1999. Two cases were observed. In both cases there was no evidence of apparent mental disturbance. The clinical picture of these cases was self limited. The water supply, sewer system, socioeconomic level and habits of the suspect species of the flies are criteria that should be investigated.O presente trabalho visa registrar os primeiros casos evidenciados de pseudomiíases humanos por Eristalis tenax no estado de Goiás, Brasil, destacando suas manifestações clínicas e suas relações diretas com os hábitos higiênicos. A identificação taxonômica das larvas foi realizada com base nas descrições e chaves apresentadas por James (1947, Hartley (1961 e Guimarães & Papavero (1999. Observaram-se dois casos. Em ambos não havia evidência de pertubações mentais claras. O quadro clínico de ambos os casos era mesmo limitado. O abastecimento de água, o nível sócio-econômico e o hábito das espécies das moscas são critérios que devem ser considerados na investigação.

O que há de novo no diagnóstico e tratamento da litíase urinária? What's new in the diagnosis and management of urinary lithiasis?

Directory of Open Access Journals (Sweden)

Eduardo Mazzucchi

2009-01-01

Full Text Available OBJETIVO. Atualizar aspectos do diagnóstico e do tratamento da litíase urinária. MÉTODOS. Uma revisão dos principais artigos publicados sobre o tema em revistas indexadas no "Medline" entre 1979 e 2009. RESULTADOS. A ocorrência de cálculos é maior em pacientes com IMC > 30. A TC sem contraste promove o diagnóstico correto em até 98% dos casos. O uso de bloqueadores alfa-adrenérgicos aumenta a eliminação de cálculos ureterais menores que 8 mm em 29%. O índice de pacientes livres de cálculo após LEOC varia entre 35% e 91%, conforme seu tamanho e localização. Cálculos renais maiores que 2 cm são eliminados pela NLPC entre 60% e 100% dos casos. Cálculos de ureter distal são tratados com sucesso em até 94% dos casos pela ureteroscopia semirrígida contra 74% da LEOC. Já para cálculos de ureter superior as taxas de sucesso situam-se entre 77% e 91% para ureteroscopia e 41% e 82% para a LEOC. CONCLUSÃO. A associação da calculose urinária com obesidade e Diabetes mellitus está bem estabelecida. A TC sem contraste é atualmente o padrão-ouro no diagnóstico da litíase urinária. A LEOC é o método de eleição em nosso meio para tratamento de cálculos renais menores que 2 cm e com densidade tomográfica OBJECTIVE. To review developments in the diagnosis and treatment of urinary lithiasis. METHODS. A review of the most important articles on the subject published in Medline indexed periodicals between 1979 and 2009.RESULTS. Stones occur with greater frequency among people with BMI > 30. Computerized tomography without contrast provides the correct diagnosis in up to 98% of cases. Alpha-adrenergic blockers increase elimination of ureteral calculi smaller than 8 mm by 29%. The proportion of patients free from calculi after ESWL varies from 35% to 91%, depending on size and location. In between 60% and 100% of cases, renal calculi larger than 2 cm are eliminated with PCNL. Calculi of the distal ureter are successfully

Analytical method for Dioxin and Organo-Chlorinated Compounds:(II) Comparison of Extraction Methods of Dioxins from XAD-2 Adsorbent

International Nuclear Information System (INIS)

Yang, Jeong Soo; Lee, Sung Kwang; Park, Young Hun; Lee, Dai Woon

1999-01-01

Supercritical fluid extraction (SFE), ultrasonic extraction (USE), and accelerated solvent extraction (ASE) were compared with the well known Soxhlet extraction for the extraction of polychlorinated biphenyls (PCB s ) and polychlorinated dibenzo-p-dioxins (PCDD s ) from the XAD-2 resin which was used to adsorb PCDD s in the atmosphere. XAD-2 resin spiked with five PCDD s was chosen as a sample. The optimum conditions for the extraction of PCDD s by SFE were turned out to be the use of CO 2 modified with 10% toluene at 100 .deg. C and 350 atm, with 5 min static extraction followed by 20 min dynamic extraction. SFE gave a good extraction rate with good reproducibility for PCDD s ranging from 68 to 98%. The ultrasonic extraction of PCDD s from XAD-2 was investigated and compared with other extractions. A probe type method was compared with a bath type. Two extraction solvents, toluene and acetone were compared with their mixture. The use of their mixture in probe type, with 9 minutes of extraction time, was found to be the optimum condition. The average recovery of the five PCDD s for USE was 82-93%. Accelerated solvent extraction (ASE) with a liquid solvent, a new technique for sample preparation, was performed under elevated temperatures and pressures. The effect of temperature on the efficiency of ASE was investigated. The extraction time for a 10 g sample was less than 15 min, when the organic solvent was η-hexaneacetone mixture (1 : 1, v/v). Using ASE, the average recoveries of five PCDD s ranged from 90 to 103%. SFE, USE, and ASE were faster and less laborious than Soxhlet extraction. The former three methods required less solvent than Soxhlet extraction. SFE required no concentration of the solvent extracts. SFE and ASE failed to perform simultaneous parallel extractions because of instrumental limitations

Age-related differences in stress responsiveness of the hypothalamic-pituitary-adrenal axis of nonhuman primates with various types of adaptive behavior.

Science.gov (United States)

Goncharova, Nadezhda D; Oganyan, Tamara E

2018-03-01

Aging is characterized by disturbances in the functioning of the hypothalamic-pituitary-adrenal (HPA) axis, associated with disturbances in the adaptation processes and increase of the probability of the onset of post-stress syndrome. However, the individual features of age-related disorders stress reactivity of HPA axis have not been studied. The purpose was to study individual characteristics of the HPA axis responsiveness to acute psycho-emotional stress exposure (restraint, ASE) at different age periods on the model of the young adult and old physically healthy female rhesus monkeys that differ in their behavioral responses to stress, i.e., with depression-like and anxiety-like behavior (DAB) on the one hand and healthy standard (control) adaptive behavior (SB) on the other hand. No significant intergroup differences were observed in HPA axis responses to ASE in young animals. During aging the monkeys with SB showed reduced ACTH response to the ASE, whereas the monkeys with DAB demonstrated its increase. The old animals with DAB in response to ASE demonstrated the most pronounced HPA axis disorders, such as the highest levels of corticotrophin (ACTH), the lowest levels of dehydroepiandrosterone sulfate (DHEAS), reduced cortisol (F) levels and the highest values of the F/DHEAS molar ratio. The ratio F/DHEAS positively correlates with the malondialdehyde concentration in erythrocytes that is considered as the biomarker of oxidative stress. Thus, these data allow us to consider the old monkeys with DAB as individuals with higher vulnerability to the adverse effects of ASE. In addition, depression-like and anxiety-like behavior of aged primates under mild/moderate stress along with reduced DHEAS plasma concentration and increased values of F/DHEAS ratio can be used to identify individuals with increased vulnerability to ASE and accelerated aging. Copyright © 2017 Elsevier Inc. All rights reserved.

The Achieving Success Everyday Group Counseling Model: Implications for Professional School Counselors

Science.gov (United States)

Steen, Sam; Henfield, Malik S.; Booker, Beverly

2014-01-01

This article presents the Achieving Success Everyday (ASE) group counseling model, which is designed to help school counselors integrate students' academic and personal-social development into their group work. We first describe this group model in detail and then offer one case example of a middle school counselor using the ASE model to conduct a…

Highly integrated Pluto payload system (HIPPS): a sciencecraft instrument for the Pluto mission

Science.gov (United States)

Stern, S. Alan; Slater, David C.; Gibson, William; Reitsema, Harold J.; Delamere, W. Alan; Jennings, Donald E.; Reuter, D. C.; Clarke, John T.; Porco, Carolyn C.; Shoemaker, Eugene M.; Spencer, John R.

1995-09-01

We describe the design concept for the highly integrated Pluto payload system (HIPPS): a highly integrated, low-cost, light-weight, low-power instrument payload designed to fly aboard the proposed NASA Pluto flyby spacecraft destined for the Pluto/Charon system. The HIPPS payload is designed to accomplish all of the Pluto flyby prime (IA) science objectives, except radio science, set forth by NASA's Outer Planets Science Working Group (OPSWG) and the Pluto Express Science Definition Team (SDT). HIPPS contains a complement of three instrument components within one common infrastructure; these are: (1) a visible/near UV CCD imaging camera; (2) an infrared spectrograph; and (3) an ultraviolet spectrograph. A detailed description of each instrument is presented along with how they will meet the IA science requirements.

Triphenylamine based benzimidazole and benzothiazole: Synthesis and applications in fluorescent chemosensors and laser dyes

Energy Technology Data Exchange (ETDEWEB)

Yang, Yang [State Key Laboratory of Luminescence and Applications, Changchun Institute of Optics Fine Mechanics and Physics, Chinese Academy of Sciences, Changchun 130033 (China); University of Chinese Academy of Sciences, Beijing 100039 (China); Li, Bin, E-mail: libinteacher@163.com [State Key Laboratory of Luminescence and Applications, Changchun Institute of Optics Fine Mechanics and Physics, Chinese Academy of Sciences, Changchun 130033 (China); Zhang, Liming; Guan, Yunlong [State Key Laboratory of Luminescence and Applications, Changchun Institute of Optics Fine Mechanics and Physics, Chinese Academy of Sciences, Changchun 130033 (China)

2014-01-15

Triphenylamine based fluorescent dyes TPA-benzimidazole and TPA-benzothiazole have been designed and synthesized. The TPA-benzimidazole chemosensor was tested for a number of metal ions and found to exhibit binding affinity for Fe{sup 3+} and Hg{sup 2+} in acetonitrile, and the fluorescence quenching was achieved through a PET process. The appearance of an isosbestic point in absorption titrations and Job's plot analysis supported 1:1 stoichiometries for Fe{sup 3+} and Hg{sup 2+} ions. Laser experiments showed that under transversal pumping with a Q-switched Nd:YAG (355 nm) laser in toluene, TPA-benzothiazole exhibits efficient and stable amplified spontaneous emissions (ASE) at 436 nm. -- Highlights: • Triphenylamine based fluorescent dyes TPA-benzimidazole and TPA-benzothiazole have been designed and synthesized. • The TPA-benzimidazole exhibits binding affinity for Fe{sup 3+} and Hg{sup 2+} in acetonitrile and the fluorescence quenching was achieved through a PET process. • Under transversal pumping at 355 nm in toluene, TPA-benzothiazole exhibits efficient and stable amplified spontaneous emissions (ASE) in 436 nm.

Triphenylamine based benzimidazole and benzothiazole: Synthesis and applications in fluorescent chemosensors and laser dyes

International Nuclear Information System (INIS)

Yang, Yang; Li, Bin; Zhang, Liming; Guan, Yunlong

2014-01-01

Triphenylamine based fluorescent dyes TPA-benzimidazole and TPA-benzothiazole have been designed and synthesized. The TPA-benzimidazole chemosensor was tested for a number of metal ions and found to exhibit binding affinity for Fe 3+ and Hg 2+ in acetonitrile, and the fluorescence quenching was achieved through a PET process. The appearance of an isosbestic point in absorption titrations and Job's plot analysis supported 1:1 stoichiometries for Fe 3+ and Hg 2+ ions. Laser experiments showed that under transversal pumping with a Q-switched Nd:YAG (355 nm) laser in toluene, TPA-benzothiazole exhibits efficient and stable amplified spontaneous emissions (ASE) at 436 nm. -- Highlights: • Triphenylamine based fluorescent dyes TPA-benzimidazole and TPA-benzothiazole have been designed and synthesized. • The TPA-benzimidazole exhibits binding affinity for Fe 3+ and Hg 2+ in acetonitrile and the fluorescence quenching was achieved through a PET process. • Under transversal pumping at 355 nm in toluene, TPA-benzothiazole exhibits efficient and stable amplified spontaneous emissions (ASE) in 436 nm

Investigating robustness of interatomic potentials with universal interface

International Nuclear Information System (INIS)

Jelinek, Bohumir; Felicelli, Sergio D; Solanki, Kiran; Peters, John F

2012-01-01

We present a set of Python routines to perform basic tests of classical atomistic potentials and their example applications. These routines are implemented using universal Atomic Simulation Environment (ASE) and LAMMPS molecular dynamics code. ASE is utilized to create atomic configurations, to write input scripts for LAMMPS, and to read results from output files. Evaluated properties are formation energies and volumes of simple point defects (vacancies, substitutions, and interstitials), formation energies of basic surfaces, heats of formation of simple binary compounds, and elastic constants. The flexibility of LAMMPS allows easy switching between different semi-empirical potentials, while the universality of ASE allows to compare results with a variety of electronic structure codes.

Relationships Between Beliefs About Group Work, Motivation, Communication Confidence, and Willingness to Communicate in Group Work

OpenAIRE

Prasasti, Wigati Dyah; Emaliana, Ive; Perdhani, Widya Caterine; Saukah, Ali

2016-01-01

Hubungan antara Keyakinan tentang Kerja Kelompok, Motivasi, Kepercayaan Diri dalamBerkomunikasi, dan Kesediaan Berkomunikasi dalam Kerja Kelompok. Kerja kelompok telahdigunakan dalam ruang kelas Bahasa Inggris sebagai Bahasa Asing (EFL) untuk mengembangkan kompetensikomunikasi siswa dalam bahasa Inggris karena pergeseran orientasi dari pembelajaran tradisionalmenjadi komunikatif. Artikel ini memaparkan hubungan antara empat faktor dalam kerja kelompokdengan menggunakan bahasa asing: keyakinan...

Immobilization of hydrogenase on carbon nanotube polyelectrolytes as heterogeneous catalysts for electrocatalytic interconversion of protons and hydrogen

Energy Technology Data Exchange (ETDEWEB)

Liu, Jiang; Wu, Wen-Jie; Fang, Fang [Fudan University, Department of Chemistry (China); Zorin, Nikolay A. [Russian Academy of Sciences, Institute of Basic Biological Problems (Russian Federation); Chen, Meng; Qian, Dong-Jin, E-mail: djqian@fudan.edu.cn [Fudan University, Department of Chemistry (China)

2016-08-15

Immobilization of active enzymes on the surfaces of electrodes and nanomaterials is important in the fields of bioscience, and biotechnology. In this study, we investigated electrocatalytic properties of the interconversion of protons and hydrogen by means of hydrogenase (H{sub 2}ase)-functionalized carbon nanotube polyelectrolyte composites. Multiwalled carbon nanotube polyelectrolytes (MWNT-PEs) were synthesized through a diazonium and an addition reaction with poly(4-vinylpyridine) (P4VP), followed by another addition reaction with either methyl iodide (CH{sub 3}I) or N-methyl-N′-benzyl bromide bipyridinium (VBenBr) to produce MWNT-P4VPMe or MWNT-P4VPBenV polyelectrolytes, respectively. The MWNT-PE@H{sub 2}ase bio-nanocomposites were then prepared by means of MWNT-PEs as substrates to bind with H{sub 2}ase. The redox current density of the MWNT-PE@H{sub 2}ase-modified electrodes increased with a decrease in pH values of the Ar-saturated electrolyte solution owing to the catalytic reduction of protons (H{sub 2} production); further, it increased with the increasing pH values of the H{sub 2}-saturated solution owing to the catalytic oxidation of hydrogen. The reversible color change between blue-colored and colorless viologen (catalyzed by the MWNT-PE@H{sub 2}ase bio-nanocomposites) suggested that they may be developed as nano-biosensors for molecular H{sub 2}. The as-synthesized bio-nanocomposites showed strong long-term stability and high bioactivity.Graphical Abstract.

Area Green Efficiency (AGE) of Two Tier Heterogeneous Cellular Networks

KAUST Repository

Tabassum, Hina

2012-10-03

Small cell networks are becoming standard part of the future heterogeneous networks. In this paper, we consider a two tier heterogeneous network which promises energy savings by integrating the femto and macro cellular networks and thereby reducing CO2 emissions, operational and capital expenditures (OPEX and CAPEX) whilst enhancing the area spectral efficiency (ASE) of the network. In this context, we define a performance metric which characterize the aggregate energy savings per unit macrocell area and is referred to as area green efficiency (AGE) of the two tier heterogeneous network where the femto base stations are arranged around the edge of the reference macrocell such that the configuration is referred to as femto-on-edge (FOE). The mobile users in macro and femto cellular networks are transmitting with the adaptive power while maintaining the desired link quality such that the energy aware FOE configuration mandates to (i) save energy, and (ii) reduce the co-channel interference. We present a mathematical analysis to incorporate the uplink power control mechanism adopted by the mobile users and calibrate the uplink ASE and AGE of the energy aware FOE configuration. Next, we derive analytical expressions to compute the bounds on the uplink ASE of energy aware FOE configuration and demonstrate that the derived bounds are useful in evaluating the ASE under worst and best case interference scenarios. Simulation results are produced to demonstrate the ASE and AGE improvements in comparison to macro-only and macro-femto configuration with uniformly distributed femtocells.

High temperature solvent extraction of oil shale and bituminous coal using binary solvent mixtures

Energy Technology Data Exchange (ETDEWEB)

Goetz, G.K.E. [Lehrstuhl fuer Geologie, Geochemie und Lagerstaetten des Erdoels und der Kohle, RWTH Aachen (Germany)

1997-12-31

A high volatile bituminous coal from the Saar Basin and an oil shale from the Messel deposit, both Germany, were extracted with binary solvent mixtures using the Advanced Solvent Extraction method (ASE). Extraction temperature and pressure were kept at 100 C, respectively 150 C, and 20,7 MPa. After the heating phase (5 min) static extractions were performed with mixtures (v:v, 1:3) of methanol with toluene, respectively trichloromethane, for further 5 min. Extract yields were the same or on a higher level compared to those from classical soxhlet extractions (3 days) using the same solvents at 60 C. Comparing the results from ASE with those from supercritical fluid extraction (SFE) the extract yields were similar. Increasing the temperature in ASE releases more soluble organic matter from geological samples, because compounds with higher molecular weight and especially more polar substances were solubilized. But also an enhanced extraction efficiency resulted for aliphatic and aromatic hydrocarbons which are used as biomarkers in Organic Geochemistry. Application of thermochemolysis with tetraethylammonium hydroxide (TEAH) using pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS) on the extraction residues shows clearly that at higher extraction temperatures minor amounts of free fatty acids or their methyl esters (original or produced by ASE) were trapped inside the pore systems of the oil shale or the bituminous coal. ASE offers a rapid and very efficient extraction method for geological samples reducing analysis time and costs for solvents. (orig.)

The x-ray time of flight method for investigation of ghosting in amorphous selenium-based flat panel medical x-ray imagers

International Nuclear Information System (INIS)

Rau, A.W.; Bakueva, L.; Rowlands, J.A.

2005-01-01

Amorphous selenium (a-Se) based real-time flat-panel imagers (FPIs) are finding their way into the digital radiology department because they offer the practical advantages of digital x-ray imaging combined with an image quality that equals or outperforms that of conventional systems. The temporal imaging characteristics of FPIs can be affected by ghosting (i.e., radiation-induced changes of sensitivity) when the dose to the detector is high (e.g., portal imaging and mammography) or the images are acquired at a high frame rate (e.g., fluoroscopy). In this paper, the x-ray time-of-flight (TOF) method is introduced as a tool for the investigation of ghosting in a-Se photoconductor layers. The method consists of irradiating layers of a-Se with short x-ray pulses. From the current generated in the a-Se layer, ghosting is quantified and the ghosting parameters (charge carrier generation rate and carrier lifetimes and mobilities) are assessed. The x-ray TOF method is novel in that (1) x-ray sensitivity (S) and ghosting parameters can be measured simultaneously (2) the transport of both holes and electrons can be isolated, and (3) the method is applicable to the practical a-Se layer structure with blocking contacts used in FPIs. The x-ray TOF method was applied to an analysis of ghosting in a-Se photoconductor layers under portal imaging conditions, i.e., 1 mm thick a-Se layers, biased at 5 V/μm, were irradiated using a 6 MV LINAC x-ray beam to a total dose (ghosting dose) of 30 Gy. The initial sensitivity (S 0 ) of the a-Se layers was 63±2 nC cm -2 cGy -1 . It was found that S decreases to 30% of S 0 after a ghosting dose of 5 Gy and to 21% after 30 Gy at which point no further change in S occurs. At an x-ray intensity of 22 Gy/s (instantaneous dose rate during a LINAC x-ray pulse), the charge carrier generation rate was 1.25±0.1x10 22 ehp m -3 s -1 and, to a first approximation, independent of the ghosting dose. However, both hole and electron transport showed a

Effect of burst and recombination models for Monte Carlo transport of interacting carriers in a-Se x-ray detectors on Swank noise

Energy Technology Data Exchange (ETDEWEB)

Fang, Yuan, E-mail: yuan.fang@fda.hhs.gov [Division of Imaging and Applied Mathematics, Office of Science and Engineering Laboratories, Center for Devices and Radiological Health, U.S. Food and Drug Administration, 10903 New Hampshire Avenue, Silver Spring, Maryland 20993-0002 and Department of Electrical and Computer Engineering, The University of Waterloo, Waterloo, Ontario N2L 3G1 (Canada); Karim, Karim S. [Department of Electrical and Computer Engineering, University of Waterloo, Waterloo, Ontario N2L 3G1 (Canada); Badano, Aldo [Division of Imaging and Applied Mathematics, Office of Science and Engineering Laboratories, Center for Devices and Radiological Health, U.S. Food and Drug Administration, 10903 New Hampshire Avenue, Silver Spring, Maryland 20993-0002 (United States)

2014-01-15

Purpose: The authors describe the modification to a previously developed Monte Carlo model of semiconductor direct x-ray detector required for studying the effect of burst and recombination algorithms on detector performance. This work provides insight into the effect of different charge generation models for a-Se detectors on Swank noise and recombination fraction. Methods: The proposed burst and recombination models are implemented in the Monte Carlo simulation package, ARTEMIS, developed byFang et al. [“Spatiotemporal Monte Carlo transport methods in x-ray semiconductor detectors: Application to pulse-height spectroscopy in a-Se,” Med. Phys. 39(1), 308–319 (2012)]. The burst model generates a cloud of electron-hole pairs based on electron velocity, energy deposition, and material parameters distributed within a spherical uniform volume (SUV) or on a spherical surface area (SSA). A simple first-hit (FH) and a more detailed but computationally expensive nearest-neighbor (NN) recombination algorithms are also described and compared. Results: Simulated recombination fractions for a single electron-hole pair show good agreement with Onsager model for a wide range of electric field, thermalization distance, and temperature. The recombination fraction and Swank noise exhibit a dependence on the burst model for generation of many electron-hole pairs from a single x ray. The Swank noise decreased for the SSA compared to the SUV model at 4 V/μm, while the recombination fraction decreased for SSA compared to the SUV model at 30 V/μm. The NN and FH recombination results were comparable. Conclusions: Results obtained with the ARTEMIS Monte Carlo transport model incorporating drift and diffusion are validated with the Onsager model for a single electron-hole pair as a function of electric field, thermalization distance, and temperature. For x-ray interactions, the authors demonstrate that the choice of burst model can affect the simulation results for the generation

Achados fonoaudiológicos na hanseníase: considerações teóricas Speech-language findings on Hansen's disease: theoretical considerations

Directory of Open Access Journals (Sweden)

Victor Gandra Quintas

2009-01-01

Full Text Available A hanseníase é uma doença que tem altos níveis de incidência no Brasil. De origem bacteriana crônica, com alta infectividade e baixa patogenicidade, tem como hospedeiro primário o homem e como agente etiológico o Mycobacterium leprae. O bacilo de Hansen, como também é conhecido o agente, se acumula principalmente na pele, nos nervos periféricos e pares cranianos, levando a diversas lesões cutâneas, também à perda da condução neural e, consequentemente, a severas alterações anatômicas e funcionais nas extremidades do corpo, como membros e região orofacial. De acordo com estas premissas, foi realizada uma revisão da literatura com intuito de mostrar a fisiopatologia da doença e sua classificação de acordo com as suas manifestações. Desta forma, a literatura, por intermédio de alguns estudos, mostrou que esta doença pode provocar alterações que comprometem significativamente a voz, a audição, os órgãos fonoarticulatórios e as funções estomatognáticas, tornando-se assim, de grande relevância à Fonoaudiologia.Hansen's disease is a malady that has high incidence levels in Brazil. It has a chronic bacterial origin, with high infectivity and low pathogenicity, having the man as its primary host, and the Mycobacterium leprae as its etiological agent. The Hansen's bacillus, as it is known, accumulates mainly in the skin, the peripheral nerves and the cranial nerves pairs, causing many skin lesions, as well as loss of neural conduction and, consequently, severe anatomical and functional changes in the ends of the body, such as members and the orofacial region. Based on these premisses, it was carried out a literature review in order to show the pathophysiology of the disease and its classification according to its manifestations. The literature review showed, through some studies, that the disease might cause alterations that significantly compromise the voice, the hearing, the phonoarticulatory organs, and the

Effect of burst and recombination models for Monte Carlo transport of interacting carriers in a-Se x-ray detectors on Swank noise

International Nuclear Information System (INIS)

Fang, Yuan; Karim, Karim S.; Badano, Aldo

2014-01-01

Purpose: The authors describe the modification to a previously developed Monte Carlo model of semiconductor direct x-ray detector required for studying the effect of burst and recombination algorithms on detector performance. This work provides insight into the effect of different charge generation models for a-Se detectors on Swank noise and recombination fraction. Methods: The proposed burst and recombination models are implemented in the Monte Carlo simulation package, ARTEMIS, developed byFang et al. [“Spatiotemporal Monte Carlo transport methods in x-ray semiconductor detectors: Application to pulse-height spectroscopy in a-Se,” Med. Phys. 39(1), 308–319 (2012)]. The burst model generates a cloud of electron-hole pairs based on electron velocity, energy deposition, and material parameters distributed within a spherical uniform volume (SUV) or on a spherical surface area (SSA). A simple first-hit (FH) and a more detailed but computationally expensive nearest-neighbor (NN) recombination algorithms are also described and compared. Results: Simulated recombination fractions for a single electron-hole pair show good agreement with Onsager model for a wide range of electric field, thermalization distance, and temperature. The recombination fraction and Swank noise exhibit a dependence on the burst model for generation of many electron-hole pairs from a single x ray. The Swank noise decreased for the SSA compared to the SUV model at 4 V/μm, while the recombination fraction decreased for SSA compared to the SUV model at 30 V/μm. The NN and FH recombination results were comparable. Conclusions: Results obtained with the ARTEMIS Monte Carlo transport model incorporating drift and diffusion are validated with the Onsager model for a single electron-hole pair as a function of electric field, thermalization distance, and temperature. For x-ray interactions, the authors demonstrate that the choice of burst model can affect the simulation results for the generation

Assistência de enfermagem ao portador de Hanseníase: abordagem transcultural Asistencia de enfermería al portador de Lepra: abordaje transcultural Nursing assistance to a Leprosy-infected patient: transcultural approach

Directory of Open Access Journals (Sweden)

Fernando José Guedes da Silva Júnior

2008-11-01

Full Text Available Trata-se de um estudo de caso, desenvolvido em um Centro de Saúde em Teresina - PI, que abordou a problemática da assistência de enfermagem prestada a uma paciente com Hanseníase Multibacilar, enfocando o cuidado de Enfermagem Transcultural, Diagnósticos e Intervenções de Enfermagem segundo a Taxonomia II da NANDA. Realizou-se a entrevista semi-estruturada e observação participante, que possibilitaram a coleta dos dados, os quais foram tratados baseados nos padrões normativos, valores e prática diárias, modos de cuidado popular e cuidados requeridos no sistema profissional. Neste estudo, constatou-se que o planejamento da assistência de enfermagem visou, principalmente, contribuir para a adesão ao tratamento da doença, diminuindo os riscos potenciais e utilizando a preservação, negociação e re-padronização do sistema profissional. Observou-se também a adesão ao tratamento e a realização de autocuidado voltado para a hanseníase de forma culturalmente satisfatória.Es un estudio de caso, desarrollado en un centro de salud en Teresina-PI, que abordó la problemática de la asistencia de enfermería dada a una paciente con lepra multibacilar, enfocando el cuidado de Enfermería Transcultural, Diagnósticos, e Intervenciones de Enfermería segundo la Taxonomía II de NANDA. Se realizó una entrevista semi-estructurada y observación participante, que posibilitaron la colecta de los datos, los cuales fueron tratados basados em los padrones normativos, valores y prácticas diárias, modos de cuidado popular y cuidados requeridos en el sistema profesional. En este estudio, se constató que el planeamiento de la asistencia de enfermería objetivó, principalmente, contribuir para la adhesión al tratamiento de la enfermidad, disminuyendo los riscos potenciales y utilizando la preservación, negociación y repradonización del sistema profesional. Se observó también la adhesión al tratamiento y la realización del auto cuidado

Time-dependent Bloch-Maxwell modelling of 1 mJ, 200 fs seeded soft x-ray laser

International Nuclear Information System (INIS)

Zeitoun, Ph.; Oliva, E.; Fajardo, M.; Velarde, P.; Ros, D.; Sebban, S.

2010-01-01

Complete text of publication follows. Seeding of high harmonic generation in a soft x-ray plasma amplifier has been first proposed and tested by T. Ditmire and collaborators. The experiment demonstrated low amplification (*2), with a very strong background coming from the soft x-ray laser ASE. Later seeding experiments reached very high amplification factors (up to 600) in both gas (Ph. Zeitoun et al.) and solid amplifiers (Wang et at.). Surprisingly, solid amplifiers extracted less energy (90 nJ) than gas amplifier (∼ 1 μJ) with equivalent pump energy. We recently demonstrated that 50-100 μJ is achievable with adequate plasma tailoring. However, this energy is still low as compared to the 10 mJ per pulse demonstrated on the ASE soft x-ray laser running at PALS facility (Czech Republic). In order to model the seeding process of PALS soft x-ray laser, we developed a time-dependent Bloch-Maxwell model that solves coherently the pumping, amplification and saturation processes. We demonstrated that direct seeding, with femtosecond pulse, a soft x-ray plasma amplifier having gain duration of several 100s of picosecond cannot extract the stored energy keeping the output beam energy in the 100 μJ range. We proposed and fully modelled a new seeding scheme that allows to achieve 10 mJ, 200 fs soft x-ray laser.

Hanseníase virchowiana associada ao uso de inibidor do fator de necrose tumoral α: relato de caso Lepromatous leprosy associated with the use of anti-TNF α therapy: case report

Directory of Open Access Journals (Sweden)

Daniele S Freitas

2010-06-01

Full Text Available A terapia anti-TNFα tem sido amplamente utilizada em diversas artropatias inflamatórias crônicas, em especial artrite reumatoide (AR. No entanto, há preocupações quanto à segurança e ao risco de doenças infecciosas nos pacientes. O objetivo deste artigo é descrever um caso de hanseníase, forma virchowiana, em paciente com AR em uso de terapia anti-TNFα. Dessa forma, a vigilância dos eventos adversos deve ser rigorosa, especialmente no que diz respeito às doenças infecciosas. É recomendada investigação apropriada de lesões cutâneas em paciente recebendo terapia anti-TNFα, visto que o quadro clínico inicial pode ser inespecífico, especialmente em regiões endêmicas como o Brasil.TNF blockers have been used in the treatment of several types of chronic inflammatory arthritis, especially rheumatoid arthritis. However, many doubts regarding the safety and high risk of infectious diseases in these patients remain. The main objective of this report was to present a case of lepromatous leprosy in a rheumatoid arthritis patient using TNF blockers. The development of adverse events should be rigorously observed, especially those related to infectious agents. Thus, appropriate investigation of skin lesions in patients receiving anti-TNFa therapy is recommended, as the initial clinical manifestation may be unusual, particularly in endemic regions in Brazil.

Antioxidant activity of extracts from Acanthopanax senticosus | Park ...

African Journals Online (AJOL)

In addition, the effect of ASE on DNA damage induced by H2O2 in human lymphocytes was also evaluated by Comet assay. The ASE showed strong inhibitory effect as its concentration increased from 0.125 to 1% by 65 to 81% against DNA damage induced by 200 M of H2O2. These results suggest that water extract of ...

DAYA JUANG MAHASISWA ASING

OpenAIRE

Wiwit Salindri Kusuma Wardani; Satih Saidiyah

2016-01-01

This research aims to describe  adversity quotient and its supporting factor among foreign students. Subjects are students from Thailand studying at  State Islamic University Sunan Kalijaga Yogyakarta. This research applied qualitative approach using phenomenology in order to  obtain the meaning of adversity quotient. The result shows some themes which are (1) controlling the problems by following many organizations, association, and remembering the struggles of parents, (2) being responsible...

Sistem Informasi Mahasiswa Asing

Directory of Open Access Journals (Sweden)

Hari Robiansyah

2017-03-01

Full Text Available Abstract—A residence permit is permission given to foreigners by Immigration Officials or foreign-service officer to be in the region of Indonesia in a certain period of time. Foreign students studying in Indonesia must have a residence permit in order to continue learning in Indonesia. Residence permit have a time limit and must always be extended before it expires (overstayed. Foreign student information system and a reminder of this residence permit are systems built to help foreign students of UIN Maulana Malik Ibrahim Malang in reminding the residence permit problems. This research uses Agile Development with Scrum model in development. GNU All Mobile Management Utilities (GAMMU is used for sending SMS (Short Message Service, and Cron program is used for running SMS commands automatically each day. The results of this research are the foreign student information system and reminder that automatically provide reminder in the form of SMS to foreign students whose the validity period of residence permit will run out.

Acute cigarette smoke exposure increases alveolar permeability in rabbits

International Nuclear Information System (INIS)

Witten, M.L.; Lemen, R.J.; Quan, S.F.; Sobonya, R.E.; Roseberry, H.; Stevenson, J.L.; Clayton, J.

1985-01-01

The authors measured lung clearance of aerosolized technetium-labeled diethylenetriamine pentaacetic acid (/sup 99m/TcDTPA) as an index of alveolar epithelial permeability in rabbits exposed to cigarette smoke. Eighteen rabbits were randomly assigned to 3 equal-size groups: control, all smoke exposure (ASE), and limited smoke exposure (LSE). Cigarette or sham smoke was delivered by syringe in a series of 5, 10, 20, and 30 tidal volume breaths with a 20-min counting period between each subset of breaths to determine /sup 99m/TcDTPA biologic half-life (T 1 / 2 ). Mean T 1 / 2 minimum was significantly lower for ASE and LSE rabbits than by control rabbits. They observed a significant difference at 20 and 30 breath exposures between the control and ASE group mean values for T 1 / 2 , arterial blood pressure, and peak airway pressure. A combination of light and electron microscopy showed focal alveolar edema and hemorrhage in the ASE and LSE groups but no alveolar-capillary membrane damage. In summary, acute cigarette smoke exposure increases alveolar permeability as measured by /sup 99m/TcDTPA clearance, but there was no detectable ultrastructural alteration of the alveolar-capillary membrane

Hepatoprotective activity of Amaranthus spinosus in experimental animals.

Science.gov (United States)

Zeashan, Hussain; Amresh, G; Singh, Satyawan; Rao, Chandana Venkateswara

2008-11-01

The hepatoprotective and antioxidant activity of 50% ethanolic extract of whole plant of Amaranthus spinosus (ASE) was evaluated against carbon tetrachloride (CCl4) induced hepatic damage in rats. The ASE at dose of 100, 200 and 400 mg/kg were administered orally once daily for fourteen days. The substantially elevated serum enzymatic levels of serum glutamate oxaloacetate transaminase (AST), serum glutamate pyruvate transaminase (ALT), serum alkaline phosphatase (SALP) and total bilirubin were restored towards normalization significantly by the ASE in a dose dependent manner. Higher dose exhibited significant hepatoprotective activity against carbon tetrachloride induced hepatotoxicity in rats. The biochemical observations were supplemented with histopathological examination of rat liver sections. Meanwhile, in vivo antioxidant activities as malondialdehyde (MDA), hydroperoxides, reduced glutathione (GSH), superoxide dismutase (SOD) and catalase (CAT) were also screened which were also found significantly positive in a dose dependent manner. The results of this study strongly indicate that whole plants of A. spinosus have potent hepatoprotective activity against carbon tetrachloride induced hepatic damage in experimental animals. This study suggests that possible mechanism of this activity may be due to the presence of flavonoids and phenolics compound in the ASE which may be responsible to hepatoprotective activity.

Gain optimization method of a DQW superluminescent diode with broad multi-state emission

KAUST Repository

Dimas, Clara E.

2010-01-01

Optimizing gain through systematic methods of varying current injection schemes analytically is significant to maximize experimentally device yield and evaluation. Various techniques are used to calculate the amplified spontaneous emission (ASE) gain for light emitting devices consisting of single-section and multiple-sections of even length. Recently double quantum well (DQW) superluminescent diodes (SLD) have shown a broad multi-state emission due to mutlielectrodes of non-equal lengths and at high non-equal current densities. In this study, we adopt an improved method utilizing an ASE intensity ratio to calibrate a gain curve based on the sum of the measured ASE spectra to efficiently estimate the gain. Although the laser gain for GaAs/AlGaAs material is well studied, the ASE gain of SLD devices has not been systematically studied particular to further explain the multiple-state emission observed in fabricated devices. In addition a unique gain estimate was achieved where the excited state gain clamps prior to the ground state due to approaching saturation levels. In our results, high current densities in long sectioned active regions achieved sufficient un-truncated gain that show evidence of excited state emission has been observed.

Coledocoduodenostomia laparoscópica

Directory of Open Access Journals (Sweden)

Marco Antônio Cezário de Melo

Full Text Available OBJETIVO: Estudar, a curto e médio prazos, o resultado e complicações da coledocoduodenostomia (CDD realizada por via laparoscópica. MÉTODO: Estudo prospectivo de 20 pacientes com indicação de coledocoduodenostomia vídeo-laparoscópica operados na DIGEST no período de 1991 a 2003. RESULTADOS: Dos 20 pacientes com indicação para CDD laparoscópica, quatro tinham coledocolitíase associada à litíase vesicular, oito litíase residual de colédoco, dois estenose benigna e seis tumor periampolar. Houve duas conversões para ressecção de colédoco. Dentre as 18 CDD, todos tinham via biliar acima de 1,5 cm de diâmetro. Foi observado vazamento biliar pelo dreno cavitário em quatro casos (duração máxima de quatro dias resolvidos espontaneamente, uma infecção de ferida e uma morte súbita no 2º. dia de pós-operatório. Os seis portadores de tumor periampolar tiveram sobrevida média de 7,2 meses evoluindo sem prurido ou icterícia até o óbito. CONCLUSÕES: Além da demonstração da viabilidade do método laparoscópico na realização da CDD, evidenciou-se que o posicionamento de trocarte adicional facilita a confecção da anastomose. Acredita-se que, a ocorrência de vazamento da anastomose possa diminuir com a experiência e que a CDD seja alternativa interessante na paliação dos tumores periampolares.

[Histochemical and histoenzymatic study of experimental endarteritis in rabbits. I. Femoral endarteritis].

Science.gov (United States)

Abou-Haila, A; Hadjiisky, P; Roland, J; Orcel, L

1978-04-01

The parietal reaction after placing a cuff of polyethylene around the femoral artery has been studied in 18 (2,5 - 3 months old) male rabbits by using histologic, histochemical (4 macromolecular substances) and histoenzymatic techniques (16 enzymatic activities). Studies were performed on the 1st, 3rd, 5th, 15th and 21st day, and every 15 days during the 3 months of the experiment. This process induced rapidly in each animal a parietal reaction with adventitial oedema (1st day), hypoxia of the media (1st -5th day), cytoenzymatic activation followed by a cellular transformation and proliferation of the intima-media, that forms a diffuse intimal thickening (adaptation). Most cells of the thickening were, by their enzymatic activities, quite comparable to immature smooth muscle cells, which probably emigrated from the media: intense LDH, NADH2 - TR; moderate G6P-DH, SDH, NADPH2 - TR, alpha-GP-DH, ATP/ase; weak ICHD, beta-HB-DH. Moreover, some reactions (accentuation of beta-Glu/ase, UDGP-DH, Glu-DH, 5'N/ase) besides suggested the active participation of the cells in the production of extracellular conjonctive constituents, because the histochemical studies revealed the presence of metachromatic glycosamino-glycanes and positive APS substances during the edification of the diffuse intimal thickening. In advanced thickening, an histoenzymatic duality was observed, that might prove the double origin of the thickening cells: some superficial cells had the enzymatic characteristics of endothelial cells (increased activity of aerobic oxydoreductases). At every stage of the study, the thickening cells differed from the atherocytes by a lack of lipids in their cytoplasm.

DeNASA: Destination-Naive AS-Awareness in Anonymous Communications

Directory of Open Access Journals (Sweden)

Barton Armon

2016-10-01

Full Text Available Prior approaches to AS-aware path selection in Tor do not consider node bandwidth or the other characteristics that Tor uses to ensure load balancing and quality of service. Further, since the AS path from the client’s exit to her destination can only be inferred once the destination is known, the prior approaches may have problems constructing circuits in advance, which is important for Tor performance. In this paper, we propose and evaluate DeNASA, a new approach to AS-aware path selection that is destination-naive, in that it does not need to know the client’s destination to pick paths, and that takes advantage of Tor’s circuit selection algorithm. To this end, we first identify the most probable ASes to be traversed by Tor streams. We call this set of ASes the Suspect AS list and find that it consists of eight highest ranking Tier 1 ASes. Then, we test the accuracy of Qiu and Gao AS-level path inference on identifying the presence of these ASes in the path, and we show that inference accuracy is 90%. We develop an AS-aware algorithm called DeNASA that uses Qiu and Gao inference to avoid Suspect ASes. DeNASA reduces Tor stream vulnerability by 74%. We also show that DeNASA has performance similar to Tor. Due to the destination-naive property, time to first byte (TTFB is close to Tor’s, and due to leveraging Tor’s bandwidth-weighted relay selection, time to last byte (TTLB is also similar to Tor’s.

An asteroseismology explorer

International Nuclear Information System (INIS)

Brown, T.M.; Cox, A.N.

1987-01-01

In response to a NASA opportunity, a proposal has been made to study the concept of an Asteroseismology Explorer (ASE). The goal of the ASE would be to measure solar-like oscillations on many (perhaps hundreds) of stars during a 1-year mission, including many members of open clusters. In this paper, the authors describe this proposal's observational goals, a strawman technical approach, and likely scientific rewards

Accelerated Solvent Extraction: An Innovative Sample Extraction Technique for Natural Products

International Nuclear Information System (INIS)

Hazlina Ahmad Hassali; Azfar Hanif Abd Aziz; Rosniza Razali

2015-01-01

Accelerated solvent extraction (ASE) is one of the novel techniques that have been developed for the extraction of phytochemicals from plants in order to shorten the extraction time, decrease the solvent consumption, increase the extraction yield and enhance the quality of extracts. This technique combines elevated temperatures and pressure with liquid solvents. This paper gives a brief overview of accelerated solvent extraction technique for sample preparation and its application to the extraction of natural products. Through practical examples, the effects of operational parameters such as temperature, volume of solvent used, extraction time and extraction yields on the performance of ASE are discussed. It is demonstrated that ASE technique allows reduced solvent consumption and shorter extraction time, while the extraction yields are even higher than those obtained with conventional methods. (author)

Highly pH-responsive sensor based on amplified spontaneous emission coupled to colorimetry.

Science.gov (United States)

Zhang, Qi; Castro Smirnov, Jose R; Xia, Ruidong; Pedrosa, Jose M; Rodriguez, Isabel; Cabanillas-Gonzalez, Juan; Huang, Wei

2017-04-07

We demonstrated a simple, directly-readable approach for high resolution pH sensing. The method was based on sharp changes in Amplified Spontaneous Emission (ASE) of a Stilbene 420 (ST) laser dye triggered by the pH-dependent absorption of Bromocresol Green (BG). The ASE threshold of BG:ST solution mixtures exhibited a strong dependence on BG absorption, which was drastically changed by the variations of the pH of BG solution. As a result, ASE on-off or off-on was observed with different pH levels achieved by ammonia doping. By changing the concentration of the BG solution and the BG:ST blend ratio, this approach allowed to detect pH changes with a sensitivity down to 0.05 in the 10-11 pH range.

CLINICAL-PATHOGENIC IMPORTANCE OF CORRELATION BETWEEN HISTOCHEMICAL INDICES OF BLOOD SYSTEM AND RHEUMATOID FACTOR IN PATIENTS WITH RHEUMATOID ARTHRITIS

Directory of Open Access Journals (Sweden)

A B Zborovsky

2001-01-01

Full Text Available Summary Relation between rheumatoid factor (RF and levels of Myeloperoxidase (MPO, Na*-K +-A TPh- ase (ATPh-ase, 5'-Nucleotidase (5 ’-NT, Succinate dehydrogenase (SDG in cells of peripheral blood of rheumatoid arthritis (RA patients was investigated. 83 RA patients were observed. The activities of MPO, ATP-ase, 5’NT, SDG in blood cells were determined by hystochemical methods. In patients having increasing MPO activity in monocytes, normal level of SDG in lymphocytes and decreasing of 5'NT in monocytes and lymphocytes increasing of RF level was noted in 3 weeks after hystochemical changes (p<0.05. Determination of MPO in monocytes was the most informative test for forecasting of immunological changes in RA. The role of macrophage system in RA is discussed.

Pressure-induced crystallization and phase transformation of amorphous selenium: Raman spectroscopy and x-ray diffraction studies

International Nuclear Information System (INIS)

Yang Kaifeng; Cui Qiliang; Hou Yuanyuan; Liu Bingbing; Zhou Qiang; Hu Jingzhu; Mao, H-K; Zou Guangtian

2007-01-01

High-pressure Raman spectroscopy studies have been carried out on amorphous Se (a-Se) at room temperature in a diamond anvil cell with an 830 nm exciting line. Raman evidence for the pressure-induced crystallization of a-Se and the coexistence of the unknown high-pressure phase with the hexagonal phase is presented for the first time. Further experimental proof of high-pressure angle-dispersive x-ray diffraction studies for a-Se indicates that the unknown high-pressure phase is also a mixture phase of the tetragonal I4 1 /acd and Se IV structure. Our Raman and x-ray diffraction results suggest that hexagonal Se I undergoes a direct transition to triclinic Se III at about 19 GPa, which is in good agreement with the theoretical prediction

The atomic simulation environment-a Python library for working with atoms.

Science.gov (United States)

Hjorth Larsen, Ask; Jørgen Mortensen, Jens; Blomqvist, Jakob; Castelli, Ivano E; Christensen, Rune; Dułak, Marcin; Friis, Jesper; Groves, Michael N; Hammer, Bjørk; Hargus, Cory; Hermes, Eric D; Jennings, Paul C; Bjerre Jensen, Peter; Kermode, James; Kitchin, John R; Leonhard Kolsbjerg, Esben; Kubal, Joseph; Kaasbjerg, Kristen; Lysgaard, Steen; Bergmann Maronsson, Jón; Maxson, Tristan; Olsen, Thomas; Pastewka, Lars; Peterson, Andrew; Rostgaard, Carsten; Schiøtz, Jakob; Schütt, Ole; Strange, Mikkel; Thygesen, Kristian S; Vegge, Tejs; Vilhelmsen, Lasse; Walter, Michael; Zeng, Zhenhua; Jacobsen, Karsten W

2017-07-12

The atomic simulation environment (ASE) is a software package written in the Python programming language with the aim of setting up, steering, and analyzing atomistic simulations. In ASE, tasks are fully scripted in Python. The powerful syntax of Python combined with the NumPy array library make it possible to perform very complex simulation tasks. For example, a sequence of calculations may be performed with the use of a simple 'for-loop' construction. Calculations of energy, forces, stresses and other quantities are performed through interfaces to many external electronic structure codes or force fields using a uniform interface. On top of this calculator interface, ASE provides modules for performing many standard simulation tasks such as structure optimization, molecular dynamics, handling of constraints and performing nudged elastic band calculations.

Epidemiological survey of the taeniasis/cysticercosis complex in cattle farms in Viçosa County, Minas Gerais, Brazil Inquérito epidemiológico sobre o complexo teníase-cisticercose bovina no município de Viçosa, Minas Gerais

Directory of Open Access Journals (Sweden)

Tatiane O. Santos

2013-04-01

Full Text Available Despite the importance of human taeniasis/bovine cysticercosis for public and animal health and the economy, its actual epidemiological status in Brazil is not well-studied. We sought to assess the epidemiological profile of this zoonosis in the rural area of Viçosa County, Minas Gerais, Brazil. The prevalence of bovine cysticercosis was 0.42%, whereas no case of human taeniasis was diagnosed. Factors favoring the persistence of zoonosis were identified. These included the supply of untreated water to animals, animals raised for slaughter without sanitary supervision, poor mechanization of raising techniques, and the use of untreated water for human consumption. Bovine meat for human consumption acquired in the city or from the farm itself was characterized as a risk factor for bovine cysticercosis (Odds Ratio (OR =16.77; pApesar da importância do complexo teníase-cisticercose bovina para a saúde pública, animal e para a economia, a realidade epidemiológica da ocorrência dessas zoonoses no Brasil é pouco conhecida. Este estudo foi realizado com o objetivo de avaliar o perfil epidemiológico desta zoonose na zona rural do município de Viçosa, MG. A prevalência encontrada de cisticercose bovina foi de 0,42%, e nenhum caso de teníase humana foi diagnosticado. Foi verificada presença de fatores favoráveis a manutenção dessa zoonose, como fornecimento de água sem tratar aos animais, criação de animais destinados ao abate sem inspeção sanitária, criação de bovinos com baixa adoção de tecnologia, e utilização de água sem tratamento. O consumo de carne bovina oriunda da propriedade e da cidade foi caracterizado como variável de risco (OR=16,77; p<0,05 para a cisticercose bovina. Apesar disso, as famílias das propriedades pesquisadas possuíam hábitos favoráveis como medida de controle para o desenvolvimento desta parasitose, como a quase ausência de esgoto a céu aberto e a ingestão de carne bovina bem passada. A

Noise filtering in a multi-channel system using a tunable liquid crystal photonic bandgap fiber

DEFF Research Database (Denmark)

Petersen, Martin Nordal; Scolari, Lara; Tokle, Torger

2008-01-01

This paper reports on the first application of a liquid crystal infiltrated photonic bandgap fiber used as a tunable filter in an optical transmission system. The device allows low-cost amplified spontaneous emission (ASE) noise filtering and gain equalization with low insertion loss and broad...... tunability. System experiments show that the use of this filter increases for times the distance over which the optical signal-to-noise ratio (OSNR) is sufficient for error-free transmission with respect to the case in which no filtering is used....

Novel Nonlinear Laser Diagnostic Techniques

Science.gov (United States)

1993-07-01

a thermometric probe of reactive flows. Since the two-photon pump laser couples a Doppler broadened ground state velocity distribution to the excited...rism, and passed unfocused into an aluminum cell con- in frequency space. Regions for line fitting are found by taining 99% pure NO. The gas mixture...of ASE as a More recently, ASE has prompted interest as an thermometric probe of combustion environments optical diagnostic of combustion environments

Investigation of a Pulsed 1550 nm Fiber Laser System (Briefing Charts)

Science.gov (United States)

2016-02-14

Pump dump and splice Pump dump and splice MFA 976 nm 15 W TFB TFB Pump dump and splice Waveform shaping Delay Power meter...filter 976 nm 7.6 W TFB WDM Pump dump and splice Pump dump and splice MFA 976 nm 15 W TFB TFB Pump dump and splice Waveform shaping...Multimode fiber to OSA or photodiode EOM EOM ASE filter ASE filter 976 nm 7.6 W TFB

On the performance of multiuser scheduling with post-examining under non-identical fading

KAUST Repository

Gaaloul, Fakhreddine

2012-06-11

We investigate the performance of a multiuser downlink access scheme based on a post-selection switch and examine algorithm. The studied scheme sequentially switches over the users that experience independent and non-identically distributed fading conditions, and selects a single user with an acceptable channel quality as compared to a pre-selected signal-to-noise ratio (SNR) threshold. If no one of the users can satisfy the target channel quality, the base station (BS) takes the advantage of the knowledge of all users channels and serves the user with the best channel quality among all users. This scheme reduces considerably the feedback load but offers a lower average spectral efficiency (ASE) as compared to that of the full feedback system with instantaneous best user selection. On the other hand, it improves the system performances, such as outage probability and average bit error rate (BER), as compared to a system that is based on a standard switching scheme without post-selection. Numerical results for the ASE average BER, and average feed back load, are presented for the cases of outdated and non-outdated rate-adaptive modulation scheme operating over independent and non-identically distributed users.

On the performance of multiuser scheduling with post-examining under non-identical fading

KAUST Repository

Gaaloul, Fakhreddine; Alouini, Mohamed-Slim; Radaydeh, Redha M.; Yang, Hong-Chuan

2012-01-01

We investigate the performance of a multiuser downlink access scheme based on a post-selection switch and examine algorithm. The studied scheme sequentially switches over the users that experience independent and non-identically distributed fading conditions, and selects a single user with an acceptable channel quality as compared to a pre-selected signal-to-noise ratio (SNR) threshold. If no one of the users can satisfy the target channel quality, the base station (BS) takes the advantage of the knowledge of all users channels and serves the user with the best channel quality among all users. This scheme reduces considerably the feedback load but offers a lower average spectral efficiency (ASE) as compared to that of the full feedback system with instantaneous best user selection. On the other hand, it improves the system performances, such as outage probability and average bit error rate (BER), as compared to a system that is based on a standard switching scheme without post-selection. Numerical results for the ASE average BER, and average feed back load, are presented for the cases of outdated and non-outdated rate-adaptive modulation scheme operating over independent and non-identically distributed users.

Basic airway skills acquisition using the American College of Surgeons/Association for Surgical Education medical student simulation-based surgical skills curriculum: Initial results.

Science.gov (United States)

Muratore, Sydne; Kim, Michael; Olasky, Jaisa; Campbell, Andre; Acton, Robert

2017-02-01

The ACS/ASE Medical Student Simulation-Based Skills Curriculum was developed to standardize medical student training. This study aims to evaluate the feasibility and validity of implementing the basic airway curriculum. This single-center, prospective study of medical students participating in the basic airway module from 12/2014-3/2016 consisted of didactics, small-group practice, and testing in a simulated clinical scenario. Proficiency was determined by a checklist of skills (1-15), global score (1-5), and letter grade (NR-needs review, PS-proficient in simulation scenario, CP-proficient in clinical scenario). A proportion of students completed pre/post-test surveys regarding experience, satisfaction, comfort, and self-perceived proficiency. Over 16 months, 240 students were enrolled with 98% deemed proficient in a simulated or clinical scenario. Pre/post-test surveys (n = 126) indicated improvement in self-perceived proficiency by 99% of learners. All students felt moderately to very comfortable performing basic airway skills and 94% had moderate to considerable satisfaction after completing the module. The ACS/ASE Surgical Skills Curriculum is a feasible and effective way to teach medical students basic airway skills using simulation. Copyright © 2016 Elsevier Inc. All rights reserved.

Evaluation of accelerated solvent extraction for butyltin speciation in PACS-2 CRM using double-spike isotope dilution-GC/ICPMS.

Science.gov (United States)

Encinar, Jorge Ruiz; Rodriguez-González, Pablo; Fernandez, Julio Rodriguez; Alonso, J Ignacio Garcia; Díez, Sergi; Bayona, Josep M; Sanz-Medelt, Alfredo

2002-10-15

Pressurized liquid extraction using the accelerated solvent extractor (Dionex ASE 200) has been evaluated for the determination of mono-, di- and tributyltin (MBT, DBT, and TBT, respectively) in PACS-2 certified reference material. A double-enriched spike containing 119Sn-enriched MBT and TBT and 118Sn-enriched DBT allowed for the simultaneous determination of the three butyltin species and the factors governing species interconversion. The stability of the spike was evaluated by reverse isotope dilution experiments covering more than one year with satisfactory results. Quantitative recoveries using ASE for TBT and DBT were obtained at temperatures above 110 degrees C. The effect of the extraction time and number of static cycles was evaluated. Results suggest that extraction efficiency was quantitative with extraction times as low as 10 min for all butyltin species at 110 degrees C. Decomposition reactions were only detected at the higher temperatures assayed (140 and 175 degrees C) and that was only for the degradation of DBT to MBT (approximately 4%). The results found for MBT were approximately 25% higher than the certified value for the PACS-2 sediment reference material in agreement with previous results obtained by ultrasonic and microwave assisted extraction.

Serological studies on shistosomiasis mansoni in the Northeast Brasil Estudo sorológico na esquistosomíase mansônica no nordeste do Brasil

Directory of Open Access Journals (Sweden)

Masanobu Tanabe

1990-04-01

schistosomiasis mansoni in the endemic area of northeast Brazil.Soros de pacientes com esquistosomíase mansônica do Hospital das Clínicas da Universidade Federal de Pernambuco (N = 10, de residentes da cidade do Cabo (PE - 51 casos ovo-positivo e 452 casos ovo-negativo -, de pacientes do Hospital Instituto Materno Infantil de Pernambuco (IMIP (N = 37, de imigrantes japoneses residentes na cidade de Petrolina (PE (N = 127, assim como de japoneses supostamente saudáveis (N = 30 foram examinados sorologicamente através de testes como ELISA; os antígenos utilizados foram preparados a partir de ovos (ELISA-ovo e de vermes adultos de Schistosoma mansoni (ELISA adulto. Em 100% dos soros de indivíduos não infectados residentes em áreas não endêmicas, tanto na ELISA-ovo como na ELISA-adulto os resultados foram negativos. No tocante a reações cruzadas, em 78 soros provenientes de indivíduos portadores de diferentes parasitas intestinais, apenas um apresentou reatividade frente aos antígenos de vermes adultos e ovos. O ELISA-ovo realizado com o soro de 51 indivíduos portadores de ovos de S. mansoni revelou uma alta sensibilidade (98% de casos ovo-positivos; contudo grande número de resultados falso-negativos foi observado em reações como ELISA-adulto, Ouchterlony usando antígeno de verme adulto, reação periovular e intradermoreação. Em casos de jovens portadores de ovos, uma baixa sensibilidade destes testes, exceto para ELISA-ovo, parece ser, em princípio, devido a uma incapacidade de detecção de anticorpos do soro destes pacientes. Parece não existir nenhuma correlação positiva entre os valores dos dois tipos de ELISA (ELISA-ovo e ELISA-adulto dentre os soros isolados de indivíduos com ELISA-positivo. Não obstante, a reação destes soros com antígeno de ovos ou vermes adultos pode ser dividida em dois sub-grupos: em um a reação é mais positiva frente a antígenos de ovos do que frente a antígenos de vermes adultos. Tudo indica que os soros de jovens

Radioisotope electric propulsion of sciencecraft to the outer Solar System and near-interstellar space

International Nuclear Information System (INIS)

Noble, R.J.

1999-01-01

Radioisotopes have been used successfully for more than 25 years to supply the heat for thermoelectric generators on various deep-space probes. Radioisotope electric propulsion (REP) systems have been proposed as low-thrust ion propulsion units based on radioisotope electric generators and ion thrusters. The perceived liability of radioisotope electric generators for ion propulsion is their high mass. Conventional radioisotope thermoelectric generators have a specific mass of about 200 kg/kW of electric power. Many development efforts have been undertaken with the aim of reducing the specific mass of radioisotope electric systems. Recent performance estimates suggest that specific masses of 50 kg/kW may be achievable with thermophotovoltaic and alkali metal thermal-to-electric conversion generators. Powerplants constructed from these near-term radioisotope electric generators and long-life ion thrusters will likely have specific masses in the range of 100 to 200 kg/kW of thrust power if development continues over the next decade. In earlier studies, it was concluded that flight times within the Solar System are indeed insensitive to reductions in the powerplant specific mass, and that a timely scientific program of robotic planetary rendezvous and near-interstellar space missions is enabled by primary electric propulsion once the powerplant specific mass is in the range of 100 to 200 kg/kW. Flight times can be substantially reduced by using hybrid propulsion schemes that combine chemical propulsion, gravity assist, and electric propulsion. Hybrid schemes are further explored in this article to illustrate how the performance of REP is enhanced for Pluto rendezvous, heliopause orbiter, and gravitational lens missions

QuASAR: quantitative allele-specific analysis of reads.

Science.gov (United States)

Harvey, Chris T; Moyerbrailean, Gregory A; Davis, Gordon O; Wen, Xiaoquan; Luca, Francesca; Pique-Regi, Roger

2015-04-15

Expression quantitative trait loci (eQTL) studies have discovered thousands of genetic variants that regulate gene expression, enabling a better understanding of the functional role of non-coding sequences. However, eQTL studies are costly, requiring large sample sizes and genome-wide genotyping of each sample. In contrast, analysis of allele-specific expression (ASE) is becoming a popular approach to detect the effect of genetic variation on gene expression, even within a single individual. This is typically achieved by counting the number of RNA-seq reads matching each allele at heterozygous sites and testing the null hypothesis of a 1:1 allelic ratio. In principle, when genotype information is not readily available, it could be inferred from the RNA-seq reads directly. However, there are currently no existing methods that jointly infer genotypes and conduct ASE inference, while considering uncertainty in the genotype calls. We present QuASAR, quantitative allele-specific analysis of reads, a novel statistical learning method for jointly detecting heterozygous genotypes and inferring ASE. The proposed ASE inference step takes into consideration the uncertainty in the genotype calls, while including parameters that model base-call errors in sequencing and allelic over-dispersion. We validated our method with experimental data for which high-quality genotypes are available. Results for an additional dataset with multiple replicates at different sequencing depths demonstrate that QuASAR is a powerful tool for ASE analysis when genotypes are not available. http://github.com/piquelab/QuASAR. fluca@wayne.edu or rpique@wayne.edu Supplementary Material is available at Bioinformatics online. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

Study of the amplified spontaneous emission spectral width and gain coefficient for a KrF laser in unsaturated and saturated conditions

International Nuclear Information System (INIS)

Hariri, A; Sarikhani, S

2014-01-01

On the basis of a model of a geometrically dependent gain coefficient, the amplified spontaneous emission (ASE) spectral width was calculated analytically for the nearly resonant transition of ν ∼ ν 0 , and also numerically for a wide range of transition frequencies. For this purpose, the intensity rate equation was used under unsaturated and saturated conditions. For verifying the proposed model, reported measurements of the ASE energy versus the excitation length for a KrF laser were used. For the excitation length of l = 84 cm corresponding to single-path propagation, the ASE spectral width for the homogeneously broadened transition was calculated to be 6.28 Å, to be compared with the measured 4.1 Å spectral width reported for a KrF oscillator utilizing a two-mirror resonator. With the gain parameters obtained from the ASE energy measurements, the unsaturated and saturated gain coefficients for l = 84 cm were calculated to be 0.042 cm −1 and 0.014 cm −1 , respectively. These values of the gain coefficient are comparable to but slightly lower than the measured gain coefficient for laser systems of 80–100 cm excitation lengths reported from different laboratories. (letter)

Automotive Stirling Engine Development Project

Science.gov (United States)

Ernst, William D.; Shaltens, Richard K.

1997-01-01

The development and verification of automotive Stirling engine (ASE) component and system technology is described as it evolved through two experimental engine designs: the Mod 1 and the Mod 2. Engine operation and performance and endurance test results for the Mod 1 are summarized. Mod 2 engine and component development progress is traced from the original design through hardware development, laboratory test, and vehicle installation. More than 21,000 hr of testing were accomplished, including 4800 hr with vehicles that were driven more dm 59,000 miles. Mod 2 engine dynamometer tests demonstrated that the engine system configuration had accomplished its performance goals for power (60 kW) and efficiency (38.5%) to within a few percent. Tests with the Mod 2 engine installed in a delivery van demonstrated combined metro-highway fuel economy improvements consistent with engine performance goals and the potential for low emission levels. A modified version of the Mod 2 has been identified as a manufacturable design for an ASE. As part of the ASE project, the Industry Test and Evaluation Program (ITEP), NASA Technology Utilization (TU) project, and the industry-funded Stirling Natural Gas Engine program were undertaken to transfer ASE technology to end users. The results of these technology transfer efforts are also summarized.

Long-Range Correlations and Memory in the Dynamics of Internet Interdomain Routing.

Directory of Open Access Journals (Sweden)

Maksim Kitsak

Full Text Available Data transfer is one of the main functions of the Internet. The Internet consists of a large number of interconnected subnetworks or domains, known as Autonomous Systems (ASes. Due to privacy and other reasons the information about what route to use to reach devices within other ASes is not readily available to any given AS. The Border Gateway Protocol (BGP is responsible for discovering and distributing this reachability information to all ASes. Since the topology of the Internet is highly dynamic, all ASes constantly exchange and update this reachability information in small chunks, known as routing control packets or BGP updates. In the view of the quick growth of the Internet there are significant concerns with the scalability of the BGP updates and the efficiency of the BGP routing in general. Motivated by these issues we conduct a systematic time series analysis of BGP update rates. We find that BGP update time series are extremely volatile, exhibit long-term correlations and memory effects, similar to seismic time series, or temperature and stock market price fluctuations. The presented statistical characterization of BGP update dynamics could serve as a basis for validation of existing and developing better models of Internet interdomain routing.

Preliminary evidence that different mechanisms underlie the anger superiority effect in children with and without Autism Spectrum Disorders

Directory of Open Access Journals (Sweden)

Tomoko eIsomura

2014-05-01

Full Text Available Previous studies have demonstrated that angry faces capture humans’ attention more rapidly than emotionally positive faces. This phenomenon is referred to as the anger superiority effect (ASE. Despite atypical emotional processing, adults and children with Autism Spectrum Disorders (ASD have been reported to show ASE as well as typically developed (TD individuals. So far, however, few studies have clarified whether or not the mechanisms underlying ASE are the same for both TD and ASD individuals. Here, we tested how TD and ASD children process schematic emotional faces during detection by employing a recognition task in combination with a face-in-the-crowd task. Results of the face-in-the-crowd task revealed the prevalence of ASE both in TD and ASD children. However, the results of the recognition task revealed group differences: In TD children, detection of angry faces required more configural face processing and disrupted the processing of local features. In ASD children, on the other hand, it required more feature-based processing rather than configural processing. Despite the small sample sizes, these findings provide preliminary evidence that children with ASD, in contrast to TD children, show quick detection of angry faces by extracting local features in faces.

Accuracy of 16-detector Multislice Spiral Computed Tomography in the initial evaluation of dilated cardiomyopathy

International Nuclear Information System (INIS)

Cornily, Jean-Christophe; Gilard, Martine; Le Gal, Gregoire; Pennec, Pierre-Yves; Vinsonneau, Ulric; Blanc, Jean-Jacques; Mansourati, Jacques; Boschat, Jacques

2007-01-01

Background: Multislice Computed Tomography (MSCT) recently proved its accuracy in the detection of coronary artery disease (CAD). It can also give information about left ventricular function and venous network anatomy. We here sought to validate a MSCT-based strategy in the initial evaluation of patients with dilated cardiomyopathy (DCM). Methods: 36 patients with DCM underwent cardiac MSCT before conventional coronary angiography with ventriculography. We analysed arterial calcium score (Agatston score equivalent: ASE), coronary stenosis, left ventricular parameters and venous network. Results: The sensitivity of a MSCT-based strategy in detecting significant CAD was 100% and the specificity 80%. The positive and negative predictive values were respectively 67% and 100%. For ASE 1.000, conventional coronary angiography is mandatory due to MSCT's poor interest in such cases; when ASE <1.000, a contrast-enhanced MSCT may, when normal, replace coronary angiography

Digital gene-expression of alfalfa saponin extract on laying hens

Directory of Open Access Journals (Sweden)

Wenna Fan

2015-03-01

Full Text Available Cardiovascular disease is a major cause of death worldwide, so people are advised to limit their intake of dietary cholesterol [1]. Egg consumption has been seriously reduced because of the high levels of cholesterol [2]. The objective of this study was to evaluate the cholesterol metabolism effects of alfalfa saponin extract (ASE in liver and ovary tissues using digital gene-expression (DGE profiling analysis. The liver and ovary tissues were isolated from laying hens fed with ASE for RNA sequencing. Here, we provide detailed experimental methods and analysis pipeline in our study to identify digital gene expression of alfalfa saponin extract on laying hens and analysis pipeline published by Singh and colleagues in the PLOS ONE [3]. The data generated in our work provide meaningful information for understanding the molecular mechanisms underlying the cholesterol-lowering effects of ASE.

Effect of extraction method on the yield of furanocoumarins from fruits of Archangelica officinalis Hoffm.

Science.gov (United States)

Waksmundzka-Hajnos, M; Petruczynik, A; Dragan, A; Wianowska, D; Dawidowicz, A L

2004-01-01

Optimal conditions for the extraction and analysis of furanocoumarins from fruits of Archangelica officinalis Hoffm. have been determined. The following extraction methods were used: exhaustive extraction in a Soxhlet apparatus, ultrasonication at 25 and 60 degrees C, microwave-assisted solvent extraction in open and closed systems, and accelerated solvent extraction (ASE). In most cases the yields of furanocoumarins were highest using the ASE method. The effects of extracting solvent, temperature and time of extraction using this method were investigated. The highest yield of furanocoumarins by ASE was obtained with methanol at 100-130 degrees C for 10 min. The extraction yields of furanocoumarins from plant material by ultrasonication at 60 degrees C and microwave-assisted solvent extraction in an open system were comparable to the extraction yields obtained in the time- and solvent-consuming exhaustive process involving the Soxhlet apparatus.

Longitudinal versus transversal excitation in doped graded-index polymer optical fibers

Science.gov (United States)

Illarramendi, M. A.; Arrue, J.; Ayesta, I.; Jiménez, F.; Zubia, J.; Bikandi, I.; Tagaya, A.; Koike, Y.

2014-03-01

In this work we perform a detailed experimental and theoretical analysis of the properties of amplified spontaneous emission (ASE) in a rhodamine-6G-doped graded-index polymer optical fiber when the fiber is pumped either longitudinally or transversally with respect to the fiber axis. The dependence of the ASE threshold and efficiency on fiber length has been compared for both schemes of excitation. A theoretical model for longitudinal excitation has been carried out by means of the laser rate equations as functions of time, distance traveled by light and wavelength. The analysis takes into account that the fiber is a typical graded-index POF in which the radial distributions of light power density and dye concentration are not uniform. The theoretical calculations agree satisfactorily with the experimental results. The photodegradation of the ASE intensity has also been measured for both pumping schemes.

Desigualdade social, crescimento urbano e hanseníase em Manaus: abordagem espacial Desigualdad social, crecimiento urbano y hanseníasis en Manaus (Norte de Brasil: abordaje espacial Social inequality, urban growth and leprosy in Manaus: a spatial approach

Directory of Open Access Journals (Sweden)

Elsia Nascimento Belo Imbiriba

2009-08-01

Full Text Available OBJETIVO: Analisar a epidemiologia de hanseníase segundo a distribuição espacial e condições de vida da população. MÉTODOS: Estudo ecológico baseado na espacialização da hanseníase em Manaus (AM, entre 1998 e 2004. Os 4.104 casos obtidos do Sistema de Informações de Agravos de Notificação foram georreferenciados de acordo com a localização dos endereços em 1.536 setores censitários urbanos, por meio de quatro técnicas: correios (73,7% dos endereços encontrados; Programa de Cadastro de Logradouros (7,3%; Programa Saúde da Família (2,1% e folhas de coleta do Instituto Brasileiro de Geografia e Estatística (1,5%. Para cálculo do coeficiente de detecção utilizou a população de 2001. Na análise espacial foi aplicado o método bayesiano empírico local para produzir uma estimativa do risco da hanseníase, suavizando o efeito da flutuação das taxas, quando calculadas para pequenas áreas. Para análise da associação entre espacialização e fatores de risco empregou-se a regressão logística, tendo como variáveis explicativas a ocorrência de casos em menores de 15 anos (indicador de gravidade e o Índice de Carência Social construído a partir das variáveis do Censo 2000. RESULTADOS: O coeficiente de detecção apresentou-se hiperendêmico em 34,0% dos setores e muito alto em 26,7%. A medida de associação (odds ratio referente às variáveis explicativas foi significativa. A combinação de baixa condição de vida e ocorrência em menores de 15 anos foi adotada para identificar as áreas prioritárias para intervenção. CONCLUSÕES: A análise espacial da hanseníase mostrou que a distribuição da doença é heterogênea, atingindo mais intensamente as regiões habitadas por grupos em situação de maior vulnerabilidade.OBJETIVO: Analizar la epidemiología de hanseníasis según la distribución espacial y condiciones de vida de la población. MÉTODOS: Estudio ecológico basado en la especialización de la

Erradicação ou manejo integrado das miíases neotropicais das Américas? Eradication or integrated managment of neotropical myiases of the Americas?

Directory of Open Access Journals (Sweden)

Gonzalo E. Moya Borja

2003-09-01

Full Text Available A erradicação da bicheira, Cochliomyia hominivorax dos EUA, da América Central e do Norte da África tornou-se uma realidade criando e liberando machos estéreis. Por que nos não decidimos também erradicar este inseto da América do Sul? Antes de tomar uma atitude corajosa, nós discutiremos neste trabalho as razões científicas, ecológicas e econômicas. O berne, Dermatobia hominis não tem sido erradicado de nenhum pais, devido a que não dispomos de técnicas para sua criação massal em dietas artificiais. Estão faltando também estudos sobre a dispersão, comportamento sexual e sítios de agregação dos adultos no campo. Devido a que as miíases continuarão sendo controladas basicamente com inseticidas, recomendações para manejar a resistência aos inseticidas e estudos sobre métodos alternativos são discutidos visando um Manejo Integrado do berne e da bicheira com fundamentos ecológicos.The eradication of the screwworm, Cochliomyia hominivorax, from USA, Central America and the North of Africa has been achieved by rearing and releasing sterile males. Why we do not decide to eradicate this insect from the southamerican countries too? In this paper the scientific, ecological and economic reasons before taking such a courageous decision are discussed. The human botfly, Dermatobia hominis, has not been eradicated from any country, because there is so far no technique available for mass production in artificial diets. Studies on dispersion, sexual behavior and aggregation sites of the adults in the field are also not known. Why the neotropical myiases will continue to be treated basically with chemicals, recommendations for insecticide resistance management and studies on alternative methods are discussed trying to apply in the future an ecologically based pest management of the screwworm and the human botfly.

TOXOCARIASIS: SEROLOGICAL DIAGNOSIS BY INDIRECT ANTIBODY COMPETITION ELISA Diagnóstico sorológico da toxocaríase através do método de ELISA indireto de competição

Directory of Open Access Journals (Sweden)

Cáris Maroni NUNES

1999-03-01

Full Text Available Toxocariasis is caused by infection of man by Toxocara canis and Toxocara cati larvae, the common roundworm of dogs and cats. Because larvae are difficult to detect in tissues, diagnosis is mostly based on serology. Non specific reactions are observed mainly due to cross-reactivity with Ascaris sp antigens. This investigation aimed at developing and evaluating an indirect antibody competition ELISA (IACE employing a specific rabbit IgG anti-Toxocara canis excretory-secretory antigens as the competition antibody, in order to improve indirect ELISA specificity performed for toxocariasis diagnosis. For that, the rabbit IgG was previously absorbed by Ascaris suum adult antigens. Sensitivity and specificity of IACE were first evaluated in 28 serum samples of mice experimentally infected with T. canis embryonated eggs. Adopting cut-off value established in this population before infection, sensitivity and specificity were 100% after 20 days post-inoculation. For human population IACE was evaluated using sera from 440 patients with clinical signs of toxocariasis and the cut-off value was established with 60 serum samples from apparently healthy individuals. Using as reference test the indirect ELISA performed by Adolfo Lutz Institute, sensitivity was 60.2%, specificity was 98% and concordance was 77.3%. Repeatability of IACE was evaluated by the inter-reactions variation coefficient (2.4%.A toxocaríase, uma emergente zoonose, é uma síndrome clínica decorrente da infecção humana por larvas de Toxocara canis e Toxocara cati, parasitas intestinais de cães e gatos, respectivamente. A dificuldade de detecção das larvas nos tecidos e a inespecificidade dos sinais clínicos tornam os testes sorológicos os meios diagnósticos mais adequados. Os antígenos excretores-secretores de T. canis empregados nos testes sorológicos, embora tenham contribuído para melhorar a especificidade destes, apresentam reações cruzadas com diversos parasitas

Orestes Kinetics Model for the Electra KrF Laser

Science.gov (United States)

Giuliani, J. L.; Kepple, P.; Lehmberg, R. H.; Myers, M. C.; Sethian, J. D.; Petrov, G.; Wolford, M.; Hegeler, F.

2003-10-01

Orestes is a first principles simulation code for the electron deposition, plasma chemistry, laser transport, and amplified spontaneous emission (ASE) in an e-beam pumped KrF laser. Orestes has been benchmarked against results from Nike at NRL and the Keio laser facility. The modeling tasks are to support ongoing oscillator experiments on the Electra laser ( 500 J), to predict performance of Electra as an amplifier, and to develop scaling relations for larger systems such as envisioned for an inertial fusion energy power plant. In Orestes the energy deposition of the primary beam electrons is assumed to be spatially uniform, but the excitation and ionization of the Ar/Kr/F2 target gas by the secondary electrons is determined from the energy distribution function as calculated by a Boltzmann code. The subsequent plasma kinetics of 23 species subject to over 100 reactions is followed with 1-D spatial resolution along the lasing axis. In addition, the vibrational relaxation among excited electronic states of the KrF molecule are included in the kinetics since lasing at 248 nm can occur from several vibrational lines of the B state. Transport of the lasing photons is solved by the method of characteristics. The time dependent ASE is calculated in 3-D using a ``local look-back'' scheme with discrete ordinates and includes specular reflection off the side walls and rear mirror. Gain narrowing is treated by multi-frequency transport of the ASE. Calculations for the gain, saturation intensity, extraction efficiency, and laser output from the Orestes model will be presented and compared with available data from Electra operated as an oscillator. Potential implications for the difference in optimal F2 concentration will be discussed along with the effects of window transmissivity at 248 nm.

Perfil epidemiológico da hanseníase na microrregião de araçuaí e sua relação com ações de controle Perfil epidemiológico de la lepra en la micro región de araçuaí y su relación con las acciones de control Epidemiological profile of leprosy at the microregion of araçuaí and its relation with actions control

Directory of Open Access Journals (Sweden)

Francisco Carlos Félix Lana

2011-03-01

Full Text Available A hanseníase representa um problema de saúde pública no Brasil pelos altos índices de prevalência e incidência. O objetivo deste estudo é analisar a situação epidemiológica da hanseníase e sua relação com o desenvolvimento das ações de controle na microrregião de Araçuaí. Trata-se de estudo epidemiológico, descritivo, cujos dados foram coletados das fichas de notificação de casos de hanseníase de municípios da microrregião, período 1998-2007, disponibilizados no Sistema de Informação de Agravos de Notificação - SINAN. Foram construídos e analisados indicadores epidemiológicos e operacionais preconizados pelo Ministério da Saúde. Foram notificados 343 casos, resultando em uma detecção geral média de 28,5 casos/100.000 habitantes/ano. A proporção de casos detectados com grau II de incapacidade e o predomínio de formas passivas de detecção sugerem diagnóstico tardio e corroboram a importância da integração das ações de controle da hanseníase na atenção básica.La lepra representa un problema de salud pública en Brasil debido a los altos índices de detección y prevalencia. El objetivo de este estudio es analizar la situación epidemiológica de la lepra y su relación con acciones de control en micro región de Araçuaí en el periodo 1998-2007. El estudio es epidemiológico, descriptivo y los dados fueran recogidos de formularios de notificación de casos de lepra de las ciudades de la región, período 1998-2007, disponible en el Sistema de Información de Agravos de Notificación - SINAN. Indicadores operacionales y epidemiológicos fueran construidos y analizados de acuerdo con los parámetros del Ministerio de la Salud. En el periodo, 343 casos de lepra fueran notificados y la detección fue 28,5 casos/100.000 habitantes/año. La proporción de casos detectados con el grado de incapacidad II y la prevalencia de las formas pasivas de detección sugiere un diagnóstico tardío y confirma la

The Development of Academic Self-Efficacy Scale for Filipino Junior High School Students

Directory of Open Access Journals (Sweden)

Angelo Reyes Dullas

2018-04-01

Full Text Available Primarily the research is focused on the development and validation of the Academic Self-efficacy Scale (ASES-FJHS for Filipino junior high school students. Self-efficacy refers to people’s beliefs in their capabilities to produce certain effects and to learn or perform behaviors at designated levels (Bandura, 2006, 2012. In relation to test construction, most of the developed self-efficacy scale focuses on one source of self-efficacy and are constructed as subscale. Given the limited published ASES for Filipino junior high school students as well as the non-existence of published and established ASES in Philippine context, this study sought to develop and validate a self-efficacy scale that is more holistic than those previously published. The design of the research is Test Development and anchored on Classical Test Theory. Respondents comprised of 4,759 junior high school students from selected 20 public and private schools in Nueva Ecija, Philippines. The study followed the two stages of test development, i.e., the development of the initial, preliminary, and final forms and validation of the scale. The items were developed through consultation with experts and literature reviews. After the development of table of specification, items were validated by four expert judges. Results showed using Lawshe Content Validation Ratio (CVI = 0.87 and Intra-class Correlation [ICC (2,4 = 0.953, a = 0.000] that the expert validators have high agreement on the items of ASES. Moreover, Upper Limit-Lower Limit method (d = 0.43, Cronbach alpha (0.95, split-half method (Spearman-Brown Coefficient = 0.86, item to total correlation, and Principal Component Analysis were also utilized to test the reliability of test items. The factor structure verified the four iterations which includes perceived control (PC, competence (C, persistence (P, and self-regulated learning domains. Convergent (r = 0.498; p < 0.05 and concurrent validity (r�

Development and Validation of an Automated Step Ergometer

Directory of Open Access Journals (Sweden)

C. de Sousa Maria do Socorro

2014-12-01

Full Text Available Laboratory ergometers have high costs, becoming inaccessible for most of the population, hence, it is imperative to develop affordable devices making evaluations like cardiorespiratory fitness feasible and easier. The objective of this study was to develop and validate an Automated Step Ergometer (ASE, adjusted according to the height of the subject, for predicting VO2max through a progressive test. The development process was comprised by three steps, the theoretical part, the prototype assembly and further validation. The ASE consists in an elevating platform that makes the step at a higher or lower level as required for testing. The ASE validation was obtained by comparing the values of predicted VO2max (equation and direct gas analysis on the prototype and on a, treadmill. For the validation process 167 subjects with average age of 31.24 ± 14.38 years, of both genders and different degrees of cardiorespiratory fitness, were randomized and divided by gender and training condition, into untrained (n=106, active (n=24 and trained (n=37 subjects. Each participant performed a progressive test on which the ASE started at the same height (20 cm for all. Then, according to the subject’s height, it varied to a maximum of 45 cm. Time in each stage and rhythm was chosen in accordance with training condition from lowest to highest (60-180 s; 116-160 bpm, respectively. Data was compared with the student’s t test and ANOVA; correlations were tested with Pearson’s r. The value of α was set at 0.05. No differences were found between the predicted VO2max and the direct gas analysis VO2max, nor between the ASE and treadmill VO2max (p= 0.365 with high correlation between ergometers (r= 0.974. The values for repeatability, reproducibility, and reliability of male and female groups measures were, respectively, 4.08 and 5.02; 0.50 and 1.11; 4.11 and 5.15. The values of internal consistency (Cronbach’s alpha among measures were all >0.90. It was verified

Spectrally narrowed emissions in 2,5-bis(4-biphenylyl)thiophene crystals pumped by fs laser pulse

International Nuclear Information System (INIS)

Kobayashi, S.; Sasaki, F.; Yanagi, H.; Hotta, S.; Ichikawa, M.; Taniguchi, Y.

2005-01-01

Spectrally narrowed emission (SNE) in 2,5-bis(4-biphenylyl)thiophene (BP1T) crystals is investigated using fs laser pulse. Two different types of narrowing are observed at different vibronic emission bands with increasing pump intensities. Based on their pump intensity dependence and illumination area dependence, we assign the SNE at 20,200 cm -1 (β-band) to amplified spontaneous emission (ASE) and the SNE at 21,600 cm -1 (α-band) to superfluorescence rather than ASE

Mechanisms of reversible photodegradation in disperse orange 11 dye doped in PMMA polymer

International Nuclear Information System (INIS)

Embaye, Natnael B.; Ramini, Shiva K.; Kuzyk, Mark G.

2008-01-01

We use amplified spontaneous emission (ASE) and linear absorption spectroscopy to study the mechanisms of reversible photodegradation of 1-amino-2-methylanthraquinone (disperse orange 11-DO11) in solid poly(methyl methacrylate). Measurements as a function of intensity, concentration, and time suggest that ASE originates in a state (be it a tautomer or a vibronic level) that can form a dimer or some other aggregate upon relaxation, which through fluorescence quenching leads to degradation of the ASE signal. Whatever the degradation route, a high concentration of DO11 is required and the polymer plays a key role in the process of opening a new reversible degradation pathway that is not available at lower concentrations or in liquid solutions. We construct an energy level diagram that describes all measured quantities in the decay and recovery processes and propose a hypothesis of the nature of the associated states

Aeroservoelasticity modeling and control

CERN Document Server

Tewari, Ashish

2015-01-01

This monograph presents the state of the art in aeroservoelastic (ASE) modeling and analysis and develops a systematic theoretical and computational framework for use by researchers and practicing engineers. It is the first book to focus on the mathematical modeling of structural dynamics, unsteady aerodynamics, and control systems to evolve a generic procedure to be applied for ASE synthesis. Existing robust, nonlinear, and adaptive control methodology is applied and extended to some interesting ASE problems, such as transonic flutter and buffet, post-stall buffet and maneuvers, and flapping flexible wing. The author derives a general aeroservoelastic plant via the finite-element structural dynamic model, unsteady aerodynamic models for various regimes in the frequency domain, and the associated state-space model by rational function approximations. For more advanced models, the full-potential, Euler, and Navier-Stokes methods for treating transonic and separated flows are also briefly addressed. Essential A...

Cellulose biodegradation studies: application of rDNA and protoplast fusion techniques

International Nuclear Information System (INIS)

Halos, S.C.; Caday, R.; Claudio, J. University of the Philippines, Diliman, Quezon City . Natural Sciences Research Inst.; Pham, L.J.

1991-01-01

A gene library of cellulomonas DNA digested with Sau3AI was constructed in BamHI site of pBr322. About 300 recombinants were screened for endo glucanase (CMC-ase) production using congo red assay technique. Out of seven CMC-ase positive clones, four were stable in E. coli C600. The plasmids were extracted from these stable clones and re transformed to HB101 and were analysed for cellulase production both intracellularly and extra cellularly. The plasmids were re isolated from HB101 clones and analysed for inserts using 23 restriction enzymes, which indicated inserts in the range of 6.8-12.5Kb. Cloning of sub fragments indicated two different fragments of 2.8 Kb and 3.7 Kb showing complete CMC-ase activity. This indicates the presence of isozymes in Cellulomonas and strengthens the reports on mutagenic expression of cellulase family. (author)

Oxiuríase e migrações pré-históricas Oxyuriasis and prehistoric migrations

Directory of Open Access Journals (Sweden)

Adauto Araújo

1995-06-01

Full Text Available O encontro de parasitos em material arqueológico tem permitido o acompanhamento da dispersão de agentes infecciosos e seus hospedeiros humanos no passado. Através desses achados, pôde-se retomar teorias propostas no início do século sobre contatos transpacíficos de populações asiáticas com a América do Sul. Assim foi feito, por exemplo, no caso do encontro de ovos de ancilostomídeos em material arqueológico datado de até sete mil anos antes do presente. O aumento da produção científica na área torna necessária, agora, a realização de trabalhos de síntese que avaliem o estado da arte e proponham modelos paleoepidemiológicos compreensíveis para a dispersão pré-histórica das parasitoses humanas. Nesse sentido, foi feito o presente trabalho, a partir dos recentes achados de ovos de Enterobius vermicularis em material arqueológico nas Américas. Diferentemente da infecção por ancilostomídeos, a oxiuríase não necessita de passagem pelo solo para a transmissão de um hospedeiro a outro, logo, sua persistência em uma dada população humana independe das condições climáticas. Poderia, portanto, ter sido trazida do velho para o novo continente, inclusive pelas migrações humanas que atravessaram o estreito de Bering. Tal fato pode explicar a maior dispersão geográfica dos achados e sua disseminação na América do Norte, desde dez mil anos até os tempos atuais. Na América do Sul, por outro lado, os achados arqueológicos só confirmaram sua existência ao longo da região andina, com achados no Chile e no Norte da Argentina. No Brasil, apesar do grande número de amostras examinadas, não foram encontrados ovos de Enterobius vermicularis em coprólitos. No presente trabalho, discutem-se modelos explicativos para a distribuição conhecida dessa parasitose em populações pré-históricas.Parasite findings in archeological material have made it possible to trace the dispersion of infectious agents and their human

Granule Associated Serine Proteases of Hematopoietic Cells - An Analysis of Their Appearance and Diversification during Vertebrate Evolution.

Directory of Open Access Journals (Sweden)

Srinivas Akula

Full Text Available Serine proteases are among the most abundant granule constituents of several hematopoietic cell lineages including mast cells, neutrophils, cytotoxic T cells and NK cells. These proteases are stored in their active form in the cytoplasmic granules and in mammals are encoded from four different chromosomal loci: the chymase locus, the met-ase locus, the T cell tryptase and the mast cell tryptase locus. In order to study their appearance during vertebrate evolution we have performed a bioinformatic analysis of related genes and gene loci from a large panel of metazoan animals from sea urchins to placental mammals for three of these loci: the chymase, met-ase and granzyme A/K loci. Genes related to mammalian granzymes A and K were the most well conserved and could be traced as far back to cartilaginous fish. Here, the granzyme A and K genes were found in essentially the same chromosomal location from sharks to humans. However in sharks, no genes clearly identifiable as members of the chymase or met-ase loci were found. A selection of these genes seemed to appear with bony fish, but sometimes in other loci. Genes related to mammalian met-ase locus genes were found in bony fish. Here, the most well conserved member was complement factor D. However, genes distantly related to the neutrophil proteases were also identified in this locus in several bony fish species, indicating that this locus is also old and appeared at the base of bony fish. In fish, a few of the chymase locus-related genes were found in a locus with bordering genes other than the mammalian chymase locus and some were found in the fish met-ase locus. This indicates that a convergent evolution rather than divergent evolution has resulted in chymase locus-related genes in bony fish.

Changes in insurance physicians' attitudes, self-efficacy, intention, and knowledge and skills regarding the guidelines for depression, following an implementation strategy.

Science.gov (United States)

Zwerver, Feico; Schellart, Antonius J M; Anema, Johannes R; van der Beek, Allard J

2013-03-01

To improve guideline adherence by insurance physicians (IPs), an implementation strategy was developed and investigated in a randomized controlled trial. This implementation strategy involved a multifaceted training programme for a group of IPs in applying the guidelines for depression. In this study we report the impact of the implementation strategy on the physicians' attitude, intention, self-efficacy, and knowledge and skills as behavioural determinants of guideline adherence. Any links between these self-reported behavioural determinants and levels of guideline adherence were also determined. Just before and 3 months after the implementation of the multifaceted training, a questionnaire designed to measure behavioural determinants on the basis of the ASE (attitude, social norm, self-efficacy) model was completed by the intervention (n = 21) and the control group (n = 19). Items of the questionnaire were grouped to form scales of ASE determinants. Internal consistency of the scales was calculated using Cronbach's alphas. Differences between groups concerning changes in ASE determinants, and the association of these changes with improvements in guideline adherence, were analyzed using analysis of covariance. The internal consistency of the scales of ASE determinants proved to be sufficiently reliable, with Cronbach's alphas of at least 0.70. At follow-up after 3 months, the IPs given the implementation strategy showed significant improvement over the IPs in the control group for all ASE determinants investigated. Changes in knowledge and skills were only weakly associated with improvements in guideline adherence. The implementation strategy developed for insurance physicians can increase their attitude, intention, self-efficacy, and knowledge and skills when applying the guidelines for depression. These changes in behavioural determinants might indicate positive changes in IPs' behaviour towards the use of the guidelines for depression. However, only changes in

Effectiveness of amorphous silica encapsulation technology on welding fume particles and its impact on mechanical properties of welds

International Nuclear Information System (INIS)

Wang, Jun; Wu, Chang-Yu; Franke, Gene

2014-01-01

Highlights: • A novel welding shielding gas containing a silica precursor. • Up to 76% of the welding fume particles encapsulated in an amorphous silica layer. • No statistical difference between different types of welds in mechanical tests. • Can potentially reduce the toxicity of welding fume particles. - Abstract: Stainless steel welding generates nano-sized fume particles containing toxic metals which may cause serious health effects upon inhalation. The objective of this study was to investigate the effectiveness of an amorphous silica encapsulation (ASE) technology by evaluating its silica coating efficiency (SCE), particle morphology, and its impact on the weld’s mechanical properties. Tetramethylsilane (TMS) added to the welding shielding gas decomposed at the high-temperature arc zone to enable the silica coating. Collected welding fume particles were digested by two acid mixtures with different degrees of silica solubility, and the measured mass differences in the digests were used to determine the SCE. The SCEs were around 48–64% at the low and medium primary shielding gas flow rates. The highest SCE of 76% occurred at the high shielding gas flow rate (30 Lpm) with a TMS carrier gas flow of 0.64 Lpm. Transmission electron microscopy (TEM) images confirmed the amorphous silica layer on the welding fume particles at most gas flow rates, as well as abundant stand-alone silica particles formed at the high gas flow rate. Metallography showed that welds from the baseline and from the ASE technology were similar except for a tiny crack found in one particular weld made with the ASE technology. Tensile tests showed no statistical difference between the baseline and the ASE welds. All the above test results confirm that welding equipment retrofitted with the ASE technology has the potential to effectively address the toxicity problem of welding fume particles without affecting the mechanical properties of the welds

ORF Sequence: NC_002932 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ase [Chlorobium tepidum TLS] MNILGIETSCDETSAAVLSDGSVRSNIVSSQRCHTDFGGVVPELASREHERLIVSIVDAAITEANIAKNDLDVIAATAG...PGLIGAVMVGLCFAEGLAWALGKPFVPVNHVEAHIFSPFISDEPGHREPKGDFVSLTVSGGHTLLSVVRQDLGYEVIGRTIDDAAGEAFDKTGKMLGLGYPAGPVIDR

Generation, amplification and propagation of partially coherent light in a Nd:glass laser driver for inertial confinement fusion

International Nuclear Information System (INIS)

Nakano, Hitoshi; Tsubakimoto, Kouji; Miyanaga, Noriaki; Nakatsuka, Masahiro; Kanabe, Tadashi.

1992-01-01

A partially coherent light source has been introduced into the high power twelve beam Nd:glass laser system, Gekko XII for obtaining the smooth intensity distribution of a focused beam pattern. An amplified spontaneous emission (ASE) from Nd:glass was used as a partially coherent source. We adopted the angularly dispersed spectrum not only for beam smoothing but for efficient harmonic conversion. The temporal evolution of the speckle smoothing was experimentally evaluated and compared with a statistical model of speckle pattern. In the amplification of a partially coherent light in Gekko XII, no reduction of the energy gain was found at high power operation 1kJ level. The ASE light can be propagated using image relaying spatial filters, with maintaining the beam divergence up to 32 times diffraction limited. Irradiation nonuniformities on a spherical target were estimated from the focused beam patterns measured at an equivalent target plane. A partially coherent light is quite effective for reducing the nonuniformity from 19.7% (the coherent laser with random phase plate) to 3.8%. Doubling efficiency was found to be reduced at high intensity region due to the phase mismatching with the beam divergence of the ASE light. We discuss possible approaches to obtain the sufficient harmonic conversion with keeping the incoherency of the ASE light. (author)

The C. elegans Tailless/TLX transcription factor nhr-67 controls neuronal identity and left/right asymmetric fate diversification.

Science.gov (United States)

Sarin, Sumeet; Antonio, Celia; Tursun, Baris; Hobert, Oliver

2009-09-01

An understanding of the molecular mechanisms of cell fate determination in the nervous system requires the elucidation of transcriptional regulatory programs that ultimately control neuron-type-specific gene expression profiles. We show here that the C. elegans Tailless/TLX-type, orphan nuclear receptor NHR-67 acts at several distinct steps to determine the identity and subsequent left/right (L/R) asymmetric subtype diversification of a class of gustatory neurons, the ASE neurons. nhr-67 controls several broad aspects of sensory neuron development and, in addition, triggers the expression of a sensory neuron-type-specific selector gene, che-1, which encodes a zinc-finger transcription factor. Subsequent to its induction of overall ASE fate, nhr-67 diversifies the fate of the two ASE neurons ASEL and ASER across the L/R axis by promoting ASER and inhibiting ASEL fate. This function is achieved through direct expression activation by nhr-67 of the Nkx6-type homeobox gene cog-1, an inducer of ASER fate, that is inhibited in ASEL through the miRNA lsy-6. Besides controlling bilateral and asymmetric aspects of ASE development, nhr-67 is also required for many other neurons of diverse lineage history and function to appropriately differentiate, illustrating the broad and diverse use of this type of transcription factor in neuronal development.

The dependence of the modulation transfer function on the blocking layer thickness in amorphous selenium x-ray detectors

International Nuclear Information System (INIS)

Hunter, David M.; Belev, Gueorgi; DeCrescenzo, Giovanni; Kasap, Safa O.; Mainprize, James G.; Rowlands, J. A.; Smith, Charles; Tuemer, Tuemay; Verpakhovski, Vladimir; Yin Shi; Yaffe, Martin J.

2007-01-01

Blocking layers are used to reduce leakage current in amorphous selenium detectors. The effect of the thickness of the blocking layer on the presampling modulation transfer function (MTF) and on dark current was experimentally determined in prototype single-line CCD-based amorphous selenium (a-Se) x-ray detectors. The sampling pitch of the detectors evaluated was 25 μm and the blocking layer thicknesses varied from 1 to 51 μm. The blocking layers resided on the signal collection electrodes which, in this configuration, were used to collect electrons. The combined thickness of the blocking layer and a-Se bulk in each detector was ∼200 μm. As expected, the dark current increased monotonically as the thickness of the blocking layer was decreased. It was found that if the blocking layer thickness was small compared to the sampling pitch, it caused a negligible reduction in MTF. However, the MTF was observed to decrease dramatically at spatial frequencies near the Nyquist frequency as the blocking layer thickness approached or exceeded the electrode sampling pitch. This observed reduction in MTF is shown to be consistent with predictions of an electrostatic model wherein the image charge from the a-Se is trapped at a characteristic depth within the blocking layer, generally near the interface between the blocking layer and the a-Se bulk

Effect of Different Solvents on the Measurement of Phenolics and the Antioxidant Activity of Mulberry (Morus atropurpurea Roxb.) with Accelerated Solvent Extraction.

Science.gov (United States)

Yang, Jiufang; Ou, XiaoQun; Zhang, Xiaoxu; Zhou, ZiYing; Ma, LiYan

2017-03-01

The effects of 9 different solvents on the measurement of the total phenolics and antioxidant activities of mulberry fruits were studied using accelerated solvent extraction (ASE). Sixteen to 22 types of phenolics (flavonols, flavan-3-ols, flavanol, hydroxycinnamic acids, hydroxybenzoic acids, and stilbenes) from different mulberry extracts were characterized and quantified using HPLC-MS/MS. The principal component analysis (PCA) was used to determine the suitable solvents to distinguish between different classes of phenolics. Additionally, the phenolic extraction abilities of ASE and ultrasound-assisted extraction (UAE) were compared. The highest extraction efficiency could be achieved by using 50% acidified methanol (50MA) as ASE solvents with 15.14 mg/gallic acid equivalents g dry weight of mulberry fruit. The PCA results revealed that the 50MA followed by 50% acidified acetone (50AA) was the most efficient solvent for the extraction of phenolics, particularly flavonols (627.12 and 510.31 μg/g dry weight, respectively), while water (W) was not beneficial to the extraction of all categories of phenolics. Besides, the results of 3 antioxidant capability assays (DPPH, ABTS free radical-scavenging assay, and ferric-reducing antioxidant power assay) showed that water-based organic solvents increased the antioxidant capabilities of the extracts compared with water or pure organic solvents. ASE was more suitable for the extraction of phenolics than UAE. © 2017 Institute of Food Technologists®.

Reactional state and nutritional profile among leprosy patients in the primary health care system, Greater Vitória, Espírito Santo State, Brazil Estado reacional e perfil nutricional em portadores de hanseníase acompanhados na rede de atenção primária à saúde da Grande Vitória, Espírito Santo, Brasil

Directory of Open Access Journals (Sweden)

Rosa Maria Natalli Montenegro

2012-01-01

Full Text Available Leprosy may present acute/subacute inflammatory processes (leprosy reactions. The study characterized the reactional states of patients at health clinics in Vitória, Espírito Santo State, Brazil, and associated them with sociodemographic factors and clinical/nutritional variables. between January and December 2009, longitudinal follow-up of patients with leprosy continued until leprosy reactions occurred or patients completed 6 months of multidrug therapy. Of the 151 patients participating, 78 (51.7% were females, 48 (31.8% had 5 to 8 years schooling, 93 (61.6% worked and earned from 1 to 3 minimum wages, and 55 (36.4 % had leprosy reactions, but with no statistical association to socioeconomic characteristics or nutritional status. However, absence of reaction was more common in the low-weight group, suggesting a trend in this group to protection from the reaction (p = 0.0906. The study found no association between nutritional status and leprosy reaction.A hanseníase pode apresentar processos inflamatórios agudos/subagudos (reações hansênicas. Os objetivos foram caracterizar os estados reacionais de pacientes de Unidades de Saúde da Grande Vitória (Espírito Santo, Brasil e associá-los aos fatores sociodemográficos e a variáveis clínicas/nutricionais. Estudo longitudinal, de monitoramento de portadores de hanseníase acompanhados até o aparecimento da reação hansênica ou até 6 meses iniciais da poliquimioterapia, de janeiro a dezembro de 2009. Participaram 151 pacientes, sendo 78 (51,7% femininos; 48 (31,8% estudaram de cinco a oito anos; 93 (61,6% trabalhavam e ganhavam de um a três salários mínimos; 55 (36,4% apresentaram reação hansênica, sem associação estatística às características socioeconômicas nem ao estado nutricional. Porém, a ausência de reação foi maior no grupo baixo peso, sugerindo neste grupo tendência na proteção da reação (p = 0,0906. No estudo não houve associação do estado

Final amplifier design and mercury

International Nuclear Information System (INIS)

Rose, E.A.; Hanson, D.E.

1991-01-01

The final amplifier for the Mercury KrF excimer facility is being designed. The design exercise involves extensive modeling to predict amplifier performance. Models of the pulsed-power system, including a Child-Langmuir diode with closure, electron-beam energy deposition, KrF laser kinetics, amplified spontaneous emission (ASE), a time-dependent laser extraction in the presence of ASE are presented as a design package. The design exercise indicates that the energy objective of Phase I -- 100 joules -- will be met

Gain media edge treatment to suppress amplified spontaneous emission in a high power laser

Science.gov (United States)

Hackel, Lloyd A.; Soules, Thomas F.; Fochs, Scott N.; Rotter, Mark D.; Letts, Stephan A.

2008-12-09

A novel method and apparatus for suppressing ASE and parasitic oscillation modes in a high average power laser is introduced. By roughening one or more peripheral edges of a solid-state crystal or ceramic laser gain media and by bonding such edges using a substantially high index bonding elastomer or epoxy to a predetermined electromagnetic absorbing arranged adjacent to the entire outer surface of the peripheral edges of the roughened laser gain media, ASE and parasitic oscillation modes can be effectively suppressed.

Books in Action: Armed Services Editions

Science.gov (United States)

1984-01-01

there were two F. Scott Fitzgerald titles in ASE: The Great Gatsby and The Diamond as Big as the Ritz and Other Stories (a "made" book). It took me...hundred fifty-five thousand ASE copies of The Great Gatsby were distributed-as against the twenty-five thousand copies of the novel printed by Scribners...what he wrote about another war and found a great deal of comfort and reassurance. ’ Years later, Sand- burg inscribed the book for him. Special

Lunar and Planetary Science XXXVI, Part 4

Science.gov (United States)

2005-01-01

Contents include the following: High-Resolution Electron Energy-Loss Spectroscopy (HREELS) Using a Monochromated TEM/STEM. Dynamical Evolution of Planets in Open Clusters. Experimental Petrology of the Basaltic Shergottite Yamato 980459: Implications for the Thermal Structure of the Martian Mantle. Cryogenic Reflectance Spectroscopy of Highly Hydrated Sulfur-bearing Salts. Implications for Core Formation of the Earth from High Pressure-Temperature Au Partitioning Experiments. Uranium-Thorium Cosmochronology. Protracted Core Differentiation in Asteroids from 182Hf-182W Systematics in the Eagle Station Pallasite. Maximizing Mission Science Return Through Use of Spacecraft Autonomy: Active Volcanism and the Autonomous Sciencecraft Experiment. Classification of Volcanic Eruptions on Io and Earth Using Low-Resolution Remote Sensing Data. Isotopic Mass Fractionation Laws and the Initial Solar System (sup26)Al/(sup27)Al Ratio. Catastrophic Disruption of Porous and Solid Ice Bodies (sup187)Re-(sup187)Os Isotope Disturbance in LaPaz Mare Basalt Meteorites. Comparative Petrology and Geochemistry of the LaPaz Mare Basalt Meteorites. A Comparison of the Structure and Bonding of Carbon in Apex Chert Kerogenous Material and Fischer-Tropsch-Type Carbons. Broad Spectrum Characterization of Returned Samples: Orientation Constraints of Small Samples on X-Ray and Other Spectroscopies. Apollo 14 High-Ti Picritic Glass: Oxidation/Reduction by Condensation of Alkali Metals. New Lunar Meteorites from Oman: Dhofar 925, 960 and 961. The First Six Months of Iapetus Observations by the Cassini ISS Camera. First Imaging Results from the Iapetus B/C Flyby of the Cassini Spacecraft. Radiative Transfer Calculations for the Atmosphere of Mars in the 200-900 nm Range. Geomorphologic Map of the Atlantis Basin, Terra Sirenum, Mars. The Meaning of Iron 60: A Nearby Supernova Injected Short-lived Radionuclides into Our Protoplanetary Disk.

Effect of an ionizing radiation on the activity of the components of the system: DNA ase 1-natural DNA ase 1 inhibitor in blood serum of white rats

International Nuclear Information System (INIS)

Ivanova, A.B.; Kerova, N.I.; Pukhova, G.G.; Baraboj, V.A.; AN Ukrainskoj SSR, Kiev. Inst. Problem Onkologii)

1976-01-01

The presence of a natural inhibitor of DNAase 1 of protein nature is responsible for the inhibiting action of blood serum on pancreatic DNAase. Depending on the radiation dose (ranging from 450 to 750 R), the activity of the serum inhibitor of DNAase 1 increases for a short time, then, in the period from 15 minutes to 24 hours, it normalizes (450 R) or drastically decreases on the seventh day (750 R). At the dose of 750 R, the activity of free serum DNAase 1 increases throughout the entire period of the experiment; the activity of bound DNAase 1 gradually decreases and it is not observed on the seventh day. The dose of 450 R does not substantially affect the activity of free DNAase 1. Evidently, at high X-ray doses, formation of the inhibitor-serum DNAase 1 complex is disturbed

Improvement of amplified spontaneous emission performance by doping tris(8-hydroxyquinoline) aluminum (Alq3) in dye-doped polymer thin films.

Science.gov (United States)

Lu, Wu; You, Han; Fang, Junfeng; Ma, Dongge

2007-04-20

A well-known red fluorescent dye 4-(dicy-anomethylene)-2-t-butyl-6(1,1,7,7-tetramethyljulolidyl-9-enyl)-4H-pyran (DCJTB) was codoped with an electron transport organic molecule tris(8-hydroxyquinoline) aluminum (Alq(3)) in a host matrix of polystyrene (PS), and the amplified spontaneous emission (ASE) was studied by optically pumping. It was found that the ASE performance was significantly improved by the introduction of Alq(3). The Alq(3):DCJTB:PS blending thin films showed a low threshold (2.4 microJ/pulse) and a high net gain coefficient (109.95 cm(-1)) compared with the pure DCJTB:PS system (threshold of 15.2 microJ/pulse and gain of 35.94 cm(-1)). The improvement of the ASE performance was considered to be attributable to the effective Föster energy transfer from Alq(3) to DCJTB. Our results demonstrate that the Alq(3):DCJTB could be a promising candidate as gain medium for red organic diode lasers.

Co-precipitation of loperamide hydrochloride and polyethylene glycol using aerosol solvent extraction system

International Nuclear Information System (INIS)

Widjojokusumo, Edward; Youn, Yong-Suk; Lee, Youn-Woo; Veriansyah, Bambang; Tjandrawinata, Raymond Rubianto

2013-01-01

The co-precipitation of loperamide hydrochloride (LPM) and polyethylene glycol (PEG) using aerosol solvent extraction system (ASES) was examined. Scanning electron microscopy - energy dispersive X-ray spectroscopy (SEM-EDS) analysis showed that the co-precipitation was achieved in various LPM-PEG mass ratios with changes in its morphology. In 10-50% PEG mass ratios, angular-shaped particles were formed, whereas in 65-90% PEG mass ratios, irregular-shaped particles were formed. X-ray diffraction (XRD) analysis of the co-precipitates revealed that the LPM retained amorphous structure, while, on the other hand, the PEG retained crystalline structure. Fourier transform infrared (FT-IR) spectra indicated carbonyl function group of LPM and ether function group of PEG appeared in the co-precipitates. Results of a dissolution test showed that the co-precipitates of LPM-PEG had higher dissolution rate compared to that of the raw material and processed LPM with ASES. Taken together, the co-precipitation of LPMPEG was achieved using ASES and higher in its dissolution rate

Resilience Building in Students: The Role of Academic Self-Efficacy

Science.gov (United States)

Cassidy, Simon

2015-01-01

Self-efficacy relates to an individual's perception of their capabilities. It has a clear self-evaluative dimension leading to high or low perceived self-efficacy. Individual differences in perceived self-efficacy have been shown to be better predictors of performance than previous achievement or ability and seem particularly important when individuals face adversity. The study investigated the nature of the association between academic self-efficacy (ASE) and academic resilience. Undergraduate student participants (N = 435) were exposed to an adverse situation case vignette describing either personal or vicarious academic adversity. ASE was measured pre-exposure and academic resilience was measured post-exposure. ASE was correlated with, and a significant predictor of, academic resilience and students exhibited greater academic resilience when responding to vicarious adversity compared to personal adversity. Identifying constructs that are related to resilience and establishing the precise nature of how such constructs influence academic resilience will assist the development of interventions aimed at promoting resilience in students. PMID:26640447

Resilience Building in Students: The Role of Academic Self-Efficacy

Directory of Open Access Journals (Sweden)

Simon eCassidy

2015-11-01

Full Text Available Self-efficacy relates to an individual’s perception of their capabilities. It has a clear self-evaluative dimension leading to high or low perceived self-efficacy. Individual differences in perceived self-efficacy have been shown to be better predictors of performance than previous achievement or ability and seem particularly important when individuals face adversity. The study investigated the nature of the association between academic self-efficacy (ASE academic resilience. Undergraduate student participants (N=435 were exposed to an adverse situation case vignette describing either personal or vicarious academic adversity. ASE was measured pre-exposure and academic resilience was measured post- exposure. ASE was correlated with, and a significant predictor of, academic resilience and students exhibited greater academic resilience when responding to vicarious adversity compared to personal adversity. Identifying constructs that are related to resilience and establishing the precise nature of how such constructs influence resilience will assist the development of interventions aimed at promoting resilience in students.

EDMS - Reaching the Million Mark

CERN Multimedia

2009-01-01

When Christophe Seith from the company Cegelec sat down to work on 14 May 2009 at 10:09 a.m. to create the EDMS document entitled "Rapport tournée PH semaine 20", little did he know that he would be the proud creator of the millionth EDMS document and the happy prize winner of a celebratory bottle of champagne to mark the occasion. In the run up to the creation of the millionth EDMS document the EDMS team had been closely monitoring the steady rise in the EDMS number generator, so as to ensure the switch from the six figured i.d. to seven figures would run smoothly and of course, to be able to congratulate the creator of the millionth EDMS document. From left to right: Stephan Petit (GS-ASE- EDS Section Leader), Christophe Delamare (GS- ASE Group Leader), Christophe Seith, creator of the millionth EDMS document, David Widegren, (GS-ASE- EPS Section Leader). The millionth EDMS document. For t...

Ação terapêutica do mebendazole (R 17635 em pacientes poliparasitados: resultados finais

Directory of Open Access Journals (Sweden)

Dirceu Wagner Carvalho de Souza

1973-08-01

Full Text Available O mebendazole (R 17635 foi testado no tratamento de pacientes, de ambos os sexos, portadores de helmintíases mistas; o grupo selecionado situava-se na faixa etária de 4 a 14 anos, constituindo-se de 140 pacientes necessariamente residentes em comunidades restritas. Cerca de 70% dos pacientes estavam infetados por pelo menos 3 helmintos (os demais pela associação de dois, dentre ancilostomídeos, Ascaris lumbricoides, Enterobius vermicularis, Taenia sp e Trichuris trichiura. O mebendazóle (R 17635 foi administrado em comprimidos de 100 mg, um 30 minutos antes do desjejum e outro 3 horas após o jantar, por 3 dias consecutivos, independentemente do peso corporal. Não foram observadas quaisquer evidências de reações indesejáveis imediatas ou tardias, que pudessem ser atribuídas à droga. O controle de cura foi efetuado mediante as técnicas de Willis e de Hoffman-Pons & Janer, em exames coprológicos realizados 7, 14 e 21 dias contados a partir do último dia do tratamento; nos portadores de teníase e oxiuríase procedeu-se, também, ao método do "anal-swab" durante 7 dias consecutivos, a partir do sétimo dia após o tratamento. Percentual de 100% de cura foi registrado para oxiuríase, tendo sido de 98% na ascaridíase e na triquiuríase e de 94.5% na ancilostomíase. De 9 pacientes com teníase, 8 apresentaram negativação dos exames; entretanto, os Autores insistem na necessidade de maiores estudos a este respeito, quanto aos aspectos técnico e estatístico. Não obstante, consideram demonstrada a real eficácia do mebendazole (R 17635 como droga anti-helmíntica polivalente.Mebendazole (R 17635 was tested in the treatment of mixed helminthiases in 140 male and female patients aged 4 to 14 years. These patients were necessarily treated by physicians visiting their restricted communities. Approximately 70% of the patients were infected by at least three, and the rest by only two, of the following helminths: hookworm, Ascaris

Performance improvement of 64-QAM coherent optical communication system by optimizing symbol decision boundary based on support vector machine

Science.gov (United States)

Chen, Wei; Zhang, Junfeng; Gao, Mingyi; Shen, Gangxiang

2018-03-01

High-order modulation signals are suited for high-capacity communication systems because of their high spectral efficiency, but they are more vulnerable to various impairments. For the signals that experience degradation, when symbol points overlap on the constellation diagram, the original linear decision boundary cannot be used to distinguish the classification of symbol. Therefore, it is advantageous to create an optimum symbol decision boundary for the degraded signals. In this work, we experimentally demonstrated the 64-quadrature-amplitude modulation (64-QAM) coherent optical communication system using support-vector machine (SVM) decision boundary algorithm to create the optimum symbol decision boundary for improving the system performance. We investigated the influence of various impairments on the 64-QAM coherent optical communication systems, such as the impairments caused by modulator nonlinearity, phase skew between in-phase (I) arm and quadrature-phase (Q) arm of the modulator, fiber Kerr nonlinearity and amplified spontaneous emission (ASE) noise. We measured the bit-error-ratio (BER) performance of 75-Gb/s 64-QAM signals in the back-to-back and 50-km transmission. By using SVM to optimize symbol decision boundary, the impairments caused by I/Q phase skew of the modulator, fiber Kerr nonlinearity and ASE noise are greatly mitigated.

Gravidez em paciente com microlitíase alveolar pulmonar grave Pregnancy in a patient with severe pulmonary alveolar microlithiasis

Directory of Open Access Journals (Sweden)

José Osmar Bezerra de Souza Filho

2008-10-01

Full Text Available A microlitíase alveolar pulmonar (MAP é uma doença rara que atinge ambos os pulmões, caracterizada pela presença de pequenos cálculos (fosfato de cálcio nos espaços alveolares. Relatamos o caso de uma paciente do sexo feminino, de 26 anos, cujo diagnóstico foi confirmado com base nos achados marcantes na radiografia de tórax e tomografia computadorizada de alta resolução. A paciente, gestante de 28 semanas, retornou ao hospital 10 meses após o diagnóstico apresentando insuficiência respiratória hipoxêmica e com distúrbio ventilatório restritivo grave à espirometria. Após completadas 32 semanas e 4 dias de gestação, foi submetida aparto cesariano, com sucesso para mãe e filha. A MAP tem evolução clínica variável. Tem provável caráter autossômico recessivo e associação com história familiar positiva. A etiologia é incerta, e muitos autores especulam que haja um defeito enzimático local responsável pelo acúmulo intra-alveolar de cálcio. Relatos de pacientes com MAP que engravidaram são excepcionais, sendo o presente caso o primeiro descrito no Brasil. O curso dessa doença costuma ser lentamente progressivo, e os pacientes geralmente falecem devido à insuficiência cardiorrespiratória. O presente caso ilustra a necessidade de se oferecer aconselhamento genético e orientações sobre o risco de gravidez às pacientes, especialmente em casos de doença avançada. Atualmente, a única terapia efetiva é o transplante pulmonar.Pulmonary alveolar microlithiasis (PAM is a rare disease that affects both lungs. It is characterized by the presence of small calculi (calcium phosphate within the alveolar spaces. We report the case of a 26-year-old female whose diagnosis was based on characteristic findings on chest X-rays and high-resolution computed tomography scans. The patient, 28 weeks pregnant, was rehospitalized 10 months after the diagnosis, presenting hypoxemic acute respiratory failure and severe restrictive

Plant physiology and proteomics reveals the leaf response to drought in alfalfa (Medicago sativa L.).

Science.gov (United States)

Aranjuelo, Iker; Molero, Gemma; Erice, Gorka; Avice, Jean Christophe; Nogués, Salvador

2011-01-01

Despite its relevance, protein regulation, metabolic adjustment, and the physiological status of plants under drought is not well understood in relation to the role of nitrogen fixation in nodules. In this study, nodulated alfalfa plants were exposed to drought conditions. The study determined the physiological, metabolic, and proteomic processes involved in photosynthetic inhibition in relation to the decrease in nitrogenase (N(ase)) activity. The deleterious effect of drought on alfalfa performance was targeted towards photosynthesis and N(ase) activity. At the leaf level, photosynthetic inhibition was mainly caused by the inhibition of Rubisco. The proteomic profile and physiological measurements revealed that the reduced carboxylation capacity of droughted plants was related to limitations in Rubisco protein content, activation state, and RuBP regeneration. Drought also decreased amino acid content such as asparagine, and glutamic acid, and Rubisco protein content indicating that N availability limitations were caused by N(ase) activity inhibition. In this context, drought induced the decrease in Rubisco binding protein content at the leaf level and proteases were up-regulated so as to degrade Rubisco protein. This degradation enabled the reallocation of the Rubisco-derived N to the synthesis of amino acids with osmoregulant capacity. Rubisco degradation under drought conditions was induced so as to remobilize Rubisco-derived N to compensate for the decrease in N associated with N(ase) inhibition. Metabolic analyses showed that droughted plants increased amino acid (proline, a major compound involved in osmotic regulation) and soluble sugar (D-pinitol) levels to contribute towards the decrease in osmotic potential (Ψ(s)). At the nodule level, drought had an inhibitory effect on N(ase) activity. This decrease in N(ase) activity was not induced by substrate shortage, as reflected by an increase in total soluble sugars (TSS) in the nodules. Proline accumulation

Measured and calculated K-fluorescence effects on the MTF of an amorphous-selenium based CCD x-ray detector.

Science.gov (United States)

Hunter, David M; Belev, George; Kasap, Safa; Yaffe, Martin J

2012-02-01

Theoretical reasoning suggests that direct conversion digital x-ray detectors based upon photoconductive amorphous-selenium (a-Se) could attain very high values of the MTF (modulation transfer function) at spatial frequencies well beyond 20 cycles mm(-1). One of the fundamental factors affecting resolution loss, particularly at x-ray energies just above the K-edge of selenium (12.66 keV), is the K-fluorescence reabsorption mechanism, wherein energy can be deposited in the detector at locations laterally displaced from the initial x-ray interaction site. This paper compares measured MTF changes above and below the Se K-edge of a CCD based a-Se x-ray detector with theoretical expectations. A prototype 25 μm sampling pitch (Nyquist frequency = 20 cycles mm(-1), 200 μm thick a-Se layer based x-ray detector, utilizing a specialized CCD readout device (200 × 400 area array), was used to make edge images with monochromatic x-rays above and below the K-edge of Se. A vacuum double crystal monochromator, exposed to polychromatic x-rays from a synchrotron, formed the monochromatic x-ray source. The monochromaticity of the x-rays was 99% or better. The presampling MTF was determined using the slanted edge method. The theory modeling the MTF performance of the detector includes the basic x-ray interaction physics in the a-Se layer as well as effects related to the operation of the CCD and charge trapping at a blocking layer present at the CCD/a-Se interface. The MTF performance of the prototype a-Se CCD was reduced from the theoretical value prescribed by the basic Se x-ray interaction physics, principally by the presence of a blocking layer. Nevertheless, the K-fluorescence reduction in the MTF was observed, approximately as predicted by theory. For the CCD prototype detector, at five cycles mm(-1), there was a 14% reduction of the MTF, from a value of 0.7 below the K-edge of Se, to 0.6 just above the K-edge. The MTF of an a-Se x-ray detector has been measured using