WorldWideScience

Sample records for science institute ssi

  1. Science teachers teaching socioscientific issues (SSI): Four case studies

    Science.gov (United States)

    Lee, Hyunju

    Socioscientific issues (SSI) are a class of issues that represent the social, ethical, and moral aspects of science in society. The need for the inclusion of SSI into science curricula has been generally accepted, but relatively few science teachers have incorporated SSI into their courses. Most science teachers feel that their most important task by far is to teach the principles of science, and any substantive pedagogical changes represent a burden. However, there are some teachers who address SSI out of personal initiatives. This dissertation study investigates four high school science teachers who address SSI out of their own initiative and explores their deeper inspirations, values, philosophies, and personal ideals that lead them to teach SSI. The overall approach is based on essentialist methodology (Witz, Goodwin, Hart, & Thomas, 2001; Witz, 2006a) with its focus on "the participant as ally" and "essentialist portraiture." The primary data source is four to six in-depth interviews with individual teachers (about 40-90 minutes for each interview). The interviews are complemented by extensive classroom observations of individual teachers' teaching SSI and by document analysis (including teaching materials, rubrics, student group projects and journals, etc.). There are two major findings. First, the teachers' deeper values and ideals are a source of larger inspiration that plays a significant role in changing their teaching practice. This inspiration may involve higher aspects (e.g., deep concern for students' development, unselfishness, caring, etc.) and commitment. Their teaching represents an integration of their personal experiences, values, concerns, and worldviews, which forms a larger inspiration for teaching. Teaching SSI is a part of this larger process. Second, the current curriculum reforms (STS, SSI, and NOS) only suggest theoretical ideals and do not effectively touch teachers' deeper values and ideals. Basically, the teachers are doing what they

  2. Using Social Media to Promote Pre-Service Science Teachers' Practices of Socio-Scientific Issue (SSI) - Based Teaching

    Science.gov (United States)

    Pitiporntapin, Sasithep; Lankford, Deanna Marie

    2015-01-01

    This paper addresses using social media to promote pre-service science teachers' practices of Socio-Scientific Issue (SSI) based teaching in a science classroom setting. We designed our research in two phases. The first phase examined pre-service science teachers' perceptions about using social media to promote their SSI-based teaching. The…

  3. Measurement Model of Reasoning Skills among Science Students Based on Socio Scientific Issues (SSI

    Directory of Open Access Journals (Sweden)

    MOHD AFIFI BAHURUDIN SETAMBAH

    2018-05-01

    Full Text Available The lack of reasoning skills has been recognized as one of the contributing factors to the declined achievement in the Trends in Mathematics and Science Studies (TIMSS and Programme for International Student Assessment (PISA assessments in Malaysia. The use of socio-scientific issues (SSI as a learning strategy offers the potential of improving the level of students' reasoning skills and consequently improves students’ achievement in science subjects. This study examined the development of a measurement model of reasoning skills among science students based on SSI using the analysis of moment structure (AMOS approach before going to second level to full structured equation modelling (SEM. A total of 450 respondents were selected using a stratified random sampling. Results showed a modified measurement model of reasoning skills consisting of the View Knowledge (VK was as a main construct. The items that measure the level of pre-reflection of students fulfilled the elements of unidimensionality, validity, and reliability. Although the level of student reasoning skills was still low but this development of measurement model could be identified and proposed teaching methods that could be adopted to improve students’ reasoning skills.

  4. Resistance to Dialogic Discourse in SSI Teaching: The Effects of an Argumentation-Based Workshop, Teaching Practicum, and Induction on a Preservice Science Teacher

    Science.gov (United States)

    Kilinc, Ahmet; Demiral, Umit; Kartal, Tezcan

    2017-01-01

    Teaching socioscientific issues (SSI) necessitates dialogic discourse activities. However, a majority of science teachers prefer monologic discourse in SSI contexts. In addition, some of these teachers are resistant to change (from monologic to dialogic discourse) despite certain professional development attempts. The purpose of the present…

  5. The TANF/SSI connection.

    Science.gov (United States)

    Wamhoff, Steve; Wiseman, Michael

    receiving benefits in TANF-related Separate State Programs (SSPs). SSPs are assistance programs that are administered by TANF agencies but are paid for wholly from state funds. When the programs are conducted in a manner consistent with federal regulations, the money states spend on SSPs counts toward federal maintenance-of-effort (MOE) requirements, under which states must sustain a certain level of contribution to the costs of TANF and approved related activities. SSPs are used for a variety of purposes, including support of families who are in the process of applying for SSI. Until very recently, families receiving cash benefits through SSPs were not subject to TANF's work participation requirements. This article contributes to analysis of the interaction between TANF and SSI by evaluating the financial consequences of TANF-to-SSI transfer and developing new estimates of both the prevalence of receipt of SSI benefits among families receiving cash assistance from TANF and the proportion of new SSI awards that go to adults and children residing in families receiving TANF or TANF-related benefits in SSPs. Using data from the Urban Institute's Welfare Rules Database, we find that by 2003 an SSI award for a child in a three-person family dependent on TANF increased family income by 103.5 percent on average across states; an award to the adult in such a family increased income by 115.4 percent. The gain from both child and adult transfers increased by about 6 percent between 1996 (the eve of the welfare reform that produced TANF) and 2003. Using data from the Department of Health and Human Services' TANF/SSP Recipient Family Characteristics Survey, we estimate that 16 percent of families receiving TANF/SSP support in federal fiscal year 2003 included an adult or child SSI recipient. This proportion has increased slightly since fiscal year 2000. The Social Security Administration's current procedures for tabulating characteristics of new SSI awardees do not recognize SSP

  6. SSI's review of ASAR Oskarshamn 1

    International Nuclear Information System (INIS)

    Godaas, T.

    1995-11-01

    Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Oskarshamn 1. The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs

  7. Development of a surgical site infection (SSI) surveillance system, calculation of SSI rates and specification of important factors affecting SSI in a digestive organ surgical department.

    Science.gov (United States)

    Kimura, Koji; Sawa, Akihiro; Akagi, Shinji; Kihira, Kenji

    2007-06-01

    We have developed an original system to conduct surgical site infection (SSI) surveillance. This system accumulates SSI surveillance information based on the National Nosocomial Infections Surveillance (NNIS) System and the Japanese Nosocomial Infections Surveillance (JNIS) System. The features of this system are as follows: easy input of data, high generality, data accuracy, SSI rate by operative procedure and risk index category (RIC) can be promptly calculated and compared with the current NNIS SSI rate, and the SSI rates and accumulated data can be exported electronically. Using this system, we monitored 798 patients in 24 operative procedure categories in the Digestive Organs Surgery Department of Mazda Hospital, Mazda Motor Corporation, from January 2004 through December 2005. The total number and rate of SSI were 47 and 5.89%, respectively. The SSI rates of 777 patients were calculated based on 15 operative procedure categories and Risk Index Categories (RIC). The highest SSI rate was observed in the rectum surgery of RIC 1 (30%), followed by the colon surgery of RIC3 (28.57%). About 30% of the isolated infecting bacteria were Enterococcus faecalis, Staphylococcus aureus, Klebsiella pneumoniae, Pseudomonas aeruginosa, and Escherichia coli. Using quantification theory type 2, the American Society of Anesthesiology score (4.531), volume of hemorrhage under operation (3.075), wound classification (1.76), operation time (1.352), and history of diabetes (0.989) increased to higher ranks as factors for SSI. Therefore, we evaluated this system as a useful tool in safety control for operative procedures.

  8. The SSI reviews of the SKB research programs 1992

    International Nuclear Information System (INIS)

    Jensen, Mikael.

    1993-02-01

    The Swedish Radiation Protection Institute (SSI) has scrutinized the research programs 1992 of the Swedish Nuclear Fuel and Waste Management Co (SKB). The judgement is that SKB has both the competence and resources to perform the presented research programs

  9. SSI's review of ASAR Ringhals 2, 1994

    International Nuclear Information System (INIS)

    Hofvander, P.

    1995-11-01

    Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Ringhals 2, 1994 . The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs

  10. 49 CFR 15.13 - Marking SSI.

    Science.gov (United States)

    2010-10-01

    ... SSI. (a) Marking of paper records. In the case of paper records containing SSI, a covered person must... limitation statement on the bottom, of— (1) The outside of any front and back cover, including a binder cover... types of records. In the case of non-paper records that contain SSI, including motion picture films...

  11. Dicty_cDB: SSI339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY

  12. Turkish preservice science teachers' socioscientific issues-based teaching practices in middle school science classrooms

    Science.gov (United States)

    Genel, Abdulkadir; Sami Topçu, Mustafa

    2016-01-01

    Background: Despite a growing body of research and curriculum reforms including socioscientific issues (SSI) across the world, how preservice science teachers (PST) or in-service science teachers can teach SSI in science classrooms needs further inquiry. Purpose: The purpose of this study is to describe the abilities of PSTs to teach SSI in middle school science classrooms, and the research question that guided the present study is: How can we characterize Turkish PSTs' SSI-based teaching practices in middle school science classrooms (ages 11-14)? Sample: In order to address the research question of this study, we explored 10 Turkish PSTs' SSI-based teaching practices in middle school science classrooms. A purposeful sampling strategy was used, thus, PSTs were specifically chosen because they were ideal candidates to teach SSI and to integrate SSI into the science curricula since they were seniors in the science education program who had to take the field experience courses. Design and method: The participants' SSI teaching practices were characterized in light of qualitative research approach. SSI-based teaching practices were analyzed, and the transcripts of all videotape recordings were coded by two researchers. Results: The current data analysis describes Turkish PSTs' SSI-based teaching practices under five main categories: media, argumentation, SSI selection and presentation, risk analysis, and moral perspective. Most of PSTs did not use media resources in their lesson and none of them considered moral perspective in their teaching. While the risk analyses were very simple and superficial, the arguments developed in the classrooms generally remained at a simple level. PSTs did not think SSI as a central topic and discussed these issues in a very limited time and at the end of the class period. Conclusions: The findings of this study manifest the need of the reforms in science education programs. The present study provides evidence that moral, media

  13. Dicty_cDB: SSI473 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI473 (Link to dictyBase) - - - - SSI473Z (Link to Original s...ite) - - SSI473Z 416 - - - - Show SSI473 Library SS (Link to library) Clone ID SSI473 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...uences producing significant alignments: (bits) Value N M77492 |M77492.1 Dictyost...Hdk03092 Head kidney cDNA library Ictalurus punctatus cDNA 5' similar to Dual specificity phosphatase 10 (DU

  14. SSI's review of SKB's RDandD Program 2007

    International Nuclear Information System (INIS)

    Wiebert, Anders

    2008-05-01

    In this report, the Swedish Radiation Protection Authority (SSI) provides a review of the Swedish Nuclear Fuel and Waste Managements Company's (SKB) RDandD programme 2007. The report is a statement from SSI in the matter submitted earlier to SKI. In the review, SSI comments SKB's feedback to the continuous research and development program on the basis of the latest carried out safety analysis, SR-Can and the biosphere research. In the statement SSI points to a number of issues that need to be resolved before a licence application is handed in. SSI suggests that the Government asks for complements to the RDandD programme 2007. According to SSI, the programme concerning low and intermediate level waste and decommissioning of the nuclear power plants does not fulfil the requirements established by the Act on Nuclear Activities. Neither does the programme fulfil the expectations set by the Government decision regarding the RDandD programme 2004. SSI suggests that the programme should be complemented

  15. Dicty_cDB: SSI468 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI468 (Link to dictyBase) - - - Contig-U16310-1 SSI468Z (Link... to Original site) - - SSI468Z 300 - - - - Show SSI468 Library SS (Link to library) Clone ID SSI468 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16310-1 Original site URL http://dict...gnments: (bits) Value N AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strai...NCING IN PROGRESS ***, 3 unordered pieces. 46 6.0 2 BM029242 |BM029242.1 IpSkn00196 Skin cDNA library Ictalu

  16. Turkish Preservice Science Teachers' Socioscientific Issues-Based Teaching Practices in Middle School Science Classrooms

    Science.gov (United States)

    Genel, Abdulkadir; Topçu, Mustafa Sami

    2016-01-01

    Background: Despite a growing body of research and curriculum reforms including socioscientific issues (SSI) across the world, how preservice science teachers (PST) or in-service science teachers can teach SSI in science classrooms needs further inquiry. Purpose: The purpose of this study is to describe the abilities of PSTs to teach SSI in middle…

  17. Dicty_cDB: SSI527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI527 (Link to dictyBase) - - - Contig-U16209-1 SSI527F (Link... to Original site) SSI527F 685 - - - - - - Show SSI527 Library SS (Link to library) Clone ID SSI527 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...N BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDNA 5' ...6357825 5' similar to SW:RSP4_CHICK P50890 40S RIBOSOMAL PROTEIN SA ;, mRNA sequence. 46 4e-06 2 BQ096846 |BQ096846.1 IfHdk00487 Ict

  18. Dicty_cDB: SSI485 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ate cortex cDNA, RIKEN full-length enriched library, clone:A830088K09, 3' end partial sequence. 42 5.7 1 AC068663 |AC068663.4 Mus mu...SS (Link to library) SSI485 (Link to dictyBase) - - - Contig-U14077-1 SSI485F (Link... to Original site) SSI485F 438 - - - - - - Show SSI485 Library SS (Link to library) Clone ID SSI485 (Link to dic...cia MC0-3 ... 115 4e-25 EF100191_35( EF100191 |pid:none) Uncultured marine bacterium HF10_... 115 5e-25 AP00...9385_2657( AP009385 |pid:none) Burkholderia multivorans ATCC 1... 114 1e-24 BC056

  19. SSI's Review of RD and D Programme 98

    International Nuclear Information System (INIS)

    1999-06-01

    The report contains SSI's review of SKB's research programme and SSI's background review PM. In the interest of transparency of the site selection process, SSI has made requirements concerning additional reporting from SKB, prior to the next step in the site selection process, and advice to the government regarding the need for clarification on a number of issues

  20. A Persian-version of the stuttering severity instrument-version four (SSI-4): How the new additions to SSI-4 complement its stuttering severity score?

    Science.gov (United States)

    Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood

    The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to translate SSI-4 into Persian language and to discuss its relative and absolute reliability as well as its criterion validity for Persian adults who stutter (PWS). We also aimed to study how the new subjective self-reports of the SSI-4 complement the stuttering severity score obtained from the SSI-3 or the SSI-4. The cross-cultural guideline recommended by the International Quality of Life Assessment project was used to translate the SSI-4 into Persian language. Thirty five PWS from ages 17 to 42 were recruited and 10 speech and language pathologists assessed their stuttering severity using either the SSI-4 or stuttering severity ratings (SR) to test validity and reliability of the Persian translated version. A very high inter-judge relative reliability along with a poor absolute inter-judge reliability was found for the SSI-4 scores. The results were more promising for the intra-judge absolute reliability. Test-retest reliability of the complementary questions to the SSI-4 was also found acceptable. However, no strong relationship was found between the SSI-4 scores and its complementary questions. The Persian version of the SSI-4 can be used reliably by trained SLPs for research and clinical purposes, but not to document small changes in stuttering severity. We argue that the response of participants to the complementary self-report questions should also be considered in calculating their stuttering severity score. Copyright © 2018 Elsevier Inc. All rights reserved.

  1. Multi-equilibrium property of metabolic networks: SSI module

    Directory of Open Access Journals (Sweden)

    Chen Luonan

    2011-06-01

    Full Text Available Abstract Background Revealing the multi-equilibrium property of a metabolic network is a fundamental and important topic in systems biology. Due to the complexity of the metabolic network, it is generally a difficult task to study the problem as a whole from both analytical and numerical viewpoint. On the other hand, the structure-oriented modularization idea is a good choice to overcome such a difficulty, i.e. decomposing the network into several basic building blocks and then studying the whole network through investigating the dynamical characteristics of the basic building blocks and their interactions. Single substrate and single product with inhibition (SSI metabolic module is one type of the basic building blocks of metabolic networks, and its multi-equilibrium property has important influence on that of the whole metabolic networks. Results In this paper, we describe what the SSI metabolic module is, characterize the rates of the metabolic reactions by Hill kinetics and give a unified model for SSI modules by using a set of nonlinear ordinary differential equations with multi-variables. Specifically, a sufficient and necessary condition is first given to describe the injectivity of a class of nonlinear systems, and then, the sufficient condition is used to study the multi-equilibrium property of SSI modules. As a main theoretical result, for the SSI modules in which each reaction has no more than one inhibitor, a sufficient condition is derived to rule out multiple equilibria, i.e. the Jacobian matrix of its rate function is nonsingular everywhere. Conclusions In summary, we describe SSI modules and give a general modeling framework based on Hill kinetics, and provide a sufficient condition for ruling out multiple equilibria of a key type of SSI module.

  2. 20 CFR 416.266 - Continuation of SSI status for Medicaid

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Continuation of SSI status for Medicaid 416... Disabling Impairment § 416.266 Continuation of SSI status for Medicaid If we stop your benefits because of... to be considered an SSI recipient for purposes of eligibility for Medicaid during the time it takes...

  3. "Jazz Ruuler" toob dzhässi Rock Cafesse

    Index Scriptorium Estoniae

    2008-01-01

    Muhu tulevikumuusika festival "Ju jääb" ja Rock Cafe avavad uue dzhässiürituste sarja "Jazz Ruuler", mille raames soovitakse igal kuul Eesti publiku ette tuua mõni maailma dzhässi tuntud artist. Kontserdist 24. jaan. Rock Cafés

  4. Secondary School Students' Understanding of Science and Their Socioscientific Reasoning

    Science.gov (United States)

    Karahan, Engin; Roehrig, Gillian

    2017-08-01

    Research in socioscientific issue (SSI)-based interventions is relatively new (Sadler in Journal of Research in Science Teaching 41:513-536, 2004; Zeidler et al. in Journal of Research in Science Teaching 46:74-101, 2009), and there is a need for understanding more about the effects of SSI-based learning environments (Sadler in Journal of Research in Science Teaching 41:513-536, 2004). Lee and Witz (International Journal of Science Education 31:931-960, 2009) highlighted the need for detailed case studies that would focus on how students respond to teachers' practices of teaching SSI. This study presents case studies that investigated the development of secondary school students' science understanding and their socioscientific reasoning within SSI-based learning environments. A multiple case study with embedded units of analysis was implemented for this research because of the contextual differences for each case. The findings of the study revealed that students' understanding of science, including scientific method, social and cultural influences on science, and scientific bias, was strongly influenced by their experiences in SSI-based learning environments. Furthermore, multidimensional SSI-based science classes resulted in students having multiple reasoning modes, such as ethical and economic reasoning, compared to data-driven SSI-based science classes. In addition to portraying how participants presented complexity, perspectives, inquiry, and skepticism as aspects of socioscientific reasoning (Sadler et al. in Research in Science Education 37:371-391, 2007), this study proposes the inclusion of three additional aspects for the socioscientific reasoning theoretical construct: (1) identification of social domains affecting the SSI, (2) using cost and benefit analysis for evaluation of claims, and (3) understanding that SSIs and scientific studies around them are context-bound.

  5. First-in-human safety and immunogenicity investigations of three adjuvanted reduced dose inactivated poliovirus vaccines (IPV-Al SSI) compared to full dose IPV Vaccine SSI when given as a booster vaccination to adolescents with a history of IPV vaccination at 3, 5, 12months and 5years of age.

    Science.gov (United States)

    Lindgren, Line M; Tingskov, Pernille N; Justesen, Annette H; Nedergaard, Bettina S; Olsen, Klaus J; Andreasen, Lars V; Kromann, Ingrid; Sørensen, Charlotte; Dietrich, Jes; Thierry-Carstensen, Birgit

    2017-01-23

    There is a demand of affordable IPV in the World. Statens Serum Institut (SSI) has developed three reduced dose IPV formulations adsorbed to aluminium hydroxide; 1/3 IPV-Al, 1/5 IPV-Al and 1/10 IPV-Al SSI, and now report the results of the first investigations in humans. 240 Danish adolescents, aged 10-15years, and childhood vaccinated with IPV were booster vaccinated with 1/3 IPV-Al, 1/5 IPV-Al, 1/10 IPV-Al or IPV Vaccine SSI. The booster effects (GMTRs) of the three IPV-Al SSI were compared to IPV Vaccine SSI, and evaluated for non-inferiority. The pre-vaccination GMTs were similar across the groups; 926 (type 1), 969 (type 2) and 846 (type 3) in the total trial population. The GMTRs by poliovirus type and IPV formulation were: Type 1: 17.0 (1/3 IPV-Al), 13.0 (1/5 IPV-Al), 7.1 (1/10 IPV-Al) and 42.2 (IPV Vaccine SSI). Type 2: 12.5 (1/3 IPV-Al), 13.1 (1/5 IPV-Al), 7.6 (1/10 IPV-Al) and 47.8 (IPV Vaccine SSI). Type 3: 14.5 (1/3 IPV-Al), 16.2 (1/5 IPV-Al), 8.9 (1/10 IPV-Al) and 62.4 (IPV Vaccine SSI) Thus, the three IPV-Al formulations were highly immunogenic, but inferior to IPV Vaccine SSI, in this booster vaccination trial. No SAE and no AE of severe intensity occurred. 59.2% of the subjects reported at least one AE. Injection site pain was the most frequent AE in all groups; from 24.6% to 43.3%. Injection site redness and swelling frequencies were<5% in most and<10% in all groups. The most frequent systemic AEs were fatigue (from 8.2% to 15.0%) and headache (from 15.0% to 28.3%). Most AEs were of mild intensity. In conclusion, the three IPV-Al SSI were safe in adolescents and the booster effects were satisfactory. ClinicalTrials.gov registration number: NCT02280447. Copyright © 2016. Published by Elsevier Ltd.

  6. Influence of different boundary conditions on analysis of SSI

    International Nuclear Information System (INIS)

    Wang Jiachun

    2005-01-01

    In the discussions of structural response to earthquakes, it has been assumed that the foundation medium is very stiff and that the seismic motions applied at the structure support points are the same as the free-field earthquake motions at those locations; in other words, the effects of soil structure interaction (SSI) have been neglected. However, its effects can be significant when the structure supported on a soft soil. Structures on the ground are affected by ground motion when there is seismic loading. The inability of the foundation to resist to deformation of soil would cause huge damages on the structures. The different codes and boundary conditions affect on analysis results of SSI. A comparison of the reactor buildings response as predicted by CLASSI and FLUSH shows substantial differences. To absorb, rather than reflect, the outwardly radiated energy, transmitting boundary conditions and soil structure interface should be taken into consideration in analysis of SSI. The paper discusses influence of several different boundary conditions on analysis of SSI. (author)

  7. Effective Strategies To Improve the Employment of SSI/SSDI Participants.

    Science.gov (United States)

    Radtke, Jean, Ed.

    This document is for administrators, rehabilitation counselors, and other professionals who support the employment of Social Security Disability Insurance (SSDI) beneficiaries and Supplemental Security Income (SSI) recipients with disabilities. It contains strategies for vocational rehabilitation (VR) programs to improve an SSI or SSDI…

  8. Pre-service Science Teachers’ Self-efficacy Beliefs to Teach Socio-scientific Issues

    OpenAIRE

    Muğaloğlu, Ebru Z.; Küçük, Zerrin Doğança; Güven, Devrim

    2016-01-01

    This study aims to examine self-efficacy of pre-service science teachers to teach socio-scientific issues (SSI). Twenty-three senior pre-service science teachers participated in the study. Science Teaching Efficacy Belief Instrument (STEBI) was modified with an emphasis on SSI rather than scientific issues. The modified STEBI was applied to the participants before and after the intervention. As for the six-week intervention, three modules, which focused on understanding nature of SSI, teachin...

  9. Impact of a surgical site infection (SSI) surveillance program in orthopedics and traumatology.

    Science.gov (United States)

    Mabit, C; Marcheix, P S; Mounier, M; Dijoux, P; Pestourie, N; Bonnevialle, P; Bonnomet, F

    2012-10-01

    Surveillance of surgical site infections (SSI) is a priority. One of the fundamental principles for the surveillance of SSI is based on receiving effective field feedback (retro-information). The aim of this study was to report the results of a program of SSI surveillance and validate the hypothesis that there is a correlation between creating a SSI surveillance program and a reduction in SSI. The protocol was based on the weekly collection of surveillance data obtained directly from the different information systems in different departments. A delay of 3 months was established before extraction and analysis of data and information from the surgical teams. The NNIS index (National Nosocomial Infections Surveillance System) developed by the American surveillance system and the reduction of length of hospital stay index Journées d'hospitalisation évitées (JHE). Since the end of 2009, 7156 surgical procedures were evaluated (rate of inclusion 97.3%), and 84 SSI were registered with a significant decrease over time from 1.86% to 0.66%. A total of 418 days of hospitalization have been saved since the beginning of the surveillance system. Our surveillance system has three strong points: follow-up is continuous, specifically adapted to orthopedic traumatology and nearly exhaustive. The extraction of data directly from hospital information systems effectively improves the collection of data on surgical procedures. The implementation of a SSI surveillance protocol reduces SSI. Level III. Prospective study. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  10. Psychometric properties and clinical utility of the Scale for Suicidal Ideation (SSI in adolescents

    Directory of Open Access Journals (Sweden)

    Ruuttu Titta

    2005-02-01

    Full Text Available Abstract Background Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. Methods 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Results Cronbach's α for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. Conclusions SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.

  11. Psychometric properties and clinical utility of the Scale for Suicidal Ideation (SSI) in adolescents.

    Science.gov (United States)

    Holi, Matti M; Pelkonen, Mirjami; Karlsson, Linnea; Kiviruusu, Olli; Ruuttu, Titta; Heilä, Hannele; Tuisku, Virpi; Marttunen, Mauri

    2005-02-03

    Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI) is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Cronbach's alpha for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC) curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.

  12. The role of the cerebellum in auditory processing using the SSI test A participação do cerebelo no processamento auditivo com o uso do teste SSI

    Directory of Open Access Journals (Sweden)

    Patricia Maria Sens

    2011-10-01

    Full Text Available The Synthetic Sentence Identification (SSI test assesses central auditory pathways by measuring auditory and visual sensitivity and testing selective attention. Cerebellum activation in auditory attention and sensorial activity modulation have already been described. Assessing patients with cerebellar lesions alone using the SSI test can confirm the role of the cerebellum in auditory processing. AIM: To evaluate the role of the cerebellum in auditory processing in individuals with normal hearing and in those with chronic cerebellum lesions, using the SSI test. MATERIALS AND METHODS: Cross-sectional cohort study. A study group comprising 18 patients with chronic cerebellar lesion and a control group of 20 healthy individuals were assessed. The SSI test was applied in an Ipsilateral Competitive Message (ICM and Contralateral Competitive Message (CCM modes. To compare the results between groups, we used the chi-square test for qualitative variables. RESULTS: A statistically significant difference was found between the study and control groups using the ICM mode of the SSI test (p=0.035, but not in the CCM mode (p=0.083. CONCLUSION: The results on the SSI confirmed cerebellar participation in auditory processing in individuals with chronic cerebellar lesions and in those with normal hearing assessed in this study.O teste de Identificação de Sentenças Sintéticas (SSI avalia as vias centrais da audição utilizando a sensibilidade auditiva e visual e testando a atenção seletiva. A ativação do cerebelo na atenção auditiva, assim como na modulação da atividade sensorial, já é descrita. Avaliar pacientes com lesão exclusiva do cerebelo por meio do teste SSI pode confirmar ou refutar a hipótese da participação do cerebelo no processamento auditivo. OBJETIVO: Avaliar pelo teste SSI a participação do cerebelo no processamento auditivo, em indivíduos com lesão crônica do cerebelo e audição normal. MATERIAL E MÉTODOS: Estudo coorte

  13. DoSSiER: Database of Scientific Simulation and Experimental Results

    CERN Document Server

    Wenzel, Hans; Genser, Krzysztof; Elvira, Daniel; Pokorski, Witold; Carminati, Federico; Konstantinov, Dmitri; Ribon, Alberto; Folger, Gunter; Dotti, Andrea

    2017-01-01

    The Geant4, GeantV and GENIE collaborations regularly perform validation and regression tests for simulation results. DoSSiER (Database of Scientific Simulation and Experimental Results) is being developed as a central repository to store the simulation results as well as the experimental data used for validation. DoSSiER can be easily accessed via a web application. In addition, a web service allows for programmatic access to the repository to extract records in json or xml exchange formats. In this article, we describe the functionality and the current status of various components of DoSSiER as well as the technology choices we made.

  14. NUCOR Institute for Life Sciences

    International Nuclear Information System (INIS)

    Anon.

    1984-01-01

    The article discusses the Nucor Institute for Life Sciences. The institute was previously part of Nucor, but is now an autonomous institute of the University of Pretoria. The task of the institute is to promote the application of radioisotopes and radiation techniques in medicine and biology. Research projects of the institute are shortly discussed

  15. Prerequisites concerning SSI:s review of applications for an encapsulation facility and a repository for spent nuclear fuel; Utgaangspunkter foer SSI:s granskning av ansoekan foer en inkapslingsanlaeggning och ett slutfoervar foer anvaent kaernbraensle

    Energy Technology Data Exchange (ETDEWEB)

    Oehlen, Elisabeth

    2006-09-15

    The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect.

  16. 20 CFR 416.1816 - Information we need concerning marriage when you apply for SSI.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Information we need concerning marriage when you apply for SSI. 416.1816 Section 416.1816 Employees' Benefits SOCIAL SECURITY ADMINISTRATION....1816 Information we need concerning marriage when you apply for SSI. When you apply for SSI benefits...

  17. Hyper- and hyporesponsive mutant forms of the Saccharomyces cerevisiae Ssy1 amino acid sensor

    DEFF Research Database (Denmark)

    Poulsen, Peter; Gaber, Richard F.; Kielland-Brandt, Morten

    2008-01-01

    The Saccharomyces cerevisiae integral membrane protein Ssy1p functions with Ssy5p and Ptr3p to sense extracellular amino acids. Signal transduction leads to processing and nuclear localization of Stp1p and Stp2p, transcriptional activators of many amino acid transporter genes. Ssy1p is structural...

  18. Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility, December 2010

    Data.gov (United States)

    Social Security Administration — The Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility (December 2010) is produced using the data found in Table 10 from the SSI...

  19. Reforming Science and Mathematics Education

    Science.gov (United States)

    Lagowski, J. J.

    1995-09-01

    Since 1991, the National Science Foundation has signed cooperative agreements with 26 states to undertake ambitious and comprehensive initiatives to reform science, mathematics, and technology education. Collectively, those agreements are known as the State Systemic Initiatives (SSI's). Two complimentary programs, The Urban and Rural Systemic Initiatives (USI's and RSI's), address similar reforms in the nation's largest cities and poorest rural areas. The SSI Program departs significantly from past NSF practice in several ways. The funding is for a longer term and is larger in amount, and the NSF is taking a more activist role, seeking to leverage state and private funds and promote the coordination of programs within states. The Initiatives also have a stronger policy orientation than previous NSF programs have had. The NSF strategy is a reflection of the growing and widely held view that meaningful reforms in schools are most likely to be achieved through state initiatives that set clear and ambitious learning goals and standards; align all of the available policy levers in support of reform; stimulate school-level initiatives; and mobilize human and financial resources to support these changes. Two premises underlie systemic reform: (1) all children can meet significantly higher standards if they are asked to do so and given adequate opportunities to master the content, and (2) state and local policy changes can create opportunities by giving schools strong and consistent signals about the changes in practice and performance that are expected. Because this is an enormous investment of Federal resources that is intended to bring about deep, systemic improvement in the nation's ability to teach science and mathematics effectively, the NSF has contracted with a consortium of independent evaluators to conduct a review of the program. The first of the SSI's were funded in 1991, sufficiently long ago to begin to formulate some initial impressions of their impact. Take

  20. Secondary School Students' Understanding of Science and Their Socioscientific Reasoning

    Science.gov (United States)

    Karahan, Engin; Roehrig, Gillian

    2017-01-01

    Research in socioscientific issue (SSI)-based interventions is relatively new (Sadler in "Journal of Research in Science Teaching" 41:513-536, 2004; Zeidler et al. in "Journal of Research in Science Teaching" 46:74-101, 2009), and there is a need for understanding more about the effects of SSI-based learning environments…

  1. Learning Science Content through Socio-Scientific Issues-Based Instruction: A Multi-Level Assessment Study

    Science.gov (United States)

    Sadler, Troy D.; Romine, William L.; Topçu, Mustafa Sami

    2016-01-01

    Science educators have presented numerous conceptual and theoretical arguments in favor of teaching science through the exploration of socio-scientific issues (SSI). However, the empirical knowledge base regarding the extent to which SSI-based instruction supports student learning of science content is limited both in terms of the number of…

  2. The Tanenbaum Open Science Institute: Leading a Paradigm Shift at the Montreal Neurological Institute.

    Science.gov (United States)

    Poupon, Viviane; Seyller, Annabel; Rouleau, Guy A

    2017-08-30

    The Montreal Neurological Institute is adopting an Open Science Policy that will be enacted by the Tanenbaum Open Science Institute. The aim is to accelerate the generation of knowledge and novel effective treatments for brain disorders by freeing science. Copyright © 2017 Elsevier Inc. All rights reserved.

  3. Small, simple but useful: the SSI approach to a real-time system for decision making support

    International Nuclear Information System (INIS)

    Baeverstam, U.

    1993-01-01

    In case of a nuclear accident or a threat of a release, the Swedish Radiation Protection Institute (SSI) is responsible for advising and informing the Government, other authorities and the public. The institute's experts are supported by a newly developed, small computerised system. Some components of the system are: a simple model for atmospheric dispersion and dose predictions; databases including maps, nuclides, instruments and facilities to store and handle measured values; on-line connection to nationwide system of automatic measuring stations; a number of data display facilities; and computer based handbooks. Most software for the system is written for the MS Windows environment. (author)

  4. Teaching with Socio-Scientific Issues in Physical Science: Teacher and Students' Experiences

    Science.gov (United States)

    Talens, Joy

    2016-01-01

    Socio-scientific issues (SSI) are recommended by many science educators worldwide for learners to acquire first hand experience to apply what they learned in class. This investigated experiences of teacher-researcher and students in using SSI in Physical Science, Second Semester, School Year 2012-2013. Latest and controversial news articles on…

  5. Supplemental Security Income (SSI) Recipients in each State by Sex and Age, December 2010

    Data.gov (United States)

    Social Security Administration — The Supplemental Security Income (SSI) Recipients in each State by Sex and Age (December 2010) is produced using the data found in Table 10 from the SSI Report of...

  6. 49 CFR 1520.15 - SSI disclosed by TSA or the Coast Guard.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false SSI disclosed by TSA or the Coast Guard. 1520.15... PROTECTION OF SENSITIVE SECURITY INFORMATION § 1520.15 SSI disclosed by TSA or the Coast Guard. (a) In... available for public inspection or copying, nor does TSA or the Coast Guard release such records to persons...

  7. National Institute of General Medical Sciences

    Science.gov (United States)

    ... Over Navigation Links National Institute of General Medical Sciences Site Map Staff Search My Order Search the ... NIGMS Website Research Funding Research Training News & Meetings Science Education About NIGMS Feature Slides View All Slides ...

  8. Secondary signal imaging (SSI) electron tomography (SSI-ET): A new three-dimensional metrology for mesoscale specimens in transmission electron microscope.

    Science.gov (United States)

    Han, Chang Wan; Ortalan, Volkan

    2015-09-01

    We have demonstrated a new electron tomography technique utilizing the secondary signals (secondary electrons and backscattered electrons) for ultra thick (a few μm) specimens. The Monte Carlo electron scattering simulations reveal that the amount of backscattered electrons generated by 200 and 300keV incident electrons is a monotonic function of the sample thickness and this causes the thickness contrast satisfying the projection requirement for the tomographic reconstruction. Additional contribution of the secondary electrons emitted from the edges of the specimens enhances the visibility of the surface features. The acquired SSI tilt series of the specimen having mesoscopic dimensions are successfully reconstructed verifying that this new technique, so called the secondary signal imaging electron tomography (SSI-ET), can directly be utilized for 3D structural analysis of mesoscale structures. Published by Elsevier Ltd.

  9. Confidence interval of intrinsic optimum temperature estimated using thermodynamic SSI model

    Institute of Scientific and Technical Information of China (English)

    Takaya Ikemoto; Issei Kurahashi; Pei-Jian Shi

    2013-01-01

    The intrinsic optimum temperature for the development of ectotherms is one of the most important factors not only for their physiological processes but also for ecological and evolutional processes.The Sharpe-Schoolfield-Ikemoto (SSI) model succeeded in defining the temperature that can thermodynamically meet the condition that at a particular temperature the probability of an active enzyme reaching its maximum activity is realized.Previously,an algorithm was developed by Ikemoto (Tropical malaria does not mean hot environments.Journal of Medical Entomology,45,963-969) to estimate model parameters,but that program was computationally very time consuming.Now,investigators can use the SSI model more easily because a full automatic computer program was designed by Shi et al.(A modified program for estimating the parameters of the SSI model.Environmental Entomology,40,462-469).However,the statistical significance of the point estimate of the intrinsic optimum temperature for each ectotherm has not yet been determined.Here,we provided a new method for calculating the confidence interval of the estimated intrinsic optimum temperature by modifying the approximate bootstrap confidence intervals method.For this purpose,it was necessary to develop a new program for a faster estimation of the parameters in the SSI model,which we have also done.

  10. Prerequisites concerning SSI:s review of applications for an encapsulation facility and a repository for spent nuclear fuel

    International Nuclear Information System (INIS)

    Oehlen, Elisabeth

    2006-09-01

    The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect

  11. 49 CFR 1520.13 - Marking SSI.

    Science.gov (United States)

    2010-10-01

    ... SECURITY INFORMATION § 1520.13 Marking SSI. (a) Marking of paper records. In the case of paper records... back cover, including a binder cover or folder, if the document has a front and back cover; (2) Any.... 552 and 49 CFR parts 15 and 1520. (d) Other types of records. In the case of non-paper records that...

  12. SSI's review of SKB's RD and D programme 2001

    Energy Technology Data Exchange (ETDEWEB)

    Hedberg, Bjoern; Larsson, Carl-Magnus; Wiebert, Anders [and others

    2002-08-01

    In the report SSI's review of SKB's RD and D programme 2001 is presented. In the review SSI comments, among other things, the decision making process, the need for a strategy document, SKB's safety and system analysis and SKB's biosphere studies.

  13. Preoperative antiseptic skin preparations and reducing SSI.

    Science.gov (United States)

    Al Maqbali, Mohammed Abdullah

    Surgical site infection (SSI) can affect the quality of care and increase the morbidity and mortality rate in after-surgical procedure. The use of an antiseptic skin preparation agent before the procedure can reduce the pathogens in the skin surface around the incision. Indicating the type of skin antiseptic preparation could prevent the infection and contamination of the wound. The most commonly used types of skin preparations are chlorhexidine and povidone iodine. However, the antiseptic solutions of both agents are strengthened with alcohol to prevent postoperative wound infection. The aim of this paper is to identify the best antiseptic agent in terms of skin preparation by evaluating the evidence in the literature. The factors associated with choosing the antiseptic skin agent, such as patients' allergies, skin condition and environmental risk, are also taken into account. This review suggests that cholorhexdine with alcohol may be the most effective in terms of reducing SSI.

  14. Galileo SSI Observations of Volcanic Activity at Tvashtar Catena, Io

    Science.gov (United States)

    Milazzo, M. P.; Keszthely, L. P.; Radebaugh, J.; Davies, A. G.; Turtle, E. P.; Geissler, P.; Klaasen, K. P.; McEwen, A. S.

    2005-01-01

    Introduction: We report on the analysis of the Galileo SSI's observations of the volcanic activity at Tvashtar Catena, Io as discussed by Milazzo et al. Galileo's Solid State Imager (SSI) observed Tvashtar Catena (63 deg N, 120 deg W) four times between November 1999 and October 2001, providing a unique look at the distinctive high latitude volcanism on Io. The November 1999 observation spatially resolved, for the first time, an active extraterrestrial fissure eruption. The brightness temperature of the lavas at the November 1999 fissure eruption was 1300 K. The second observation (orbit I27, February 2000) showed a large (approx. 500 sq km) region with many, small spots of hot, active lava. The third observation was taken in conjunction with a Cassini observation in December 2000 and showed a Pele-like plume deposition ring, while the Cassini images revealed a 400 km high Pele-type plume above the Catena. The final Galileo SSI observation of Tvashtar was acquired in October 2001, and all obvious (to SSI) activity had ceased, although data from Galileo's Near Infrared Mapping Spectrometer (NIMS) indicated that there was still significant thermal emission from the Tvashtar region. We have concentrated on analyzing the style of eruption during orbit I27 (February 2000). Comparison with a lava flow cooling model indicates that the behavior of the Tvashtar eruption during I27 does not match that of "simple" advancing lava flows. Instead, it may be an active lava lake or a complex set of lava flows with episodic, overlapping (in time and space) eruptions.

  15. Data Science for Institutional and Organizational Economics

    NARCIS (Netherlands)

    Prüfer, Jens; Prüfer, Patricia

    2018-01-01

    To which extent can data science methods – such as machine learning, text analysis, or sentiment analysis – push the research frontier in the social sciences? This essay briefly describes the most prominent data science techniques that lend themselves to analyses of institutional and organizational

  16. SSI's Review of the RDandD Program 2004 of the Swedish Nuclear Fuel and Waste Management Co; SSI:s granskning av SKB:s Fud-program 2004

    Energy Technology Data Exchange (ETDEWEB)

    Larsson, Carl-Magnus; Hedberg, Bjoern; Wiebert, Anders [and others

    2005-06-01

    In this report the Swedish Radiation Protection Authority's (SSI) review of the Swedish Nuclear Fuel and Waste Management Company's (SKB) RDandD programme 2004 is presented. In the review SSI comments, among other things, SKB's plan of action and future direction of SKB's RDandD programme, need for different types of consultations, plans for demonstration of canister deposition and long term experiments, and strategies for dismantling of nuclear facilities.

  17. Information Science Research Institute. Quarterly progress report

    Energy Technology Data Exchange (ETDEWEB)

    Nartker, T.A.

    1994-06-30

    This is a second quarter 1194 progress report on the UNLV Information Science Research Institute. Included is symposium activity; staff activity; document analysis program; text retrieval program; institute activity; and goals.

  18. Seismic Response of Steel Braced Building Frame Considering Soil Structure Interaction (SSI): An Experimental Study

    Science.gov (United States)

    Hirave, Vivek; Kalyanshetti, Mahesh

    2018-02-01

    Conventional fixed-base analysis ignoring the effect of soil-flexibility may result in unsafe design. Therefore, to evaluate the realistic behavior of structure the soil structure interaction (SSI) effect shall be incorporated in the analysis. In seismic analysis, provision of bracing system is one of the important option for the structure to have sufficient strength with adequate stiffness to resist lateral forces. The different configuration of these bracing systems alters the response of buildings, and therefore, it is important to evaluate the most effective bracing systems in view point of stability against SSI effect. In present study, three RC building frames, G+3, G+5 and G+7 and their respective scaled down steel model with two types of steel bracing system incorporating the effect of soil flexibility is considered for experimental and analytical study. The analytical study is carried out using Elastic continuum approach and the experimental study is carried out using Shake Table. The influence of SSI on various seismic parameters is presented. The study reveals that, steel bracing system is beneficial to control SSI effect and it is observed that V bracing is more effective, in resisting seismic load considering SSI.

  19. ssi plaat saab 30aastaseks / Gerli Romanovitsh

    Index Scriptorium Estoniae

    Romanovitš, Gerli, 1977-

    2004-01-01

    Ilmunud ka: Severnoje Poberezhje, 22. dets. 2004, lk. 4. Aasta aega Šveitsi investeerimisfirmale Sorbes AG kuulunud Püssi Repo Vabrikud tähistab puitlaastvabrikute kombinaadi 30. sünnipäeva. Praegu toodetakse 170 000 m3 puitlaastplaati aastas

  20. 73. Surgical site infection after CABG: Root cause analysis and quality measures recommendation SSI quality improvement project

    Directory of Open Access Journals (Sweden)

    A. Arifi

    2016-07-01

    Full Text Available Surgical site infection (SSI, is a preventable and devastating complication with significant morbidity after cardiac surgery. The reported SSI rate at our center, ranging from 3.4% to 11.2% (2007–2013. This rate is considered to be above the standardized rate recommended by the NHSN. Quality improvement project team to address the issue of SSI, (SCIP, where formed by the medical administration late 2014. The aim of the study was to identify SSI risk factors at our cardiac surgical unit, using evidence based practices while taking a local approach to problem solving. We performed Root Cause Analysis (RCA, and we applied other quality improvement tools to identify the area for potential improvement. Data include a Process Map of the pre-operative, intra-operative and post-operative factors that might contribute to SSI risk. We prospectively used the RCA form to investigate all the stages of the patient process map (pre, intra op, and post operatively. The data included the Patient related factors, the sterilization and the hygiene practice in the operating room, and the operating room traffic, and the compliance to the bundle of care. Figure represent the “Fishbone” diagram of the possible causes of SSI after cardiac surgery in our unit. Demographic features of patients with SSI were as follows: mean age-65 years; female 83%; time to infection (mean 101 days; range 1–36 days;. The root cause analysis identified a significant weakness in the compliance to the bundle of care to prevent SSI. Furthermore, the patient flow, the operating theatre cleaning and traffic was also identified as a contributing factor to SSI. Surgical site infection after cardiac surgery is a preventable complication. The application of the evidence based practice and structured way of thinking in problem solving, will help identify the potential risk factors. Focusing on solving the right patient process and visually represents the problem will help identifying the

  1. FT4 Data Analysis Summary (SSI-ARC)

    Science.gov (United States)

    Isaacson, Douglas R.; Gong, Chester; Reardon, Scott Edward; Santiago, Confesor

    2016-01-01

    Standards for Unmanned Aircraft System (UAS) Detect-and-Avoid (DAA) systems are currently being developed under the auspices of the RTCA Special Committee 228 (SC-228). To support the development of these standards, a series of flight tests has been conducted at NASAs Armstrong Flight Research Center (NASA-AFRC). The fourth in this series of flight test activities (Flight Test 4, or simply FT4) was conducted during the Spring and Summer of 2016. FT4 supported the objectives of numerous organizations working toward UAS DAA Minimum Operational Performance Standards (MOPS) and UAS DAA Radar MOPS. The summary provided herein is limited to the objectives, analysis and conclusions of the NASA Ames Research Center (NASA-ARC) SSI team toward the refinement of UAS DAA MOPS. This document provides a high-level overview of FT4 and the SSI-ARC objectives, a summary of the data analysis methodology and recommendations for UAS DAA MOPS refinements based on the data analysis results. A total of 72 encounters were flown to support SSI-ARC objectives. Test results were generally consistent with acceptable UAS DAA system performance and will be considered in broader SC-228 requirements validation efforts. Observed alert lead times indicated acceptable UAS DAA alerting performance. Effective interoperability between the UAS DAA system and the Traffic Alert and Collision Avoidance System (TCAS) was observed with one notable exception: TCAS Resolutions Advisories (RA) were observed in the absence of any DAA alert on two occasions, indicating the need for alert parameter refinement. Findings further indicated the need for continued work in the areas of DAA Well Clear Recovery logic and alert stability for Mode-C-only intruders. Finally, results demonstrated a high level of compliance with a set of evaluation criteria designed to provide anecdotal evidence of acceptable UAS DAA system performance.

  2. Sensitivity Study of Poisson's Ratio Used in Soil Structure Interaction (SSI) Analyses

    International Nuclear Information System (INIS)

    Han, Seung-ju; You, Dong-Hyun; Jang, Jung-bum; Yun, Kwan-hee

    2016-01-01

    The preliminary review for Design Certification (DC) of APR1400 was accepted by NRC on March 4, 2015. After the acceptance of the application for standard DC of APR1400, KHNP has responded the Request for Additional Information (RAI) raised by NRC to undertake a full design certification review. Design certification is achieved through the NRC's rulemaking process, and is founded on the staff's review of the application, which addresses the various safety issues associated with the proposed nuclear power plant design, independent of a specific site. The USNRC issued RAIs pertain to Design Control Document (DCD) Ch.3.7 'Seismic Design' is DCD Tables 3.7A-1 and 3.7A-2 show Poisson’s ratios in the S1 and S2 soil profiles used for SSI analysis as great as 0.47 and 0.48 respectively. Based on staff experience, use of Poisson's ratio approaching these values may result in numerical instability of the SSI analysis results. Sensitivity study is performed using the ACS SASSI NI model of APR1400 with S1 and S2 soil profiles to demonstrate that the Poisson’s ratio values used in the SSI analyses of S1 and S2 soil profile cases do not produce numerical instabilities in the SSI analysis results. No abrupt changes or spurious peaks, which tend to indicate existence of numerical sensitivities in the SASSI solutions, appear in the computed transfer functions of the original SSI analyses that have the maximum dynamic Poisson’s ratio values of 0.47 and 0.48 as well as in the re-computed transfer functions that have the maximum dynamic Poisson’s ratio values limited to 0.42 and 0.45

  3. Building a Science Software Institute: Synthesizing the Lessons Learned from the ISEES and WSSI Software Institute Conceptualization Efforts

    Science.gov (United States)

    Idaszak, R.; Lenhardt, W. C.; Jones, M. B.; Ahalt, S.; Schildhauer, M.; Hampton, S. E.

    2014-12-01

    The NSF, in an effort to support the creation of sustainable science software, funded 16 science software institute conceptualization efforts. The goal of these conceptualization efforts is to explore approaches to creating the institutional, sociological, and physical infrastructures to support sustainable science software. This paper will present the lessons learned from two of these conceptualization efforts, the Institute for Sustainable Earth and Environmental Software (ISEES - http://isees.nceas.ucsb.edu) and the Water Science Software Institute (WSSI - http://waters2i2.org). ISEES is a multi-partner effort led by National Center for Ecological Analysis and Synthesis (NCEAS). WSSI, also a multi-partner effort, is led by the Renaissance Computing Institute (RENCI). The two conceptualization efforts have been collaborating due to the complementarity of their approaches and given the potential synergies of their science focus. ISEES and WSSI have engaged in a number of activities to address the challenges of science software such as workshops, hackathons, and coding efforts. More recently, the two institutes have also collaborated on joint activities including training, proposals, and papers. In addition to presenting lessons learned, this paper will synthesize across the two efforts to project a unified vision for a science software institute.

  4. The Implement of a Multi-layer Frozen Soil Scheme into SSiB3 and its Evaluation over Cold Regions

    Science.gov (United States)

    Li, Q.

    2016-12-01

    The SSiB3 is a biophysics-based model of land-atmosphere interactions and is designed for global and regional studies. It has three soil layers, three snow layers, as well as one vegetation layer. Soil moisture of the three soil layers, interception water store for the canopy, subsurface soil temperature, ground temperature, canopy temperature and snow water equivalent are all predicted based on the water and energy balance at canopy, soil and snow. SSiB3 substantially enhances the model's capability for cold season studies and produces reasonable results compared with observations. However, frozen soil processes are ignored in the SSiB3 and may have effects on the interannual variability of soil temperature and deep soil memory. A multi-layer comprehensive frozen soil scheme (FSM), which is developed for climate study has been implemented into the SSiB3 to describe soil heat transfer and water flow affected by frozen processed in soil. In the coupled SSiB3-FSM, both liquid water and ice content have been taken into account in the frozen soil hydrologic and thermal property parameterization. The maximum soil layer depth could reach 10 meters thick depending on land conditions. To better evaluate the models' performance, the coupled offline SSiB3-FSM and SSiB3 have been driven from 1948 to 1958 by the Princeton global meteorological data set, respectively. For the 10yrs run, the coupled SSiB3-FSM almost captures the features over different regions, especially cold regions. In order to analysis and compare the differences of SSIB3-FSM and SSIB3 in detail, monthly mean surface temperature for different regions are compared with CAMS data. The statistical results of surface skin temperature show that high latitude regions, Africa, Eastern Australia, and North American monsoon regions have been greatly improved in SSIB3-FSM. For the global statistics, the RMSE of the surface temperature simulated by SSiB3-FSM can be improved about 0.6K compared to SSiB3. In this study

  5. ANTIMICROBIAL SUSCEPTIBILITY PATTERN OF ORGANISMS CAUSING SURGICAL SITE INFECTIONS (SSI

    Directory of Open Access Journals (Sweden)

    Rohini Murlidhar Gajbhiye

    2017-02-01

    Full Text Available BACKGROUND CDC defines surgical site infection as ‘Infections related to operative procedure that occurs at or near surgical incision within 30 days of operative procedure or within one year if the implant is left in situ’. Surgical site infection (SSI is 3 rd most frequently reported nosocomial infection (12%-16% as per National Nosocomial Infection Surveillance (NNIS. The aim of this study was to investigate the antimicrobial susceptibility pattern of organisms causing SSI. MATERIALS AND METHODS During a two year study period in a tertiary care hospital, 19,127 patients underwent surgeries in various surgical departments. Of these 517 (2.7% developed surgical site infection. The surgical wounds were classified by CDC & NNIS criteria into 4 classes. Two wound swabs were taken and processed by standard microbiological techniques. Antimicrobial susceptibility along with testing of ESBLs, MBLs, AmpCβ lactamases was done for all isolates causing SSI. RESULTS Among 19,127 patients, 517 (2.7% developed SSI. It was highest in patients of perforation peritonitis (11.99%.Among 517 specimens, 340 (65.76% showed growth and 177 (34.23% were culture negative. E.coli (23.33% was the commonest organism isolated followed by Acinetobacter spp. (16%, Klebsiella spp. (15.66%, Pseudomonas spp. (15.33%, S. aureus (10.33%, S. epidermidis(7.3%, Proteus spp. (6.00% and Citrobacter spp. (2.66%.Staphylococcus spp. were 100 % sensitive to Vancomycin & Linezolid. (27.5% S. aureus were MRSA and (17.5% were Inducible Clindamycin resistant (ICR. Enterobacteriaceae isolates showed maximum sensitivity towards Imipenem, Piperacillin-Tazobactam and Amikacin. Klebsiella spp. (40.62%, E.coli (35.89%, Citrobacter spp. (33.33%, Proteus spp. (26.08% were ESBL producers. Klebsiella spp. (17.18%, E.coli (10.25%, Proteus spp. (11.11% and Citrobacter spp. (8.69% were AmpC producers. Acinetobacter spp. (28.57% was commonest MBL producer followed by Klebsiella spp. (20

  6. From the American Academy of Pediatrics: Policy statements--Supplemental Security Income (SSI) for children and youth with disabilities.

    Science.gov (United States)

    2009-12-01

    The Supplemental Security Income (SSI) program remains an important source of financial support for low-income families of children with special health care needs and disabling conditions. In most states, SSI eligibility also qualifies children for the state Medicaid program, providing access to health care services. The Social Security Administration (SSA), which administers the SSI program, considers a child disabled under SSI if there is a medically determinable physical or mental impairment or combination of impairments that results in marked and severe functional limitations. The impairment(s) must be expected to result in death or have lasted or be expected to last for a continuous period of at least 12 months. The income and assets of families of children with disabilities are also considered when determining financial eligibility. When an individual with a disability becomes an adult at 18 years of age, the SSA considers only the individual's income and assets. The SSA considers an adult to be disabled if there is a medically determinable impairment (or combination of impairments) that prevents substantial gainful activity for at least 12 continuous months. SSI benefits are important for youth with chronic conditions who are transitioning to adulthood. The purpose of this statement is to provide updated information about the SSI medical and financial eligibility criteria and the disability-determination process. This statement also discusses how pediatricians can help children and youth when they apply for SSI benefits.

  7. The implementation of integrated science teaching materials based socio-scientific issues to improve students scientific literacy for environmental pollution theme

    Science.gov (United States)

    Yenni, Rita; Hernani, Widodo, Ari

    2017-05-01

    The study aims to determine the increasing of students' science literacy skills on content aspects and competency of science by using Integrated Science teaching materials based Socio-scientific Issues (SSI) for environmental pollution theme. The method used in the study is quasi-experiment with nonequivalent pretest and posttest control group design. The students of experimental class used teaching materials based SSI, whereas the students of control class were still using the usual textbooks. The result of this study showed a significant difference between the value of N-gain of experimental class and control class, whichalso occurred in every indicator of content aspects and competency of science. This result indicates that using of Integrated Science teaching materials based SSI can improve content aspect and competency of science and can be used as teaching materials alternative in teaching of Integrated Science.

  8. Long-term housing subsidies and SSI/SSDI income: Creating health-promoting contexts for families experiencing housing instability with disabilities.

    Science.gov (United States)

    Glendening, Zachary S; McCauley, Erin; Shinn, Marybeth; Brown, Scott R

    2018-04-01

    Though disability and housing instability are discussed separately in public health literature, few studies address families at their intersection. As a result, little is known about families who experience both homelessness and disability, how many receive disability benefits like SSI and SSDI, or the influence of those benefits on health-promoting outcomes like housing stability and self-sufficiency. Moreover, no previous research compares the ability of different housing and service interventions to increase disability benefit access. We examine relationships between disabilities and SSI/SSDI income reported when families enter emergency shelters and later health-promoting outcomes (housing stability and self-sufficiency) and how housing interventions affect SSI/SSDI receipt. Families in the (name removed) Study (N = 1857) were interviewed in emergency shelters, randomly offered of one of three housing interventions or usual care (i.e., no immediate referral to any intervention beyond shelter), and re-interviewed 20 months later. A third of families reported a disability at shelter entry. SSI/SSDI coverage of these families increased nearly 10% points over 20 months but never exceeded 40%. Disabilities predicted greater housing instability, food insecurity, and economic stress and less work and income. Among families reporting disabilities, SSI/SSDI receipt predicted fewer returns to emergency shelter, and more income despite less work. Offers of long-term housing subsidies increased SSI/SSDI receipt. Many families experiencing homelessness have disabilities; those receiving SSI/SSDI benefits have better housing and income outcomes. Providing families experiencing homelessness with long-term housing subsidies and SSI/SSDI could improve public health. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. 76 FR 446 - Supplemental Security Income (SSI) for the Aged, Blind, and Disabled; Dedicated Accounts and...

    Science.gov (United States)

    2011-01-05

    ... also were concerned that paying SSI in installments could distress SSI recipients. These commenters... increase an installment payment. Congress itemized certain outstanding debts relating to food, clothing... authority to make exceptions of this type. We can only approve impairment-related expenses. Comment: Several...

  10. Summer Institute for Physical Science Teachers

    Science.gov (United States)

    Maheswaranathan, Ponn; Calloway, Cliff

    2007-04-01

    A summer institute for physical science teachers was conducted at Winthrop University, June 19-29, 2006. Ninth grade physical science teachers at schools within a 50-mile radius from Winthrop were targeted. We developed a graduate level physics professional development course covering selected topics from both the physics and chemistry content areas of the South Carolina Science Standards. Delivery of the material included traditional lectures and the following new approaches in science teaching: hands-on experiments, group activities, computer based data collection, computer modeling, with group discussions & presentations. Two experienced master teachers assisted us during the delivery of the course. The institute was funded by the South Carolina Department of Education. The requested funds were used for the following: faculty salaries, the University contract course fee, some of the participants' room and board, startup equipment for each teacher, and indirect costs to Winthrop University. Startup equipment included a Pasco stand-alone, portable Xplorer GLX interface with sensors (temperature, voltage, pH, pressure, motion, and sound), and modeling software (Wavefunction's Spartan Student and Odyssey). What we learned and ideas for future K-12 teacher preparation initiatives will be presented.

  11. SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report on large-scale groundwater flow modelling for eastern Smaaland in Sweden (SKB Report 06-64); SSI:s granskning av SKB:s storregionala grundvattenmodellering foer oestra Smaaland (SKB Rapport 06-64)

    Energy Technology Data Exchange (ETDEWEB)

    Dverstorp, Bjorrn

    2007-09-15

    This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009.

  12. Toward enhanced learning of science: An educational scheme for informal science institutions

    Science.gov (United States)

    Suzuki, Midori

    Current educational operation for informal science institutions tend to be based on the staff's experience and intuition rather than on educational theories or research findings. This status study sought research evidence for an educational scheme to give informal science institutions. Evidence for this scheme came from surveys to determine specific circumstances of educational operations and visitor behaviors. The Provus discrepancy model, seeking gaps between the actual and desired states, guided this investigation of how informal science education institution staff view the nature and status of educational operations. Another investigation sought visitors' views of the effectiveness of the main idea for exhibit understanding (n=68 for each group of with the main idea and without the main idea), effective labels (n=68), expectations toward on-site lessons(n=22 and 65 for student groups, and n=2 for teachers), and possibilities for assessments of museum operations. Institutional data were collected via a web portal, with a separate site created for administrators (n=41), exhibit developers (n=21), and program planners (n=35). The survey asked about actual and desired states in terms of goals and roles of staff, contents of exhibits and programs, assessment, and professional development. The four visitor surveys were administered individually at the North Carolina Museum of Natural Sciences. The institutional survey found that most institutions focus on attitudinal reinforcement rather than visitor learning, do not overtly value research or long-term assessment, and value partnerships with K-12 schools more than other groups. It is also clarified that the staff do not have a clear vision of the nature or function of an operations manuals. Large gaps were found between the actual and desired states in terms of assessment (administrators, exhibit developers, and program planners), professional development (exhibit developers and program planners), and partnerships

  13. Incoherent SSI Analysis of Reactor Building using 2007 Hard-Rock Coherency Model

    International Nuclear Information System (INIS)

    Kang, Joo-Hyung; Lee, Sang-Hoon

    2008-01-01

    Many strong earthquake recordings show the response motions at building foundations to be less intense than the corresponding free-field motions. To account for these phenomena, the concept of spatial variation, or wave incoherence was introduced. Several approaches for its application to practical analysis and design as part of soil-structure interaction (SSI) effect have been developed. However, conventional wave incoherency models didn't reflect the characteristics of earthquake data from hard-rock site, and their application to the practical nuclear structures on the hard-rock sites was not justified sufficiently. This paper is focused on the response impact of hard-rock coherency model proposed in 2007 on the incoherent SSI analysis results of nuclear power plant (NPP) structure. A typical reactor building of pressurized water reactor (PWR) type NPP is modeled classified into surface and embedded foundations. The model is also assumed to be located on medium-hard rock and hard-rock sites. The SSI analysis results are obtained and compared in case of coherent and incoherent input motions. The structural responses considering rocking and torsion effects are also investigated

  14. UNLV Information Science Research Institute. Quarterly progress report

    International Nuclear Information System (INIS)

    Nartker, T.A.

    1994-01-01

    This document summarizes the activities and progress for the 1994 Fall quarter for the UNLV Information Science Research Institute. Areas covered include: Symposium activity, Staff activity, Document analysis program, Text-retrieval program, and Institute activity

  15. UNLV Information Science Research Institute. Quarterly progress report

    Energy Technology Data Exchange (ETDEWEB)

    Nartker, T.A.

    1994-12-31

    This document summarizes the activities and progress for the 1994 Fall quarter for the UNLV Information Science Research Institute. Areas covered include: Symposium activity, Staff activity, Document analysis program, Text-retrieval program, and Institute activity.

  16. Swedish Radiation Protection Institute: information activities

    International Nuclear Information System (INIS)

    Persson, Lars

    2000-01-01

    The purpose of SSI's Information and PR Service is to broaden public awareness of radiation and radiation risks as well as to fulfill other performance goals. SSI achieves this through its advisory, educational and informative activities. SSI publishes two external magazines, Stralskyddsnytt and SSI News. Stralskyddsnytt - which is available in Swedish only - has a circulation of 2,000 and is published four times a year. SSI News - which is in English - is published twice a year and has a circulation of about 1,800. Another important channel of communication is the web site (www.ssi.se). Taking advantage of PUSH technology, SSI also distributes, by e-mail, press releases and other important information on radiation to radiation protection professionals in Sweden. SSI continuously monitors news by subscribing to a press clipping service. SSI Training is a commercial unit within the Information and PR Service. A policy for mass media contacts exists as well as a policy for internal communication. SSI has a graphic profile. SSI has a specialized research library. (author)

  17. Swedish radiation protection institute. Information activities

    International Nuclear Information System (INIS)

    Persson, Lars

    1999-01-01

    The purpose of SSI's information and PR Service is to broaden public awareness of radiation and radiation risks as well as to fulfil other performance goals. SSI achieves this through its advisory, educational and informative activities. SSI publishes two external magazines, Straalskyddsnytt and SSI News. Straalskyddsnytt - which is available in Swedish only - has a circulation of 2,400 and is published four times a year. SSI News - which is in English - is published twice a year and has a circulation of about 1,500. Another important channel of communication is the web site (www.ssi.se). Taking advantage of PUSH technology, SSi also distributes, by e-mail, press releases and other important information of radiation to radiation protection professionals in Sweden. SSI continuously monitors news by subscribing to a press clipping service. SSI Training is a commercial unit within the Information and PR Service. A policy for mass media contacts exists as well as a policy for internal communication. SSI has a graphic profile. SSI has a specialised research library. (au)

  18. Pengaruh Learning Cycle–5E Berkonteks SSI Terhadap Pemahaman Hakikat Sains Pada Materi Larutan Penyangga Dan Hidrolisis Garam Siswa SMA

    Directory of Open Access Journals (Sweden)

    Eris Ratnawati

    2017-03-01

    Key words: Learning Cycle-5E , Socioscientific Issues, Nature Of Science, Buffer Solution, Salt Hydrolysis   Abstrak: Penelitian ini bertujuan menguji perbedaan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional pada materi larutan penyangga dan hidrolisis garam. Penelitian ini menggunakan rancangan penelitian eksperimen semu dengan pretes dan pascates. Sampel terdiri dari dua kelas dan dipilih menggunakan teknik convenience sampling di SMAN Tulungagung. Data diperoleh menggunakan instrumen angket hakikat sains berskala likert (R = 0,883 dan dianalisis dengan ANCOVA satu jalur dan effect size. Hasil penelitian menunjukkan ada perbedaan signifikan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional. Berdasarkan effect size, aspek hakikat sains yang berkontribusi tinggi adalah metode ilmiah, empiris, inferensi, dimensi sosial sains, dan penerapan sains dalam bidang sosbud. Aspek hakikat sains yang berkontribusi sedang adalah tentatif, kreatif, dan theory driven. Sedangkan hukum dan teori berkontribusi kecil. Kata kunci: Learning Cycle-5E , Socioscientific Issues, Hakikat Sains, Larutan Penyangga, Hidrolisis Garam

  19. Using Our Heads and HARTSS*: Developing Perspective-Taking Skills for Socioscientific Reasoning (*Humanities, ARTS, and Social Sciences)

    Science.gov (United States)

    Kahn, Sami; Zeidler, Dana L.

    2016-01-01

    Functional scientific literacy demands an informed citizenry capable of negotiating controversial socioscientific issues (SSI). Perspective taking is critical to SSI implementation as it enables understanding of the diverse cognitive and emotional perspectives of others. Science teacher educators must therefore facilitate teachers' promotion of…

  20. A Persian-version of the stuttering severity instrument-version four (SSI-4) : How the new additions to SSI-4 complement its stuttering severity score?

    NARCIS (Netherlands)

    Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood

    2018-01-01

    Purpose: The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to

  1. 7th International Summer Institute in Surface Science

    CERN Document Server

    Howe, Russell

    1986-01-01

    This volume contains review articles which were written by the invited speak­ ers of the seventh International Summer Institute in Surface Science (ISISS), held at the University of Wisconsin - Milwaukee in July 1985. The form of ISISS is a set of tutorial review lectures presented over a one-week period by internationally recognized experts on various aspects of surface science. Each speaker is asked, in addition, to write a review article on his lecture topic. No single volume in the series Chemistry and Physics of Solid Surfaces can possibly cover the entire field of modern surface science. However, the series as a whole is intended to provide experts and students alike with a comprehensive set of reviews and literature references, particularly empha­ sizing the gas-solid interface. The collected articles from previous Summer Institutes have been published under the following titles: Surface Science: Recent Progress and Perspectives, Crit. Rev. Solid State Sci. 4, 125-559 (1974) Chemistry and Physics of ...

  2. Institute for Computer Applications in Science and Engineering (ICASE)

    Science.gov (United States)

    1984-01-01

    Research conducted at the Institute for Computer Applications in Science and Engineering in applied mathematics, numerical analysis and computer science during the period April 1, 1983 through September 30, 1983 is summarized.

  3. Petroleum Science and Technology Institute with the TeXas Earth and Space Science (TXESS) Revolution

    Science.gov (United States)

    Olson, H. C.; Olson, J. E.; Bryant, S. L.; Lake, L. W.; Bommer, P.; Torres-Verdin, C.; Jablonowski, C.; Willis, M.

    2009-12-01

    The TeXas Earth and Space Science (TXESS) Revolution, a professional development program for 8th- thru 12th-grade Earth Science teachers, presented a one-week Petroleum Science and Technology Institute at The University of Texas at Austin campus. The summer program was a joint effort between the Jackson School of Geosciences and the Department of Petroleum and Geosystems Engineering. The goal of the institute was to focus on the STEM components involved in the petroleum industry and to introduce teachers to the larger energy resources theme. The institute kicked off with a welcoming event and tour of a green, energy-efficient home (LEED Platinum certified) owned by one of the petroleum engineering faculty. Tours of the home included an introduction to rainwater harvesting, solar energy, sustainable building materials and other topics on energy efficiency. Classroom topics included drilling technology (including a simulator lab and an overview of the history of the technology), energy use and petroleum geology, well-logging technology and interpretation, reservoir engineering and volumetrics (including numerous labs combining chemistry and physics), risk assessment and economics, carbon capture and storage (CO2 sequestration technology) and hydraulic fracturing. A mid-week field trip included visiting the Ocean Star offshore platform in Galveston, the Weiss Energy Hall at the Houston Museum of Science and Schlumberger (to view 3-D visualization technology) in Houston. Teachers remarked that they really appreciated the focused nature of the institute and especially found the increased use of mathematics both a tool for professional growth, as well as a challenge for them to use more math in their science classes. STEM integration was an important feature of the summer institute, and teachers found the integration of science (earth sciences, geophysics), technology, engineering (petroleum, chemical and reservoir) and mathematics particularly valuable. Pre

  4. Improving University Students' Science-Technology-Society-Environment Competencies

    Science.gov (United States)

    Yalaki, Yalçin

    2016-01-01

    Science, Technology, Society, Environment (STSE) is an education movement that started and developed from 70s through early 2000s. Although this movement had lost emphasis in recent years, it is one of the most important educational reform attempts in science education history. Today, concepts like Socio Scientific Issues (SSI) or Science,…

  5. Political Science Careers at Comprehensive Universities: Building Balanced Careers at "Greedy" Institutions

    Science.gov (United States)

    Hendrickson, Ryan C.; Mueller, Melinda A.; Strand, Jonathan R.

    2011-01-01

    A considerable amount of research exists about political science careers at community colleges and liberal arts institutions, as well as about training and hiring practices across different types of institutions. However, there is virtually no commentary available on political science careers at comprehensive institutions, where a significant…

  6. 76 FR 7225 - National Institute of Environmental Health Sciences; Notice of Meetings

    Science.gov (United States)

    2011-02-09

    ... Environmental Health Sciences; Notice of Meetings Pursuant to section 10(a) of the Federal Advisory Committee..., National Institute of Environmental Health Sciences, 615 Davis Dr., KEY615/3112, Research Triangle Park, NC..., National Institute of Environmental Health Sciences, 615 Davis Dr., KEY615/3112, Research Triangle Park, NC...

  7. SSI analysis of a massive concrete structure based on a novel ...

    Indian Academy of Sciences (India)

    1Structural Engineering Research Centre, CSIR Campus, Taramani,. Chennai ... In the numerical analysis of an SSI problem, the main difficulty is in representation of the ... validated software tools to execute the task is considered as the main ...

  8. Homi Bhabha Centre for Science Education, Tata Institute of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 2. Homi Bhabha Centre for Science Education, Tata Institute of Fundamental Research (A Deemed University). Information and Announcements Volume 22 Issue 2 February 2017 pp 189-189 ...

  9. Organizer of International Conference on Science and Applied Science (Engineering and Educational Science) 2016

    International Nuclear Information System (INIS)

    2017-01-01

    Organizer Graduate Program, Physics Department, Sebelas Maret University, Indonesia Jl. Ir. Sutami 36A Kentingan Jebres Surakarta 57126, Indonesia Phone/fax : 0271-669017 psw 308 email: icsas@mail.uns.ac.id Chairman 1. Prof. Dra. Soeparmi, M.A., Ph.D, Sebelas Maret University, Indonesia 2. Dr. Fuad Anwar, S.Si., M.Si, Sebelas Maret University, Indonesia Organizing Committee 1. Prof. Drs. Cari, M.A., M.Sc., PhD, Sebelas Maret University, Indonesia 2. Ahmad Marzuki, S.Si., Ph.D., Sebelas Maret University, Indonesia 3. Dr. Eng Budi Purnama, S.Si, M.Si., Sebelas Maret University, Indonesia 4. Dr. Fahru Nurosyid, S.Si., M.Si., Sebelas Maret University, Indonesia 5. Drs. Harjana, M.Si. M.Sc., Ph.D, Sebelas Maret University, Indonesia 6. Dr. Agus Supriyanto, S.Si, M.Si., Sebelas Maret University, Indonesia 7. Dr. Yofentina Iriani, S.Si., M.Si., Sebelas Maret University, Indonesia 8. Dr.Eng. Risa Suryana, S.Si, M.Si., Sebelas Maret University, Indonesia 9. Khairuddin, S.Si., M.Phil, Ph.D., Sebelas Maret University, Indonesia 10. Drs. Iwan Yahya, M.Si., Sebelas Maret University, Indonesia 11. Mohtar Yunianto, S.Si, M.Si., Sebelas Maret University, Indonesia 12. Dr. Nuryani, S.Si., M.Si., Sebelas Maret University, Indonesia (paper)

  10. The Natural Science Institute for Teachers of Minority Students: Performance report

    Energy Technology Data Exchange (ETDEWEB)

    Ervin, C.J.

    1995-02-01

    The purpose of the Natural Science Institute for Teachers of Minority Students is to enhance the science knowledge and skills of grades four through twelve science teachers in the District of Columbia Public Schools. The Institute brings school teachers together with practicing scientists and experienced science educators who are currently doing or involved in research and publication, especially in the area of global change. Special emphasis is placed on the interdisciplinary nature of science and the part played by the understanding and teaching about the dynamics of the environment and global change. In addition to these goals, teachers will learn a number of successful alternate strategies for teaching science to minority, disabled and non-English speaking students.

  11. 76 FR 11500 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2011-03-02

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory... Administrator, Nat. Institute of Environmental Health Sciences, Office of Program Operations, Scientific Review... . Name of Committee: National Institute of Environmental Health Sciences Special Emphasis Panel; Novel...

  12. RESULTS OF JOINT WORK OF ALLRRUSSIAN PUBLIC ORGANIZATION «THE ACADEMY OF NON TRADITIONAL AND RARE PLANTS» AND THE SSI ALLRRUSSIAN RESEARCH INSTITUTE OF VEGETABLE BREEDING AND SEED PRODUCTION OF RAAS FROM 1994 TO 2013 ON THE INTRODUCTION OF PLANTS

    Directory of Open Access Journals (Sweden)

    P. F. Kononkov

    2013-01-01

    Full Text Available The results  of joint work of All-Russian public organization «The Academy of non traditional and rare plants» and the SSI All-Russian research  institute of vegetable breeding and seed production  of RAAS are presented.   The results of two decades of work on the introduction of new, less common and non-traditional plants by scientists from Russia and foreign countries published  in fifty volumes of the proceedings  of international symposia and conferences  and in the collections «The introduction of non6traditional and rare plants and the prospects for their practical use» are reviewed.

  13. Galileo SSI Observations of Io During Orbits C30 I33

    Science.gov (United States)

    Keszthelyi, L.; Turtle, E.; McEwen, A.; Simonelli, D.; Geissler, P.; Williams, D.; Milazzo, M.; Radebaugh, J.; Jaeger, W.; Klaasen, K. P.

    2002-01-01

    New Galileo SSI imaging of Io from orbits C30 I33 will be presented. The aging Galileo spacecraft continues to produce spectacular new results, including the tallest volcanic plume yet found on Io. Additional information is contained in the original extended abstract.

  14. NIH's National Institute of General Medical Sciences celebrates 45 years of Discovery for Health

    Science.gov (United States)

    ... Alison Davis NIH's National Institute of General Medical Sciences celebrates 45 years of Discovery for Health The National Institute of General Medical Sciences (NIGMS) is the NIH institute that primarily supports ...

  15. 8th International Summer Institute in Surface Science

    CERN Document Server

    Howe, Russell

    1988-01-01

    This volume contains review articles written by the invited speakers at the eighth International Summer Institute in Surface Science (ISISS 1987), held at the University of Wisconsin-Milwaukee in August of 1987. During the course of ISISS, invited speakers, all internationally recognized experts in the various fields of surface science, present tutorial review lectures. In addition, these experts are asked to write review articles on their lecture topic. Former ISISS speakers serve as advisors concerning the selection of speakers and lecture topics. Em­ phasis is given to those areas which have not been covered in depth by recent Summer Institutes, as well as to areas which have recently gained in significance and in which important progress has been made. Because of space limitations, no individual volume of Chemistry and Physics of Solid Surfaces can possibly cover the whole area of modem surface science, or even give a complete survey of recent pro­ gress in the field. However, an attempt is made to pres...

  16. 78 FR 32259 - National Institute of Environmental Health Sciences; Amended Notice of Meeting

    Science.gov (United States)

    2013-05-29

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Institute of Environmental Health Sciences; Amended Notice of Meeting Notice is hereby given of a change in the meeting of the National Institute of Environmental Health Sciences Special Emphasis Panel, July 15, 2013, 8:00 a...

  17. 77 FR 22793 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2012-04-17

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory.... Institute of Environmental Health Sciences, P.O. Box 12233, MD EC-30, Research Triangle Park, NC 27709, (919....D., Scientific Review Administrator, Nat. Institute of Environmental Health Sciences, Office of...

  18. 77 FR 16844 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2012-03-22

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory.... Institute Environmental Health Sciences, P.O. Box 12233, MD EC-30, Research Triangle Park, NC 27709, (919) 541-1307, [email protected] . Name of Committee: National Institute of Environmental Health Sciences...

  19. Institute for Nuclear Research and Nuclear Energy and Nuclear Science

    International Nuclear Information System (INIS)

    Stamenov, J.

    2004-01-01

    The Institute for Nuclear Research and Nuclear Energy (INRNE) of the Bulgarian Academy of Sciences is the leading Bulgarian Institute for scientific investigations and applications of nuclear science. The main Institute's activities in the field of elementary particles and nuclear physics, high energy physics and nuclear energy, radiochemistry, radioecology, radioactive wastes treatment, monitoring of the environment, nuclear instruments development ect. are briefly described. Several examples for: environmental radiation monitoring; monitoring of the radioactivity and heavy metals in aerosols, 99m Tc clinical use, Boron Neutron Capture Therapy application of IRT-2000 Research Reactor, neutron fluence for reactor vessel embrittlement, NPP safety analysis, nuclear fuel modelling are also presented

  20. 78 FR 32672 - National Institute of Environmental Health Sciences (NIEHS); Notice of Meeting

    Science.gov (United States)

    2013-05-31

    ... Environmental Health Sciences (NIEHS); Notice of Meeting Pursuant to the NIH Reform Act of 2006 (42 U.S.C. 281 (d)(4)), notice is hereby given that the National Institute of Environmental Health Sciences (NIEHS... Popovich, National Institute of Environmental Health Sciences, Division of Extramural Research and Training...

  1. 77 FR 37423 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2012-06-21

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory..., [email protected] . Name of Committee: National Institute of Environmental Health Sciences Special... Research and Training, Nat. Institute of Environmental Health Science, P.O. Box 12233, MD EC-30/Room 3170 B...

  2. 76 FR 58521 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2011-09-21

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory... and Training, Nat. Institute of Environmental Health Science, P. O. Box 12233, MD EC-30/Room 3170 B... Extramural Research and Training, Nat. Institute of Environmental Health Sciences, P. O. Box 12233, MD EC-30...

  3. Science Learning and Citizenship (Proceedings of ESERA 2011) Proceedings of the ESERA 2011 Conference

    DEFF Research Database (Denmark)

    2012-01-01

    Teaching about scientific literacy, science and citizenship education, science and media education, information literacy, informal reasoning and critical thinking, decision making, debates on socioscientific issues (SSI), discourse communities, social dimension of science and technoscientific...... practices, public engagement in science, schools', students' and teachers' engagement in socioscientific issues....

  4. A Pedagogical Model for Ethical Inquiry into Socioscientific Issues in Science

    Science.gov (United States)

    Saunders, Kathryn J.; Rennie, Leonie J.

    2013-01-01

    Internationally there is concern that many science teachers do not address socioscientific issues (SSI) in their classrooms, particularly those that are controversial. However with increasingly complex, science-based dilemmas being presented to society, such as cloning, genetic screening, alternative fuels, reproductive technologies and…

  5. 76 FR 11765 - Education Research and Special Education Research Grant Programs; Institute of Education Sciences...

    Science.gov (United States)

    2011-03-03

    ... DEPARTMENT OF EDUCATION Education Research and Special Education Research Grant Programs; Institute of Education Sciences; Overview Information; Education Research and Special Education Research.... SUMMARY: The Director of the Institute of Education Sciences (Institute) announces the Institute's FY 2012...

  6. University of Washington's eScience Institute Promotes New Training and Career Pathways in Data Science

    Science.gov (United States)

    Stone, S.; Parker, M. S.; Howe, B.; Lazowska, E.

    2015-12-01

    Rapid advances in technology are transforming nearly every field from "data-poor" to "data-rich." The ability to extract knowledge from this abundance of data is the cornerstone of 21st century discovery. At the University of Washington eScience Institute, our mission is to engage researchers across disciplines in developing and applying advanced computational methods and tools to real world problems in data-intensive discovery. Our research team consists of individuals with diverse backgrounds in domain sciences such as astronomy, oceanography and geology, with complementary expertise in advanced statistical and computational techniques such as data management, visualization, and machine learning. Two key elements are necessary to foster careers in data science: individuals with cross-disciplinary training in both method and domain sciences, and career paths emphasizing alternative metrics for advancement. We see persistent and deep-rooted challenges for the career paths of people whose skills, activities and work patterns don't fit neatly into the traditional roles and success metrics of academia. To address these challenges the eScience Institute has developed training programs and established new career opportunities for data-intensive research in academia. Our graduate students and post-docs have mentors in both a methodology and an application field. They also participate in coursework and tutorials to advance technical skill and foster community. Professional Data Scientist positions were created to support research independence while encouraging the development and adoption of domain-specific tools and techniques. The eScience Institute also supports the appointment of faculty who are innovators in developing and applying data science methodologies to advance their field of discovery. Our ultimate goal is to create a supportive environment for data science in academia and to establish global recognition for data-intensive discovery across all fields.

  7. Local knowledge, science, and institutional change: the case of desertification control in Northern China.

    Science.gov (United States)

    Yang, Lihua

    2015-03-01

    This article studies the influence of local knowledge on the impact of science on institutional change in ecological and environmental management. Based on an empirical study on desertification control in 12 counties in north China, the study found the following major results: (1) although there was a cubic relationship between the extent and effect of local knowledge, local knowledge significantly influenced the impact of science on institutional change; (2) local knowledge took effect mainly through affecting formal laws and regulations, major actors, and methods of desertification control in institutional change but had no significant impact on the types of property rights; and (3) local knowledge enhanced the impact of science on the results of desertification control through affecting the impact of science on institutional change. These findings provide a reference for researchers, policy makers, and practitioners, both in China and in other regions of the world, to further explore the influence of local knowledge on the impact of science on institutional change and the roles of local knowledge or knowledge in institutional change and governance.

  8. THE EFFECT OF 5E LEARNING CYCLE INSTRUCTIONAL MODEL USING SOCIOSCIENTIFIC ISSUES (SSI LEARNING CONTEXT ON STUDENTS’ CRITICAL THINKING

    Directory of Open Access Journals (Sweden)

    A. Cahyarini

    2016-11-01

    Full Text Available The aim of this study was to investigate the effect of 5E learning cycle instructional model using socioscientific issues (SSI learning context on students’ critical thinking skills of acid-base. This study used quasi-experimental posttest only control group design. The sample consisted of three classes, which were XI MIA-4class (n = 32 that learned using 5E LC model, XI MIA-5 class (n = 33 that learned using 5E LC+SSI, and XI MIA-6 class (n = 32 that learned using conventional method. The samples were choosen by convenience sampling technique. The test instrument consisted of 15 multiple choice items which were valid and reliable (r = 0.806. The data were analyzed using one way ANOVA test and LSD posthoc test. The results of this study indicated that the students who learned using 5E LC+SSI model showed greater levels of critical thinking skills (  = 74,95 than both the student who learned using 5E LC model (  = 74,17 and  the student who learned using conventional method (  = 68,96. Based on statistics analysis, there was significant differences on students’ critical thinkings between students taught using conventional method and students taught either using 5E LC+SSI model and 5E LC model. However,  there was no significant differences on students’ critical thinking skills between students taught using 5E LC+SSI model and the students taught using 5E LC model.

  9. Annual report of national institute of radiological sciences

    International Nuclear Information System (INIS)

    1993-07-01

    This annual report is a compilation of the research activities and achievement in the National Institute of Radiological Sciences (NIRS) in Japan during the fiscal year 1992 (from April 1992 through March 1993). Construction of the Heavy Ion Medical Accelerator in Chiba (HIMAC) has reached semi-final stage. The research covers a wide range of radiological sciences from molecular biology to environmental studies and medicine including engineering for heavy ion therapy of cancer. Topics consists of physics, chemistry, biomedical science, clinical research, and environmental sciences, covering a total of 84 titles. A list of publications by staff members, activities of research divisions, and organization chart of the NIRS are given in Appendix. (J.P.N.) 78 refs

  10. Duties and responsibilities of the Nuclear Power Inspectorate and the National Radiation Protection Institute in connection with nuclear power plants

    International Nuclear Information System (INIS)

    Eckered, T.

    1977-01-01

    The two Swedish bodies competent for the control of nuclear energy are the Swedish Nuclear Power Inspectorate (SKI) and the National Swedish Institute on Radiation Protection (SSI). The duties of both bodies in respect of inspection stem from the provisions of the Atomic Energy Act and the Radiation Protection Act. The procedure to be followed for construction and operation of nuclear power plants is described from the viewpoint of the responsibilities entrusted to SKI and SSI. (NEA) [fr

  11. NOAA Climate Data Record (CDR) of Solar Spectral Irradiance (SSI), NRLSSI Version 2

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Climate Data Record (CDR) contains solar spectral irradiance (SSI) as a function of time and wavelength created with the Naval Research Laboratory model for...

  12. SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report on large-scale groundwater flow modelling for eastern Smaaland in Sweden (SKB Report 06-64)

    International Nuclear Information System (INIS)

    Dverstorp, Bjorrn

    2007-09-01

    This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009

  13. 20 CFR 416.250 - Experimental, pilot, and demonstration projects in the SSI program.

    Science.gov (United States)

    2010-04-01

    ... administration of the SSI program. These projects will test the advantages of altering certain requirements... demonstration project will have a termination date (up to 10 years from the start of the project). [48 FR 7576...

  14. Incorporating higher order WINKLER springs with 3-D finite element model of a reactor building for seismic SSI analysis

    International Nuclear Information System (INIS)

    Ermutlu, H.E.

    1993-01-01

    In order to fulfill the seismic safety requirements, in the frame of seismic requalification activities for NPP Muehleberg, Switzerland, detailed seismic analysis performed on the Reactor Building and the results are presented previously. The primary objective of the present investigation is to assess the seismic safety of the reinforced concrete structures of reactor building. To achieve this objective requires a rather detailed 3-D finite element modeling for the outer shell structures, the drywell, the reactor pools, the floor decks and finally, the basemat. This already is a complicated task, which enforces need for simplifications in modelling the reactor internals and the foundation soil. Accordingly, all internal parts are modelled by vertical sticks and the Soil Structure Interaction (SSI) effects are represented by sets of transitional and higher order rotational WINKLER springs, i.e. avoiding complicated finite element SSI analysis. As a matter of fact, the availability of the results of recent investigations carried out on the reactor building using diversive finite element SSI analysis methods allow to calibrate the WINKLER springs, ensuring that the overall SSI behaviour of the reactor building is maintained

  15. Socioscience and Ethics in Science Classrooms: Teacher Perspectives and Strategies

    Science.gov (United States)

    Sadler, Troy D.; Amirshokoohi, Aidin; Kazempour, Mahsa; Allspaw, Kathleen M.

    2006-01-01

    This study explored teacher perspectives on the use of socioscientific issues (SSI) and on dealing with ethics in the context of science instruction. Twenty-two middle and high school science teachers from three US states participated in semi-structured interviews, and researchers employed inductive analyses to explore emergent patterns relative…

  16. Validation of seismic soil structure interaction (SSI) methodology for a UK PWR nuclear power station

    International Nuclear Information System (INIS)

    Llambias, J.M.

    1993-01-01

    The seismic loading information for use in the seismic design of equipment and minor structures within a nuclear power plant is determined from a dynamic response analysis of the building in which they are located. This dynamic response analysis needs to capture the global response of both the building structure and adjacent soil and is commonly referred to as a soil structure interaction (SSI) analysis. NNC have developed a simple and cost effective methodology for the seismic SSI analysis of buildings in a PWR nuclear power station at a UK soft site. This paper outlines the NNC methodology and describes the approach adopted for its validation

  17. Information actions in science and technology: institutionalities, agencies and subjects

    Directory of Open Access Journals (Sweden)

    Rodrigo Rabello

    Full Text Available Considering the influence of new agency forms - intervention and interaction among subjects - in the context of information intermediation, we aim to approach information actions in Science and Technology (S&T taking into consideration the institutionalities involved. For such, we assume there is an influence of a theoretical model emerging in Information Science (IS regarding current inventive and interactive form propitiated by the Web. The text is structured in two central topics bringing: i theoretical and epistemic constructions of the "information action" concept; and ii a certain interpretation oriented by the "informational action in S&T" construct, taking as its object the actions performed by IBICT (Brazilian Institute for Information in Science and Technology, directed towards excellence in information. Finally, we discuss how limitations of the "systemic model" propitiate the construction of new study objects in the model emerging in IS from theoretical innovations and counterpoints thoughts facing the diverse forms of information action, considering, for instance, the action of subjects on what concerns the validation of information in the current scenery of institutional intermediation.

  18. Activities of the Institute for Computer Applications in Science and Engineering

    Science.gov (United States)

    1985-01-01

    Research conducted at the Institute for Computer Applications in Science and Engineering in applied mathematics, numerical analysis, and computer science during the period April 1, 1985 through October 2, 1985 is summarized.

  19. The impact of institutional ethics on academic health sciences library leadership: a survey of academic health sciences library directors.

    Science.gov (United States)

    Tooey, Mary Joan M J; Arnold, Gretchen N

    2014-10-01

    Ethical behavior in libraries goes beyond service to users. Academic health sciences library directors may need to adhere to the ethical guidelines and rules of their institutions. Does the unique environment of an academic health center imply different ethical considerations? Do the ethical policies of institutions affect these library leaders? Do their personal ethical considerations have an impact as well? In December 2013, a survey regarding the impact of institutional ethics was sent to the director members of the Association of Academic Health Sciences Libraries. The objective was to determine the impact of institutional ethics on these leaders, whether through personal conviction or institutional imperative.

  20. Survey and evaluation of the external research and development programme 1977-1983 of the Swedish Radiation Protection Institute

    International Nuclear Information System (INIS)

    Persson, Lars.

    1993-01-01

    A review of the external research programme of SSI is undertaken. The main research programme is in this report divided into five subprogrammes according to the main programmes of the Institute. This report covers research projects reported 1977-1983. An evaluation of the impact of the R and D programme is included in the report. The external R and D research programme of SSI has had an important impact on the radiation protection work in Sweden. The methods for evaluation of research programmes are also discussed in the report

  1. Pioneering the Transdisciplinary Team Science Approach: Lessons Learned from National Cancer Institute Grantees.

    Science.gov (United States)

    Vogel, Amanda L; Stipelman, Brooke A; Hall, Kara L; Nebeling, Linda; Stokols, Daniel; Spruijt-Metz, Donna

    2014-01-01

    The National Cancer Institute has been a leader in supporting transdisciplinary (TD) team science. From 2005-2010, the NCI supported Transdisciplinary Research on Energetic and Cancer I (TREC I), a center initiative fostering the TD integration of social, behavioral, and biological sciences to examine the relationships among obesity, nutrition, physical activity and cancer. In the final year of TREC I, we conducted qualitative in-depth-interviews with 31 participating investigators and trainees to learn more about their experiences with TD team science, including challenges, facilitating factors, strategies for success, and impacts. Five main challenges emerged: (1) limited published guidance for how to engage in TD team science, when TREC I was implemented; (2) conceptual and scientific challenges inherent to efforts to achieve TD integration; (3) discipline-based differences in values, terminology, methods, and work styles; (4) project management challenges involved in TD team science; and (5) traditional incentive and reward systems that do not recognize or reward TD team science. Four main facilitating factors and strategies for success emerged: (1) beneficial attitudes and beliefs about TD research and team science; (2) effective team processes; (3) brokering and bridge-building activities by individuals holding particular roles in a research center; and (4) funding initiative characteristics that support TD team science. Broad impacts of participating in TD team science in the context of TREC I included: (1) new positive attitudes about TD research and team science; (2) new boundary-crossing collaborations; (3) scientific advances related to research approaches, findings, and dissemination; (4) institutional culture change and resource creation in support of TD team science; and (5) career advancement. Funding agencies, academic institutions, and scholarly journals can help to foster TD team science through funding opportunities, institutional policies on

  2. Environmental Aspects of Tritium Around the Vinca Institute of Nuclear Sciences

    International Nuclear Information System (INIS)

    Miljevic, N.; Sipka, V.

    1995-01-01

    An overview of environmental distribution of tritium around the Institute of Nuclear Sciences Vinca during the period 1988-1994 is presented. Temporal and local variations of the specific tritium variations in precipitation (Usek, Zeleno Brdo), river waters (the Danube, the Sava and Mlaka Creek) as well as atmospheric water vapor are given. Estimates based on precipitation measurements have shown that 6.3 TBq of tritium activity should be released annually into the atmosphere from the Vinca Institute of Nuclear Sciences. (author)

  3. SSI's International Development Co-operation (SIUS). Annual report 1998

    International Nuclear Information System (INIS)

    Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar

    1999-04-01

    SSI's International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998

  4. Expert judgements in performance assessments. Report of an SKI/SSI seminar

    International Nuclear Information System (INIS)

    Wilmot, R.D.; Galson, D.A.; Hora, S.C.

    2000-09-01

    Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session, designed to

  5. Expert judgements in performance assessments. Report of an SKI/SSI seminar

    Energy Technology Data Exchange (ETDEWEB)

    Wilmot, R.D.; Galson, D.A. [Galson Sciences Ltd, Oakham (United Kingdom); Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States)

    2000-09-01

    Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session

  6. 78 FR 47715 - National Institute of Environmental Health Sciences; Amended Notice of Meeting

    Science.gov (United States)

    2013-08-06

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Institute of Environmental Health Sciences; Amended Notice of Meeting Notice is hereby given of a change in the meeting of the Environmental Health Sciences Review Committee, July 24, 2013, 08:00 a.m. to July 26, 2013, 02:00...

  7. Annual report of National Institute of Radiological Science, April 1995 -March 1996

    International Nuclear Information System (INIS)

    1997-03-01

    This annual report presents a brief summary of the research activities and the achievements in the Institute for fiscal year 1995 (from April 1995 to March 1996). The clinical trial of cancer therapy using heavy ion beams is making progress with successful results. Various kinds of basic researches using the same heavy ion beams are also growing up gradually in an open use system available to many researchers not only inside but also outside the Institute. Studies of newly assembled research groups are also going to appear. The Institute is covering a very wide area of comprehensive radiological sciences including physics, chemistry, biomedical sciences, clinical research and environmental science. The recent publications, list of keywords, author index, and organization and staff are included in this report. (M.N.)

  8. Annual report of National Institute of Radiological Science, April 1995 - March 1996

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    This annual report presents a brief summary of the research activities and the achievements in the Institute for fiscal year 1995 (from April 1995 to March 1996). The clinical trial of cancer therapy using heavy ion beams is making progress with successful results. Various kinds of basic researches using the same heavy ion beams are also growing up gradually in an open use system available to many researchers not only inside but also outside the Institute. Studies of newly assembled research groups are also going to appear. The Institute is covering a very wide area of comprehensive radiological sciences including physics, chemistry, biomedical sciences, clinical research and environmental science. The recent publications, list of keywords, author index, and organization and staff are included in this report. (M.N.)

  9. Active Volcanism on Io as Seen by Galileo SSI

    Science.gov (United States)

    McEwen, A.S.; Keszthelyi, L.; Geissler, P.; Simonelli, D.P.; Carr, M.H.; Johnson, T.V.; Klaasen, K.P.; Breneman, H.H.; Jones, T.J.; Kaufman, J.M.; Magee, K.P.; Senske, D.A.; Belton, M.J.S.; Schubert, G.

    1998-01-01

    Active volcanism on Io has been monitored during the nominal Galileo satellite tour from mid 1996 through late 1997. The Solid State Imaging (SSI) experiment was able to observe many manifestations of this active volcanism, including (1) changes in the color and albedo of the surface, (2) active airborne plumes, and (3) glowing vents seen in eclipse. About 30 large-scale (tens of kilometers) surface changes are obvious from comparison of the SSI images to those acquired by Voyager in 1979. These include new pyroclastic deposits of several colors, bright and dark flows, and caldera-floor materials. There have also been significant surface changes on Io during the Galileo mission itself, such as a new 400-km-diameter dark pyroclastic deposit around Pillan Patera. While these surface changes are impressive, the number of large-scale changes observed in the four months between the Voyager 1 and Voyager 2 flybys in 1979 suggested that over 17 years the cumulative changes would have been much more impressive. There are two reasons why this was not actually the case. First, it appears that the most widespread plume deposits are ephemeral and seem to disappear within a few years. Second, it appears that a large fraction of the volcanic activity is confined to repeated resurfacing of dark calderas and flow fields that cover only a few percent of Io's surface. The plume monitoring has revealed 10 active plumes, comparable to the 9 plumes observed by Voyager. One of these plumes was visible only in the first orbit and three became active in the later orbits. Only the Prometheus plume has been consistently active and easy to detect. Observations of the Pele plume have been particularly intriguing since it was detected only once by SSI, despite repeated attempts, but has been detected several times by the Hubble Space Telescope at 255 nm. Pele's plume is much taller (460 km) than during Voyager 1 (300 km) and much fainter at visible wavelengths. Prometheus-type plumes (50

  10. Developing institutional repository at National Institute for Materials Science : Researchers directory service “SAMURAI” and Research Collection Library

    Science.gov (United States)

    Takaku, Masao; Tanifuji, Mikiko

    National Institute for Materials Science (NIMS) has developed an institutional repository “NIMS eSciDoc” since 2008. eSciDoc is an open source repository software made in Germany, and provides E-Science infrastructures through its flexible data model and rich Web APIs. NIMS eScidoc makes use of eSciDoc functions to benefit for NIMS situations. This article also focuses on researchers directory service “SAMURAI” in addition to NIMS eSciDoc. Successfully launched in October 2010, SAMURAI provides approximately 500 researchers' profile and publication information.

  11. 76 FR 50235 - National Institute of Environmental Health Sciences; Notice of Meetings

    Science.gov (United States)

    2011-08-12

    ... Environmental Health Sciences; Notice of Meetings Pursuant to section 10(a) of the Federal Advisory Committee... (DERT), Nat. Inst. of Environmental Health Sciences, National Institutes of Health, 615 Davis Dr... of Extramural Research and Training (DERT), Nat. Inst. of Environmental Health Sciences, National...

  12. La fabrique des sciences des institutions aux pratiques

    CERN Document Server

    Benninghoff, Martin; Crettaz von Roten, Fabienne; Merz, Martina

    2006-01-01

    Aujourd'hui, les façons de produire, d'organiser, d'évaluer et d'utiliser les savoirs sont en profond débat. De plus en plus, l'Etat, la société civile et l'économie tentent d'influencer les activités des universités et des laboratoires de recherche. Ces développements mettent à l'épreuve tout à la fois les fondements des systèmes d'enseignement supérieur et de recherche, l'autonomie des institutions scientifiques, la définition des frontières des savoirs et l'acceptation des sciences. Dans des contextes suisses et européens, cet ouvrage s'intéresse aux manières dont les sciences et les technologies sont fabriquées, en analysant leurs institutions et les pratiques. A partir d'une approche relationnelle, les sciences et les technologies sont conçues comme des phénomènes profondément sociaux, culturels et politiques. Une telle démarche déstabilise les visions parfois idéalisées et stéréotypées de la construction des savoirs. Des études de cas détaillées décrivent des phénomè...

  13. 76 FR 7572 - National Institute of Environmental Health Sciences; Notice of Meetings

    Science.gov (United States)

    2011-02-10

    ... Environmental Health Sciences; Notice of Meetings Pursuant to section 10(a) of the Federal Advisory Committee..., Director, Division of Extramural Research and Training, National Institute of Environmental Health Sciences... of Environmental Health Sciences, 615 Davis Dr., KEY615/3112, Research Triangle Park, NC 27709, (919...

  14. 76 FR 77239 - National Institute of Environmental Health Sciences; Notice of Meeting

    Science.gov (United States)

    2011-12-12

    ... Environmental Health Sciences; Notice of Meeting Pursuant to section 10(a) of the Federal Advisory Committee Act.../boards/ibcercc/ . Place: National Institute of Environmental Health Sciences, Building 101, Rodbell... and Education; 93.894, Resources and Manpower Development in the Environmental Health Sciences; 93.113...

  15. 77 FR 66853 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2012-11-07

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory... Health Sciences Special Emphasis Panel Career Grants in the Environmental Health Sciences. Date: November...., Scientific Review Administrator, Nat. Institute of Environmental Health Sciences, Office of Program...

  16. 76 FR 80954 - National Institute of Environmental Health Sciences; Notice of Meeting

    Science.gov (United States)

    2011-12-27

    ... Environmental Health Sciences; Notice of Meeting Pursuant to section 10(a) of the Federal Advisory Committee Act.../boards/ibcercc/ . Place: Nat. Inst. of Environmental Health Sciences, Building 101, Rodbell Auditorium... Environmental Health Sciences, National Institutes of Health, 615 Davis Dr., KEY615/3112, Research Triangle Park...

  17. 77 FR 39688 - Notice of Proposed Information Collection Requests; Institute of Education Sciences; FAFSA...

    Science.gov (United States)

    2012-07-05

    ... DEPARTMENT OF EDUCATION Notice of Proposed Information Collection Requests; Institute of Education Sciences; FAFSA Completion Project Evaluation SUMMARY: The Institute of Education Sciences (IES) at the U.S. Department of Education (ED) is conducting a rigorous study of the Free Application for Federal Student Aid...

  18. 76 FR 13197 - National Institute of Environmental Health Sciences Strategic Planning

    Science.gov (United States)

    2011-03-10

    ... parties. The goal of this strategic planning process is to define an overarching Vision Statement... this planning process, visit the NIEHS Strategic Planning Web site at Request for Visionary Ideas The... Environmental Health Sciences Strategic Planning AGENCY: National Institutes of Health (NIH), National Institute...

  19. Thai Pre-Service Science Teachers' Struggles in Using Socio-Scientific Issues (SSIs) during Practicum

    Science.gov (United States)

    Pitiporntapin, Sasithep; Yutakom, Naruemon; Sadler, Troy D.

    2016-01-01

    In educational reform, teaching through socio-scientific issues (SSIs) is considered the best way to promote scientific literacy for citizenship as the goal of science teaching. To bring SSIs into the science classroom, Thai pre-service science teachers (PSTs) are expected to understand the concept of SSI-based teaching and to use it effectively…

  20. The Relationship of Science Knowledge, Attitude and Decision Making on Socio-Scientific Issues: The Case Study of Students' Debates on a Nuclear Power Plant in Korea

    Science.gov (United States)

    Jho, Hunkoog; Yoon, Hye-Gyoung; Kim, Mijung

    2014-01-01

    The purpose of this study was to investigate the relationship of students' understanding of science knowledge, attitude and decision making on socio-scientific issues (SSI), especially on the issues of nuclear energy in Korea. SSI-focused instructions were developed to encourage students to understand and reflect on knowledge, attitude and…

  1. Activities of the Institute for Computer Applications in Science and Engineering (ICASE)

    Science.gov (United States)

    1988-01-01

    This report summarizes research conducted at the Institute for Computer Applications Science and Engineering in applied mathematics, numerical analysis, and computer science during the period October 2, 1987 through March 31, 1988.

  2. [Research Conducted at the Institute for Computer Applications in Science and Engineering

    Science.gov (United States)

    1997-01-01

    This report summarizes research conducted at the Institute for Computer Applications in Science and Engineering in applied mathematics, fluid mechanics, and computer science during the period 1 Oct. 1996 - 31 Mar. 1997.

  3. Annual report of the National Institute of Radiological Sciences. April 2000-March 2001

    International Nuclear Information System (INIS)

    2001-10-01

    This report contains all of accomplishments of National Institute of Radiological Sciences (NIRS), including research and investigations, medical practice, training and technology assistance the institute performed during the given year. Actually, the content covers NIRS activity results in the fields of physics (6 presentations), chemistry (3), bio-medical sciences, clinical research (7), environmental science (15) and space science (5). The third involves fields of biochemistry and biophysics (6), cell biology (6), immunology and hematology (1), pathology and physiology (5), genetics (8) and radiotoxicology (1). Topical issues are clinical trials of heavy-ion radiotherapy for cancer; researches of radiation-sensitive genes and gene-expression profiles; and activities for various accidents after the turning point of the JCO criticality accident in Tokai. NIRS was reborn as an independent corporative body as a result of the national administrative reform and this report is the final one as that from the national institute. (N.I.)

  4. 76 FR 71046 - National Institute of Environmental Health Sciences; Notice of Meeting

    Science.gov (United States)

    2011-11-16

    ... Environmental Health Sciences; Notice of Meeting Pursuant to section 10(a) of the Federal Advisory Committee Act... Environmental Health Sciences, National Institutes of Health, 615 Davis Dr., KEY615/3112, Research Triangle Park... and Education; 93.894, Resources and Manpower Development in the Environmental Health Sciences; 93.113...

  5. NASA's Solar System Exploration Research Virtual Institute: Science and Technology for Lunar Exploration

    Science.gov (United States)

    Schmidt, Greg; Bailey, Brad; Gibbs, Kristina

    2015-01-01

    The NASA Solar System Exploration Research Virtual Institute (SSERVI) is a virtual institute focused on research at the intersection of science and exploration, training the next generation of lunar scientists, and development and support of the international community. As part of its mission, SSERVI acts as a hub for opportunities that engage the larger scientific and exploration communities in order to form new interdisciplinary, research-focused collaborations. The nine domestic SSERVI teams that comprise the U.S. complement of the Institute engage with the international science and exploration communities through workshops, conferences, online seminars and classes, student exchange programs and internships. SSERVI represents a close collaboration between science, technology and exploration enabling a deeper, integrated understanding of the Moon and other airless bodies as human exploration moves beyond low Earth orbit. SSERVI centers on the scientific aspects of exploration as they pertain to the Moon, Near Earth Asteroids (NEAs) and the moons of Mars, with additional aspects of related technology development, including a major focus on human exploration-enabling efforts such as resolving Strategic Knowledge Gaps (SKGs). The Institute focuses on interdisciplinary, exploration-related science focused on airless bodies targeted as potential human destinations. Areas of study represent the broad spectrum of lunar, NEA, and Martian moon sciences encompassing investigations of the surface, interior, exosphere, and near-space environments as well as science uniquely enabled from these bodies. This research profile integrates investigations of plasma physics, geology/geochemistry, technology integration, solar system origins/evolution, regolith geotechnical properties, analogues, volatiles, ISRU and exploration potential of the target bodies. New opportunities for both domestic and international partnerships are continually generated through these research and

  6. 77 FR 33472 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2012-06-06

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... Health Sciences Special Emphasis Panel International Collaborations in Environmental Health. Date: June....D., Scientific Review Administrator, Nat. Institute of Environmental Health Sciences, Office of...

  7. 78 FR 14562 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2013-03-06

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... Health Sciences Special Emphasis Panel; Studies on Environmental Health Concerns from Superstorm Sandy... Administrator, National Institute of Environmental Health Sciences, Office of Program Operations, Scientific...

  8. 78 FR 12369 - United States Government Policy for Institutional Oversight of Life Sciences Dual Use Research of...

    Science.gov (United States)

    2013-02-22

    ... Oversight of Life Sciences Dual Use Research of Concern AGENCY: Office of Science and Technology Policy... comments on the proposed United States Government Policy for Institutional Oversight of Life Sciences Dual... requirements for certain categories of life sciences research at institutions that accept Federal funding for...

  9. 76 FR 31620 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2011-06-01

    ... Health Sciences Special Emphasis Panel, Research on Ethics and Integrity of Human and or Animal Subjects... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Institute of..., DVM, Chief, Scientific Review Branch, Division of Extramural Research and Training, National Institute...

  10. Annual report of National Institute of Radiological Sciences, April 1993 - March 1994

    International Nuclear Information System (INIS)

    1995-03-01

    This report summarized briefly the research activities and achievements in the Institute for fiscal year 1993 (from April 1993 through March 1994). At the end of this period, the construction of HIMAC has been completed and preparatory experiments of physical and biological studies necessary to the clinical trial have started by use of the heavy ion beams of HIMAC itself. The Institute is covering a wide range of comprehensive radiological sciences from molecular biology to environmental studies and medicine including engineering for heavy ion therapy of cancer. Therefore, the topics collected in the main part have been classified into five categories (physics, chemistry, bio-medical sciences, clinical research and environmental sciences). (J.P.N.)

  11. Annual report of National Institute of Radiological Sciences, April 1993 - March 1994

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-01

    This report summarized briefly the research activities and achievements in the Institute for fiscal year 1993 (from April 1993 through March 1994). At the end of this period, the construction of HIMAC has been completed and preparatory experiments of physical and biological studies necessary to the clinical trial have started by use of the heavy ion beams of HIMAC itself. The Institute is covering a wide range of comprehensive radiological sciences from molecular biology to environmental studies and medicine including engineering for heavy ion therapy of cancer. Therefore, the topics collected in the main part have been classified into five categories (physics, chemistry, bio-medical sciences, clinical research and environmental sciences). (J.P.N.).

  12. SSI`s International Development Co-operation (SIUS). Annual report 1998

    Energy Technology Data Exchange (ETDEWEB)

    Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar

    1999-04-01

    SSI`s International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998

  13. 75 FR 34147 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2010-06-16

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... Review Branch, Division of Extramural Research and Training, Nat. Institute Environmental Health Sciences... Development in the Environmental Health Sciences; 93.113, Biological Response to Environmental Health Hazards...

  14. 78 FR 51734 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2013-08-21

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory..., Nat. Institute of Environmental Health Sciences, Office of Program Operations, Scientific Review... Development in the Environmental Health Sciences; 93.113, Biological Response to Environmental Health Hazards...

  15. 75 FR 32797 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2010-06-09

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... Branch, Division of Extramural Research and Training, Nat. Institute of Environmental Health Sciences, P... Manpower Development in the Environmental Health Sciences; 93.113, Biological Response to Environmental...

  16. 77 FR 61771 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2012-10-11

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory... clearly unwarranted invasion of personal privacy. Name of Committee: Environmental Health Sciences Review... applications. Place: National Institute of Environmental Health Sciences, Building 101, Rodbell Auditorium, 111...

  17. 78 FR 27410 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2013-05-10

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory..., Nat. Institute of Environmental Health Sciences, Office of Program Operations, Scientific Review... the Environmental Health Sciences; 93.113, Biological Response to Environmental Health Hazards; 93.114...

  18. Effect of the gate scaling on the analogue performance of s-Si CMOS devices

    International Nuclear Information System (INIS)

    Fobelets, K; Calvo-Gallego, J; Velázquez-Pérez, J E

    2011-01-01

    In this contribution, we present a detailed study of the analogue performance of deep submicron strained n-channel Si/SiGe (s-Si) MOSFETs. The study was carried out using a 2D device simulator based on the hydrodynamic model and the impedance field method to self-consistently obtain the current noise at the device's terminals. The analysis focused on the possible benefits of the gate scaling on the ac and noise performance of the transistor for low-power applications while keeping constant the oxide thickness equal to 2 nm to guarantee negligible level of the gate tunnel current. For a drain to source bias of 50 mV, it was found that a pure scaling of the transistor's gate length under 32 nm is detrimental for subthreshold operation in terms of the subthreshold slope (S) and transconductance (g m ) but would lead to reasonably low values of the minimum noise figure (NF min ). For the sake of comparison, SOI MOSFETs with the same layout and operating under the same conditions were simulated. The SOI MOSFETs showed better immunity against the gate scaling in terms of S than the s-Si MOSFETs, but lower values of g m and a higher value of NF min at the same level of the drain current. Finally, the devices have been studied in the saturation region for a drain to source bias of 1 V. In this region, it was found that the dependence of the current level SOI or s-Si MOSFET may outperform its counterparts

  19. Research in Institutional Economics in Management Science

    DEFF Research Database (Denmark)

    Foss, Kirsten; Foss, Nicolai Juul

    This report maps research in institutional economics in management science in the European Union for the 1995 to 2002 period. The reports applies Internet search based on a university listing, search on journal databases, key informants and an internet-based survey. 195 researchers are identified....... In (sub-)disciplinary terms, organization, strategy, corporate governance, and international business are the major areas of application of institutional economics ideas. In terms of countries, the EU strongholds are Holland, Denmark, UK, and Germany. There is apparently no or very little relevant...... research in Ireland, Portugal, Luxembourg and Greece. Based on the findings of the report, it seems warranted to characterize the EU research effort in the field as being rather dispersed and uncoordinated. Thus, there are no specialized journals, associations or PhD courses. This state of affairs...

  20. 75 FR 63843 - National Institute of General Medical Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2010-10-18

    ... Sciences Special Emphasis Panel; Review of Minority Biomedical Research Neuro Grant Applications. Date... General Medical Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... of General Medical Sciences, National Institutes of Health, Natcher Building, Room 3AN18J, Bethesda...

  1. 78 FR 25754 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2013-05-02

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... of Extramural Research and Training, Nat. Institute of Environmental Health Science, P.O. Box 12233... Health Sciences; 93.113, Biological Response to Environmental Health Hazards; 93.114, Applied...

  2. 76 FR 52672 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2011-08-23

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory.... of Environmental Health Sciences, Keystone Building, 530 Davis Drive, Research Triangle Park, NC..., Division of Extramural Research and Training, Nat. Institute of Environmental Health Sciences, P.O. Box...

  3. 78 FR 39739 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2013-07-02

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... clearly unwarranted invasion of personal privacy. Name of Committee: Environmental Health Sciences Review... Research and Training, National Institute of Environmental Health Sciences, P.O. Box 12233, MD EC-30...

  4. 78 FR 14312 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2013-03-05

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory... Health Sciences Special Emphasis Panel; Understanding Environmental Control of Epigenetic/Mechanisms... Extramural Research and Training, Nat. Institute of Environmental Health Sciences, P.O. Box 12233, MD EC-30...

  5. 75 FR 61765 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2010-10-06

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory... Environmental Health Sciences Special Emphasis Panel, Superfund Research and Training Program. Date: October 26...-Tilotta, PhD, Scientific Review Officer, Nat. Institute of Environmental Health Sciences, Office of...

  6. 77 FR 30019 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2012-05-21

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... of Extramural Research and Training, Nat. Institute of Environmental Health Science, P.O. Box 12233... Health Sciences; 93.113, Biological Response to Environmental Health Hazards; 93.114, Applied...

  7. Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area, December 2010

    Data.gov (United States)

    Social Security Administration — The Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area (December 2010) is produced using the data found in Table 38...

  8. A Reconstructed Vision of Environmental Science Literacy: The case of Qatar

    Science.gov (United States)

    Khishfe, Rola

    2014-12-01

    The purpose of this study was twofold: (a) develop a conceptual framework for environmental science literacy; and consequently (b) examine the potential of science standards/curricula to prepare environmentally literate citizens. The framework comprised four pillars: science content knowledge, scientific inquiry, nature of science (NOS), and socioscientific issues (SSI). A conceptual understanding of these pillars as interconnected was presented and justified. Then the developed framework was used to examine the potential of the Qatari science standards to prepare environmentally literate citizens. Results showed that the secondary Qatari science standards generally take up the pillars of science content and scientific inquiry in an explicit manner. The NOS pillar is rarely addressed, while the SSI pillar is not addressed in the objectives and activities in a way that aligns with the heavy emphasis given in the overall aims. Moreover, the connections among pillars are mostly manifested within the activities and between the science content and scientific inquiry. The objectives and activities targeting the environment were less frequent among the four pillars across the Qatari standards. Again, the connections related to the environment were less frequent in conformity with the limited environmental objectives and activities. Implications from this study relate to the need for the distribution of the four pillars across the standards as well as the presentation of the different pillars as interconnected.

  9. Preservice Science Teachers' Epistemological Beliefs and Informal Reasoning Regarding Socioscientific Issues

    Science.gov (United States)

    Ozturk, Nilay; Yilmaz-Tuzun, Ozgul

    2017-12-01

    This study investigated preservice elementary science teachers' (PSTs) informal reasoning regarding socioscientific issues (SSI), their epistemological beliefs, and the relationship between informal reasoning and epistemological beliefs. From several SSIs, nuclear power usage was selected for this study. A total of 647 Turkish PSTs enrolled in three large universities in Turkey completed the open-ended questionnaire, which assessed the participants' informal reasoning about the target SSI, and Schommer's (1990) Epistemological Questionnaire. The participants' epistemological beliefs were assessed quantitatively and their informal reasoning was assessed both qualitatively and quantitatively. The findings revealed that PSTs preferred to generate evidence-based arguments rather than intuitive-based arguments; however, they failed to generate quality evidence and present different types of evidence to support their claims. Furthermore, among the reasoning quality indicators, PSTs mostly generated supportive argument construction. Regarding the use of reasoning modes, types of risk arguments and political-oriented arguments emerged as the new reasoning modes. The study demonstrated that the PSTs had different epistemological beliefs in terms of innate ability, omniscient authority, certain knowledge, and quick learning. Correlational analyses revealed that there was a strong negative correlation between the PSTs' certain knowledge and counterargument construction, and there were negative correlations between the PSTs' innate ability, certain knowledge, and quick learning dimensions of epistemological beliefs and their total argument construction. This study has implications for both science teacher education and the practice of science education. For example, PST teacher education programs should give sufficient importance to training teachers that are skillful and knowledgeable regarding SSIs. To achieve this, specific SSI-related courses should form part of science

  10. 75 FR 65363 - National Institute of General Medical Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2010-10-22

    ... Sciences Special Emphasis Panel; Review of Minority Biomedical Research Neuro Grant Applications. Date... General Medical Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... General Medical Sciences, National Institutes of Health, Natcher Building, Room 3AN18J, Bethesda, MD 20892...

  11. 78 FR 18359 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2013-03-26

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory... Training, Nat. Institute of Environmental Health Sciences, P.O. Box 12233, MD EC-30, Research Triangle Park... Environmental Health Sciences Special Emphasis Panel; Research Careers in Emerging Technologies. Date: April 30...

  12. 77 FR 60445 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2012-10-03

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory... Research and Training, National Institute of Environmental Health Science, P.O. Box 12233, MD EC-30/Room... Environmental Health Sciences Special Emphasis Panel; Support for Conferences and Scientific Meetings. Date...

  13. 78 FR 8156 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2013-02-05

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... Environmental Health Sciences Special Emphasis Panel; Studies of Environmental Agents to Induce Immunotoxicity... Research and Training, Nat. Institute of Environmental Health Sciences, P.O. Box 12233, MD EC-30, Research...

  14. 76 FR 13650 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2011-03-14

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory... Training, Nat. Institute of Environmental Health Sciences, P.O. Box 12233, MD EC-30/Room 3171, Research... Environmental Health Sciences Special Emphasis Panel; Review of Educational Grants with an Environmental Health...

  15. 76 FR 62080 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2011-10-06

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... clearly unwarranted invasion of personal privacy. Name of Committee: Environmental Health Sciences Review... Extramural Research and Training, Nat'l Institute of Environmental Health Sciences, P.O. Box 12233, MD EC-30...

  16. 75 FR 10293 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2010-03-05

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory.... Institute Environmental Health Sciences, P. O. Box 12233, MD EC-30, Research Triangle Park, NC 27709, (919... Health Sciences; 93.113, Biological Response to Environmental Health Hazards; 93.114, Applied...

  17. SSI response of a typical shear wall structure. Volume 1

    International Nuclear Information System (INIS)

    Johnson, J.J.; Schewe, E.C.; Maslenikov, O.R.

    1984-04-01

    The Simplified Methods project of the US NRC-funded Seismic Safety Margins Research Program (SSMRP) has as its goal the development of a methodology to perform routine seismic probabilistic risk assessments of commercial nuclear power plants. The study reported here develops calibration factors to relate best estimate response to design values accounting for approximations and simplifications in SSI analysis procedures. Nineteen cases were analyzed and in-structure response compared. The structure of interest was a typical shear wall structure. 6 references, 44 figures, 22 tables

  18. Argumentation, critical thinking, nature of science and socioscientific issues: a dialogue between two researchers

    Science.gov (United States)

    Yacoubian, Hagop A.; Khishfe, Rola

    2018-05-01

    The purpose of this paper is to compare and contrast between two theoretical frameworks for addressing nature of science (NOS) and socioscientific issues (SSI) in school science. These frameworks are critical thinking (CT) and argumentation (AR). For the past years, the first and second authors of this paper have pursued research in this area using CT and AR as theoretical frameworks, respectively. Yacoubian argues that future citizens need to develop a critical mindset as they are guided to (1) practice making judgments on what views of NOS to acquire and (2) practice making decisions on SSI through applying their NOS understandings. Khishfe asserts that AR is an important component of decision making when dealing with SSI and the practice in AR in relation to controversial issues is needed for informed decision making. She argues that AR as a framework may assist in the development of more informed understandings of NOS. In this paper, the authors delve into a dialogue for (1) elucidating strengths and potential of each framework, (2) highlighting challenges that they face in their research using the frameworks in question, (3) exploring the extent to which the frameworks can overlap, and (4) proposing directions for future research.

  19. Annual report of National Institute of Radiological Sciences, 2004

    International Nuclear Information System (INIS)

    2005-10-01

    The fiscal year 2004 was the 4th year since the National Institute of Radiological Sciences (NIRS) reformed as an Independent Administrative Institution (IAI) in April 2001. The main items of this report, being the same as the previous year's, are: the summary of NIRS activities; research and development including studies of important project, fundamental research, fundamental and frontier research, contract research and fact-finding; management; organization/budget/finance; and appendix. Important projects are radiological studies in advanced medicine, on sensitivity, of effects on human and of hazard. Fundamental research concerns studies of environmental radiation, radiobiology, heavy particle ion therapy, diagnostic imaging, dose assessment and protection in medical radiation, brain function, systematic basic technology of nuclear sciences and international cooperation. Fact-finding studies are on the present situations of people exposed by nuclear experiment at Bikini Atoll in 1954 and of patients treated with thorotrast in past. Appendix cites the personnel name list, honorable events, cooperative studies, patent situation and others. (J.P.N.)

  20. Nonlinear Time Domain Seismic Soil-Structure Interaction (SSI) Deep Soil Site Methodology Development

    International Nuclear Information System (INIS)

    Spears, Robert Edward; Coleman, Justin Leigh

    2015-01-01

    Currently the Department of Energy (DOE) and the nuclear industry perform seismic soil-structure interaction (SSI) analysis using equivalent linear numerical analysis tools. For lower levels of ground motion, these tools should produce reasonable in-structure response values for evaluation of existing and new facilities. For larger levels of ground motion these tools likely overestimate the in-structure response (and therefore structural demand) since they do not consider geometric nonlinearities (such as gaping and sliding between the soil and structure) and are limited in the ability to model nonlinear soil behavior. The current equivalent linear SSI (SASSI) analysis approach either joins the soil and structure together in both tension and compression or releases the soil from the structure for both tension and compression. It also makes linear approximations for material nonlinearities and generalizes energy absorption with viscous damping. This produces the potential for inaccurately establishing where the structural concerns exist and/or inaccurately establishing the amplitude of the in-structure responses. Seismic hazard curves at nuclear facilities have continued to increase over the years as more information has been developed on seismic sources (i.e. faults), additional information gathered on seismic events, and additional research performed to determine local site effects. Seismic hazard curves are used to develop design basis earthquakes (DBE) that are used to evaluate nuclear facility response. As the seismic hazard curves increase, the input ground motions (DBE's) used to numerically evaluation nuclear facility response increase causing larger in-structure response. As ground motions increase so does the importance of including nonlinear effects in numerical SSI models. To include material nonlinearity in the soil and geometric nonlinearity using contact (gaping and sliding) it is necessary to develop a nonlinear time domain methodology. This

  1. 75 FR 45133 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2010-08-02

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory.... Institute of Environmental Health Science, P.O. Box 12233, MD EC-30/Room 3170 B, Research Triangle Park, NC... Manpower Development in the Environmental Health Sciences; 93.113, Biological Response to Environmental...

  2. 77 FR 61613 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2012-10-10

    ... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory... Environmental Health Sciences, P. O. Box 12233, MD EC-30, Research Triangle Park, NC 27709, (919) 541-1307, [email protected] . Name of Committee: National Institute of Environmental Health Sciences Special Emphasis...

  3. 75 FR 68367 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2010-11-05

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... Research and Training, Nat. Institute of Environmental Health Science, P.O. Box 12233, MD EC-30/Room 3170 B... Sciences; 93.113, Biological Response to Environmental Health Hazards; 93.114, Applied Toxicological...

  4. 76 FR 26311 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2011-05-06

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory.... Institute of Environmental Health Sciences, P.O. Box 12233, MD EC-30/Room 3171, Research Triangle Park, NC... and Education; 93.894, Resources and Manpower Development in the Environmental Health Sciences; 93.113...

  5. Contextualization of Nature of Science within the Socioscientific Issues Framework: A Review of Research

    Science.gov (United States)

    Karisan, Dilek; Zeidler, Dana L.

    2017-01-01

    The aim of this paper is to examine the importance of contextualization of Nature of Science (NOS) within the Socioscientific Issues (SSI) framework, because of the importance to science education. The emphasis on advancing scientific literacy is contingent upon a robust understanding and appreciation of NOS, as well as the acquisition of…

  6. Research in progress at the Institute for Computer Applications in Science and Engineering

    Science.gov (United States)

    1987-01-01

    This report summarizes research conducted at the Institute for Computer Applications in Science and Engineering in applied mathematics, numerical analysis, and computer science during the period April 1, 1987 through October 1, 1987.

  7. New FINESSE Faculty Institutes for NASA Earth and Space Science Education

    Science.gov (United States)

    Slater, Timothy F.; Slater, Stephanie; Marshall, Sunette Sophia; Stork, Debra; Pomeroy, J. Richard R

    2014-06-01

    In a systematic effort to improve the preparation of future science teachers, scholars coordinated by the CAPER Center for Astronomy & Physics Education Research are providing a series of high-quality, 2-day professional development workshops, with year-round follow-up support, for college and university professors who prepare future science teachers to work with highly diverse student populations. These workshops focus on reforming and revitalizing undergraduate science teaching methods courses and Earth and Space science content courses that future teachers most often take to reflect contemporary pedagogies and data-rich problem-based learning approaches steeped in authentic scientific inquiry, which consistently demonstrate effectiveness with diverse students. Participants themselves conduct science data-rich research projects during the institutes using highly regarded approaches to inquiry using proven models. In addition, the Institute allocates significant time to illustrating best practices for working with diverse students. Moreover, participants leave with a well-formulated action plan to reform their courses targeting future teachers to include more data-rich scientific inquiry lessons and to be better focused on improving science education for a wide diversity of students. Through these workshops faculty use a backwards faded scaffolding mechanism for working inquiry into a deeper understanding of science by using existing on-line data to develop and research astronomy, progressing from creating a valid and easily testable question, to simple data analysis, arriving at a conclusion, and finally presenting and supporting that conclusion in the classroom. An updated schedule is available at FINESSEProgram.org

  8. Earth Institute at Columbia University ADVANCE Program: Addressing Needs for Women in Earth and Environmental Sciences

    Science.gov (United States)

    Bell, R. E.; Cane, M.; Mutter, J.; Miller, R.; Pfirman, S.; Laird, J.

    2004-12-01

    The Earth Institute has received a major NSF ADVANCE grant targeted at increasing the participation and advancement of women scientists and engineers in the Academy through institutional transformation. The Earth Institute at Columbia University includes 9 research institutes including Lamont-Doherty Earth Observatory, Center for Environmental Research and Conservation (CERC), Center for International Earth Science Information Network (CIESIN), International Research Institute (IRI) for Climate Prediction, Earth Engineering Center, NASA-Goddard Institute for Space Studies, Center for Risks and Hazards, Center for Globalization and Sustainable Development, and Center for Global Health and Economic Development and six academic departments including Ecology, Evolution and Environmental Biology (E3B, School of Arts and Sciences), Earth and Environmental Engineering (DEEE, School of Engineering and Applied Sciences), Department of Environmental Health (School of Public Health), Department of Earth and Environmental Sciences (DEES, School of Arts and Sciences), Department of International and Public Affairs (School of International and Policy Affairs), and Barnard College Department of Environmental Science. The Earth Institute at Columbia University's ADVANCE program is based both on a study of the status of women at Columbia and research on the progression of women in science elsewhere. The five major targets of the Columbia ADVANCE program are to (1) change the demographics of the faculty through intelligent hiring practices, (2) provide support to women scientists through difficult life transitions including elder care and adoption or birth of a child, (3) enhance mentoring and networking opportunities, (4) implement transparent promotion procedures and policies, and (5) conduct an institutional self study. The Earth Institute ADVANCE program is unique in that it addresses issues that tend to manifest themselves in the earth and environmental fields, such as extended

  9. 76 FR 62422 - National Institute of Environmental Health Sciences; Cancellation of Meeting

    Science.gov (United States)

    2011-10-07

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Institute of Environmental Health Sciences; Cancellation of Meeting Notice is hereby given of the cancellation of the Interagency Breast Cancer and Environmental Research Coordinating Committee, October 12, 2011, 1 p.m. to 3 p.m...

  10. The Swedish Radiation Protection Institute's regulations concerning the final management of spent nuclear fuel and nuclear waste - with background and comments

    International Nuclear Information System (INIS)

    2000-11-01

    This report presents and comments on the Swedish Radiation Protection Institute's Regulations concerning the Protection of Human Health and the Environment in connection with the Final Management of Spent Nuclear Fuel or Nuclear Waste, SSI FS 1998: 1

  11. 78 FR 59944 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2013-09-30

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... Institute of Environmental Health Sciences, P.O. Box 12233, MD EC-30, Research Triangle Park, NC 27709, (919... [[Page 59945

  12. Ghana Space Science and Technology Institute (GSSTI) - Annual Report 2015

    International Nuclear Information System (INIS)

    2015-01-01

    The Ghana Space Science and Technology Institute (GSSTI) of the Ghana Atomic Energy Commission was established to exploit space science and technology for socio-economic development of Ghana. The report gives the structure of GSSTI and the detailed activities of the year. Various activities include: training and seminars, projects and workshops. Publications and their abstracts are also listed. The report also highlights some of the challenges, provides some recommendations and points to some expectation for the following year.

  13. Polish Academy of Sciences Institute of Biochemistry and Biophysics research report 1994-1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-12-31

    Scientific interests of Institute of Biochemistry and Biophysics Polish Academy of Sciences are focused on DNA replication and repair, gene expression, gene sequencing and molecular biophysics. The work reviews research projects of the Institute in 1994-1995.

  14. Polish Academy of Sciences Institute of Biochemistry and Biophysics research report 1994-1995

    International Nuclear Information System (INIS)

    1996-01-01

    Scientific interests of Institute of Biochemistry and Biophysics Polish Academy of Sciences are focused on DNA replication and repair, gene expression, gene sequencing and molecular biophysics. The work reviews research projects of the Institute in 1994-1995

  15. Polish Academy of Sciences Institute of Biochemistry and Biophysics research report 1994-1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    Scientific interests of Institute of Biochemistry and Biophysics Polish Academy of Sciences are focused on DNA replication and repair, gene expression, gene sequencing and molecular biophysics. The work reviews research projects of the Institute in 1994-1995.

  16. Análise da versão espanhola do Sport Satisfaction Instrument (SSI adaptado à Educação Física Analysis of the Spanish version of the Sport Satisfaction Instrument (SSI adapted to Physical Education

    Directory of Open Access Journals (Sweden)

    Antonio Granero-Gallegos

    2013-03-01

    Full Text Available O objetivo deste estudo foi analisar as propriedades psicométricas do Sport Satisfation Instrument (SSI adaptado para a Educação Física (EF por meio de uma análise fatorial exploratória da estrutura bidimensional do instrumento em uma amostra espanhola. Com isso, buscou-se determinar, de maneira preliminar, se o SSI constitui um instrumento válido e fiável para ser utilizado em futuras pesquisas. O instrumento foi elaborado em um modelo teórico de dois fatores: Satisfação/Diversão e Tédio. A amostra constituiu-se de um total de 224 alunos de secundária entre 12 e 19 anos. A versão [espanhola] do instrumento adaptado para a EF demonstrou níveis aceitáveis de consistência interna.The objective of this study was to analyze the psychometric properties of Sport Satisfaction Instrument (SSI adapted physical education (PE using exploratory factor analysis of the dimensional structure of the instrument in a Spanish sample. It was intended to determine, on a preliminary basis, whether it constitutes a valid and reliable for use in future research. Was administered to a total of 224 high school students 12 to 19 years. This analysis supports the hypothesized theoretical model of two factors (satisfaction / fun and boredom. The Spanish version of the instrument for PE showed acceptable levels of internal consistency.

  17. The SSI TOOLBOX Source Term Model SOSIM - Screening for important radionuclides and parameter sensitivity analysis

    Energy Technology Data Exchange (ETDEWEB)

    Avila Moreno, R.; Barrdahl, R.; Haegg, C.

    1995-05-01

    The main objective of the present study was to carry out a screening and a sensitivity analysis of the SSI TOOLBOX source term model SOSIM. This model is a part of the SSI TOOLBOX for radiological impact assessment of the Swedish disposal concept for high-level waste KBS-3. The outputs of interest for this purpose were: the total released fraction, the time of total release, the time and value of maximum release rate, the dose rates after direct releases of the biosphere. The source term equations were derived and simple equations and methods were proposed for calculation of these. A literature survey has been performed in order to determine a characteristic variation range and a nominal value for each model parameter. In order to reduce the model uncertainties the authors recommend a change in the initial boundary condition for solution of the diffusion equation for highly soluble nuclides. 13 refs.

  18. A university system's approach to enhancing the educational mission of health science schools and institutions: the University of Texas Academy of Health Science Education

    Directory of Open Access Journals (Sweden)

    L. Maximilian Buja

    2013-03-01

    Full Text Available Background: The academy movement developed in the United States as an important approach to enhance the educational mission and facilitate the recognition and work of educators at medical schools and health science institutions. Objectives: Academies initially formed at individual medical schools. Educators and leaders in The University of Texas System (the UT System, UTS recognized the academy movement as a means both to address special challenges and pursue opportunities for advancing the educational mission of academic health sciences institutions. Methods: The UTS academy process was started by the appointment of a Chancellor's Health Fellow for Education in 2004. Subsequently, the University of Texas Academy of Health Science Education (UTAHSE was formed by bringing together esteemed faculty educators from the six UTS health science institutions. Results: Currently, the UTAHSE has 132 voting members who were selected through a rigorous, system-wide peer review and who represent multiple professional backgrounds and all six campuses. With support from the UTS, the UTAHSE has developed and sustained an annual Innovations in Health Science Education conference, a small grants program and an Innovations in Health Science Education Award, among other UTS health science educational activities. The UTAHSE represents one university system's innovative approach to enhancing its educational mission through multi- and interdisciplinary as well as inter-institutional collaboration. Conclusions: The UTAHSE is presented as a model for the development of other consortia-type academies that could involve several components of a university system or coalitions of several institutions.

  19. Radiological and Medical Sciences Research Institute (RAMSRI) - Annual Report 2015

    International Nuclear Information System (INIS)

    2015-01-01

    The Radiological and Medical Sciences Research Institute (RAMSRI) is the fourth Research and Development Institute of the Ghana Atomic Energy Commission (GAEC), undertaking research in human health and nutrition. This annual report covers the major activities undertaken by RAMSRI for the year 2015. The activities are grouped under the following headings: Establishment; Personnel and Organisation; Major Activities of Centres; Ongoing IAEA TC Projects; Human Resource Development; IAEA Coordinated Meetings Hosted; Publications; Achievements; Challenges; Projections for the Year 2016; and Recommendations.

  20. Management information system of research institute supported by ministry of science and technology

    International Nuclear Information System (INIS)

    1992-12-01

    This book mentions development strategy of MIS. This book contains development strategy of MIS research institute supported by government, computerization of administrative work of research institute, library computer system, methodology on system development, LAN build of ministry science and technology, ocean data base energy data base, computerization of research data management case of construction and analysis for chemical DB, information system of life science, electronic data interchange, queueing theory, biotechnology and computer, comprehensive weather information system, special equipment of data and data processing of oil-hunt operation.

  1. Management information system of research institute supported by ministry of science and technology

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1992-12-15

    This book mentions development strategy of MIS. This book contains development strategy of MIS research institute supported by government, computerization of administrative work of research institute, library computer system, methodology on system development, LAN build of ministry science and technology, ocean data base energy data base, computerization of research data management case of construction and analysis for chemical DB, information system of life science, electronic data interchange, queueing theory, biotechnology and computer, comprehensive weather information system, special equipment of data and data processing of oil-hunt operation.

  2. 77 FR 58111 - Notice of Submission for OMB Review; Institute of Education Sciences; FAFSA Completion Project...

    Science.gov (United States)

    2012-09-19

    ... DEPARTMENT OF EDUCATION Notice of Submission for OMB Review; Institute of Education Sciences; FAFSA Completion Project Evaluation SUMMARY: The Institute of Education Sciences (IES) at the U.S. Department of Education (ED) is conducting a rigorous study of the Free Application for Federal Student Aid...

  3. Selective traditions in group discussions: teachers' views about good science and the possible obstacles when encountering a new topic

    Science.gov (United States)

    Lundqvist, Eva; Sund, Per

    2016-11-01

    There is an ongoing discussion about what content that should be taught in science education and there are different views among teachers about what represent good science content. However, teachers are not isolated individuals making their own interpretations, but are part of institutionalised systems building on patterns in the selection of teaching goals and content. Earlier research shows that teachers teach in alignment with different selective traditions, which can be understood as well-developed teaching habits. Individual teachers seem to develop their personal habits on the basis of the contextual situations created by earlier generations of teachers. In order to find out which content teachers find representative for science education, we asked nine teachers to take part in group interviews to talk about what they value as "good" science content. The participants were grouped according to their selective traditions expressed in earlier studies. The method was used to dynamically explore, challenge and highlight teachers' views. The starting point for the group discussions is national tests in science. In Sweden, national tests in biology, physics and chemistry were introduced in secondary school science (year 9) in 2009. One overarching aim of these tests is to support the implementation of the science curricula and to include for example knowledge about socio-scientific issues (SSI). The content of the tests can consequently be seen as important for teachers to consider. The findings show that `resistance' to including SSI is not just an issue for individual teachers. As individuals teachers can create many kinds of obstacles, but still be interested in integrating SSI in their science teaching. However, in group discussions the teachers tend to collectively adopt the scientific rational discourse. This discourse is what joins them and creates their common identity as science teachers. In turn, they seek to free scientific knowledge from social knowledge

  4. Science-policy interaction in the global greenhouse. Institutional design and institutional performance in the Intergovernmental Panel on Climate Change (IPCC)

    Energy Technology Data Exchange (ETDEWEB)

    Skodvin, Tora

    1999-08-01

    This paper explores the science-policy interaction and the extent to which and how institutional arrangements may be used as instruments for enhancing the effectiveness of the dialog. The first part develops the theory. The point of departure of the analysis is the internal dynamics of science and politics in their pure forms and the nature of the dynamics that are generated when these two distinct systems of behaviour meet. On this basis, then, the question of which functions the institutional apparatus should be able to serve in order to enhance the effectiveness of science-policy dialogue is addressed. This approach is then applied to an empirical case study of the Intergovernmental Panel on Climate Change (IPCC) from its establishment in 1988 to the provision of the Second IPCC Assessment Report in 1995. 53 refs., 3 figs., 2 tabs.

  5. Annual Report of National Institute of Radiological Sciences, April 1991 - March 1992

    International Nuclear Information System (INIS)

    1992-07-01

    This annual report is a compilation of the research activities and achievement in the National Institute of Radiological Sciences (NIRS) in Japan during the fiscal year 1991 (from April 1991 through March 1992). The research covers a wide range of radiological sciences from molecular to environmental studies and medicine including engineering. Topics consists of physics, chemistry, biomedical science, clinical research, and environmental sciences, covering a total of 69 titles. A list of publications by staff members, activities of research divisions, and organization chart of the NIRS are given in Appendix. (J.P.N.) 64 refs

  6. 77 FR 4572 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2012-01-30

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... Development in the Environmental Health Sciences; 93.113, Biological Response to Environmental Health Hazards... clearly unwarranted invasion of personal privacy. Name of Committee: National Institute of Environmental...

  7. 75 FR 41506 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2010-07-16

    ... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... Sciences; 93.113, Biological Response to Environmental Health Hazards; 93.114, Applied Toxicological... clearly unwarranted invasion of personal privacy. Name of Committee: National Institute of Environmental...

  8. Effects of different SSI parameters on the floor response spectra of a nuclear reactor building

    International Nuclear Information System (INIS)

    Kabir, A.F.; Bolourchi, S.; Maryak, M.E.

    1991-01-01

    The effects of several critical soil-structure interaction (SSI) parameters on the floor response spectra (FRS) of a typical nuclear reactor building have been examined. These parameters are computation of soil impedance functions using different approaches, scattering effects (reductions in ground motion due to embedment and rigidity of building foundation) and strain dependency of soil dynamic properties. This paper reports that the significant conclusions of the study, which are applicable to a deeply embedded very rigid nuclear reactor building, are as follows: FRS generated without considering scattering effects are highly conservative; differences between FRS, generated considering strain-dependency of soil dynamic properties, and those generated suing low-strain values, are not significant; and the lumped-parameter approach of SSI calculations, which only uses a single value of soil shear modulus in impedance calculations, may not be able to properly compute the soil impedances for a soil deposit with irregularly varying properties with depth

  9. The effects of a professional development geoscience education institute upon secondary school science teachers in Puerto Rico

    Science.gov (United States)

    Llerandi Roman, Pablo Antonio

    The geographic and geologic settings of Puerto Rico served as the context to develop a mixed methods investigation on: (1) the effects of a five-day long constructivist and field-based earth science education professional development institute upon 26 secondary school science teachers' earth science conceptual knowledge, perceptions of fieldwork, and beliefs about teaching earth science; and (2) the implementation of participants' newly acquired knowledge and experience in their science lessons at school. Qualitative data included questionnaires, semi-structured interviews, reflective journals, pre-post concept maps, and pre-post lesson plans. The Geoscience Concept Inventory and the Science Outdoor Learning Environment Inventory were translated into Spanish and culturally validated to collect quantitative data. Data was analyzed through a constructivist grounded theory methodology, descriptive statistics, and non-parametric methods. Participants came to the institute with serious deficiencies in earth science conceptual understanding, negative earth science teaching perspectives, and inadequate earth science teaching methodologies. The institute helped participants to improve their understanding of earth science concepts, content, and processes mostly related to the study of rocks, the Earth's structure, plate tectonics, maps, and the geology of Puerto Rico. Participants also improved their earth science teaching beliefs, perceptions on field-based education, and reflected on their environmental awareness and social responsibility. Participants greatly benefited from the field-based learning environment, inquiry-based teaching approaches modeled, the attention given to their affective domain, and reflections on their teaching practice as part of the institute's activities. The constructivist learning environment and the institute's contextualized and meaningful learning conceptual model were effective in generating interest and confidence in earth science teaching

  10. Summary of research in applied mathematics, numerical analysis and computer science at the Institute for Computer Applications in Science and Engineering

    Science.gov (United States)

    1984-01-01

    Research conducted at the Institute for Computer Applications in Science and Engineering in applied mathematics, numerical analysis and computer science during the period October 1, 1983 through March 31, 1984 is summarized.

  11. NASA's Solar System Exploration Research Virtual Institute: Merging Science and Exploration

    Science.gov (United States)

    Pendleton, Y. J.; Schmidt, G. K.; Bailey, B. E.; Minafra, J. A.

    2016-01-01

    NASA's Solar System Exploration Research Virtual Institute (SSERVI) represents a close collaboration between science, technology and exploration, and was created to enable a deeper understanding of the Moon and other airless bodies. SSERVI is supported jointly by NASA's Science Mission Directorate and Human Exploration and Operations Mission Directorate. The institute currently focuses on the scientific aspects of exploration as they pertain to the Moon, Near Earth Asteroids (NEAs) and the moons of Mars, but the institute goals may expand, depending on NASA's needs, in the future. The 9 initial teams, selected in late 2013 and funded from 2014-2019, have expertise across the broad spectrum of lunar, NEA, and Martian moon sciences. Their research includes various aspects of the surface, interior, exosphere, near-space environments, and dynamics of these bodies. NASA anticipates a small number of additional teams to be selected within the next two years, with a Cooperative Agreement Notice (CAN) likely to be released in 2016. Calls for proposals are issued every 2-3 years to allow overlap between generations of institute teams, but the intent for each team is to provide a stable base of funding for a five year period. SSERVI's mission includes acting as a bridge between several groups, joining together researchers from: 1) scientific and exploration communities, 2) multiple disciplines across a wide range of planetary sciences, and 3) domestic and international communities and partnerships. The SSERVI central office is located at NASA Ames Research Center in Mountain View, CA. The administrative staff at the central office forms the organizational hub for the domestic and international teams and enables the virtual collaborative environment. Interactions with geographically dispersed teams across the U.S., and global partners, occur easily and frequently in a collaborative virtual environment. This poster will provide an overview of the 9 current US teams and

  12. NASA's Solar System Exploration Research Virtual Institute: Merging Science and Exploration

    Science.gov (United States)

    Pendleton, Yvonne J.

    2016-10-01

    Established in 2013, through joint funding from the NASA Science Mission Directorate (SMD) and Human Exploration and Operations Mission Directorate (HEOMD), NASA's Solar System Exploration Research Virtual Institute (SSERVI) is focused on science at the intersection of these two enterprises. Addressing questions of value to the human exploration program that also represent important research relevant to planetary science, SSERVI creates a bridge between HEOMD and SMD. The virtual institute model reduces travel costs, but its primary virtue is the ability to join together colleagues who bring the right expertise, techniques and tools, regardless of their physical location, to address multi-faceted problems, at a deeper level than could be achieved through the typical period of smaller research grants. In addition, collaboration across team lines and international borders fosters the creation of new knowledge, especially at the intersections of disciplines that might not otherwise overlap.SSERVI teams investigate the Moon, Near-Earth Asteroids, and the moons of Mars, addressing questions fundamental to these target bodies and their near space environments. The institute is currently composed of nine U.S. teams of 30-50 members each, distributed geographically across the United States, ten international partners, and a Central Office located at NASA Ames Research Center in Silicon Valley, CA. U.S. teams are competitively selected through peer-reviewed proposals submitted to NASA every 2-3 years, in response to a Cooperative Agreement Notice (CAN). The current teams were selected under CAN-1, with funding for five years (2014-2019). A smaller, overlapping set of teams are expected to be added in 2017 in response to CAN-2, thereby providing continuity and a firm foundation for any directional changes NASA requires as the CAN-1 teams end their term. This poster describes the research areas and composition of the institute to introduce SSERVI to the broader planetary

  13. 75 FR 46950 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2010-08-04

    ... Health Sciences Special Emphasis Panel, Gulf Oil Spill Health Effects. Date: August 17, 2010. Time: 1 p.m...--Health Risks from Environmental Exposures; 93.142, NIEHS Hazardous Waste Worker Health and Safety... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Institute of...

  14. Science Information Centre and Nuclear Library of 'Jozef Stefan' Institute, Ljubljana, Slovenia

    International Nuclear Information System (INIS)

    Stante, A.; Smuc, S.

    2006-01-01

    The 'Jozef Stefan' Institute Science Information Centre is the central Slovene physics library and one of the largest special libraries in Slovenia. Our collection covers the fields of physics, chemistry, biochemistry, electronics, information science, artificial intelligence, energy management, environmental science, material science, robotics etc. The Nuclear Library at the Reactor Centre Podgorica is a part of the Science Information Centre. It collects and keeps literature from the field of reactor and nuclear energy and provides information to scientists employed at the Reactor Centre and users from the Nuclear Power Plant Krsko as well as other experts dealing with nuclear science and similar fields. The orders subscribed are sent by the Science Information Centre to other libraries included in inter-library lending in Slovenia and abroad. (author)

  15. Climate change, uncertainty, and resilient fisheries: Institutional responses through integrative science

    DEFF Research Database (Denmark)

    Miller, K.; Charles, A.; Barange, M.

    2010-01-01

    This paper explores the importance of a focus on the fundamental goals of resilience and adaptive capacity in the governance of uncertain fishery systems, particularly in the context of climate change. Climate change interacts strongly with fishery systems, and adds to the inherent uncertainty...... that understanding these aspects of fishery systems and fishery governance is valuable even in the absence of climate-induced processes of change, but that attention to climate change both reinforces the need for, and facilitates the move toward, implementation of integrative science for improved fishery governance....... and processes – to support suitable institutional responses, a broader planning perspective, and development of suitable resilience-building strategies. The paper explores how synergies between institutional change and integrative science can facilitate the development of more effective fisheries policy...

  16. Suborganizations of Institutions in Library and Information Science Journals

    Directory of Open Access Journals (Sweden)

    Dalibor Fiala

    2013-10-01

    Full Text Available In this paper, we analyze Web of Science data records of articles published from 1991 to 2010 in library and information science (LIS journals. We focus on addresses of these articles’ authors and create citation and collaboration networks of departments which we define as the first suborganization of an institution. We present various rankings of departments (e.g., by citations, times cited, PageRank, publications, etc. and highlight the most influential of them. The correlations between the individual departments are also shown. Furthermore, we visualize the most intense citation and collaboration relationships between “LIS” departments (many of which are not genuine LIS departments but merely affiliations of authors publishing in journals covered by the specific Web of Science category and give examples of two basic research performance distributions across departments of the leading universities in the field.

  17. U.S. Institutional Research Productivity in Major Science Education Research Journals: Top 30 for 2000's

    Science.gov (United States)

    Barrow, Lloyd H.; Tang, Nai-en

    2013-01-01

    VonAalst (2010) used Google Scholar to identify the top four science education research journals: "Journal of Research in Science Teaching," "Science Education," "International Journal of Science Education," and "Journal of Science Teacher Education." U.S. institutional productivity for 2000-2009 for the…

  18. Inequality in societies, academic institutions and science journals: Gini and k-indices

    Science.gov (United States)

    Ghosh, Asim; Chattopadhyay, Nachiketa; Chakrabarti, Bikas K.

    2014-09-01

    Social inequality is traditionally measured by the Gini-index (g). The g-index takes values from 0 to 1 where g=0 represents complete equality and g=1 represents complete inequality. Most of the estimates of the income or wealth data indicate the g value to be widely dispersed across the countries of the world: g values typically range from 0.30 to 0.65 at a particular time (year). We estimated similarly the Gini-index for the citations earned by the yearly publications of various academic institutions and the science journals. The ISI web of science data suggests remarkably strong inequality and universality (g=0.70±0.07) across all the universities and institutions of the world, while for the journals we find g=0.65±0.15 for any typical year. We define a new inequality measure, namely the k-index, saying that the cumulative income or citations of (1-k) fraction of people or papers exceed those earned by the fraction (k) of the people or publications respectively. We find, while the k-index value for income ranges from 0.60 to 0.75 for income distributions across the world, it has a value around 0.75±0.05 for different universities and institutions across the world and around 0.77±0.10 for the science journals. Apart from above indices, we also analyze the same institution and journal citation data by measuring Pietra index and median index.

  19. A Pedagogical Model for Ethical Inquiry into Socioscientific Issues In Science

    Science.gov (United States)

    Saunders, Kathryn J.; Rennie, Léonie J.

    2013-02-01

    Internationally there is concern that many science teachers do not address socioscientific issues (SSI) in their classrooms, particularly those that are controversial. However with increasingly complex, science-based dilemmas being presented to society, such as cloning, genetic screening, alternative fuels, reproductive technologies and vaccination, there is a growing call for students to be more scientifically literate and to be able to make informed decisions on issues related to these dilemmas. There have been shifts in science curricula internationally towards a focus on scientific literacy, but research indicates that many secondary science teachers lack the support and confidence to address SSI in their classrooms. This paper reports on a project that developed a pedagogical model that scaffolded teachers through a series of stages in exploring a controversial socioscientific issue with students and supported them in the use of pedagogical strategies and facilitated ways of ethical thinking. The study builds on existing frameworks of ethical thinking. It presents an argument that in today's increasingly pluralistic society, these traditional frameworks need to be extended to acknowledge other worldviews and identities. Pluralism is proposed as an additional framework of ethical thinking in the pedagogical model, from which multiple identities, including cultural, ethnic, religious and gender perspectives, can be explored.

  20. Equity in Elementary Science Education: A Study of Institutional and Policy Factors

    Science.gov (United States)

    Hayes, Kathryn N.

    Despite recognition that the foundation for interest in science is laid down at the elementary level (Tai, et al., 2006), in the last ten years elementary science instruction time has declined in K-6 schooling (Center on Education Policy, 2007). A lack of access to excellent science education is exacerbated for low-income students, prompting significant questions regarding inequities within the science education pipeline (Maulucci, 2010). The critical factors needed to address these inequities include teacher preparation, access to resources, and instructional leadership, as well as a supportive policy and institutional milieu. However, although the former three have been studied extensively, the role of policy and institutions in creating the conditions for equity in science education are little understood despite their likely significant role (Lemke, 2001). This mixed methods study addressed this gap by examining the role the policy and institutional milieu play in constraining or supporting equitable elementary science education. Institutional theory provides the framework for understanding how various institutional logics and regulatory pressures permeate schools and districts across contexts, influencing science education implementation (Scott, 2014). Two distinct approaches were used to first quantitatively examine the predictors of differentiation in elementary science education instructional time and methods, and second qualitatively analyze the nature and process by which these mechanisms exert influence. Data for the first two papers was derived from a case study of a purposively sampled district, including surveys of 200 teachers and embedded case studies of four schools. Analysis consisted of multi-level models of teacher attributes and school and policy factors in predicting differential distribution of science education instructional time and methods (Raudenbush & Bryk, 2002). Data for the third paper arose out of a series of principal, administrator

  1. Cyberinfrastructure for Open Science at the Montreal Neurological Institute.

    Science.gov (United States)

    Das, Samir; Glatard, Tristan; Rogers, Christine; Saigle, John; Paiva, Santiago; MacIntyre, Leigh; Safi-Harab, Mouna; Rousseau, Marc-Etienne; Stirling, Jordan; Khalili-Mahani, Najmeh; MacFarlane, David; Kostopoulos, Penelope; Rioux, Pierre; Madjar, Cecile; Lecours-Boucher, Xavier; Vanamala, Sandeep; Adalat, Reza; Mohaddes, Zia; Fonov, Vladimir S; Milot, Sylvain; Leppert, Ilana; Degroot, Clotilde; Durcan, Thomas M; Campbell, Tara; Moreau, Jeremy; Dagher, Alain; Collins, D Louis; Karamchandani, Jason; Bar-Or, Amit; Fon, Edward A; Hoge, Rick; Baillet, Sylvain; Rouleau, Guy; Evans, Alan C

    2016-01-01

    Data sharing is becoming more of a requirement as technologies mature and as global research and communications diversify. As a result, researchers are looking for practical solutions, not only to enhance scientific collaborations, but also to acquire larger amounts of data, and to access specialized datasets. In many cases, the realities of data acquisition present a significant burden, therefore gaining access to public datasets allows for more robust analyses and broadly enriched data exploration. To answer this demand, the Montreal Neurological Institute has announced its commitment to Open Science, harnessing the power of making both clinical and research data available to the world (Owens, 2016a,b). As such, the LORIS and CBRAIN (Das et al., 2016) platforms have been tasked with the technical challenges specific to the institutional-level implementation of open data sharing, including: Comprehensive linking of multimodal data (phenotypic, clinical, neuroimaging, biobanking, and genomics, etc.)Secure database encryption, specifically designed for institutional and multi-project data sharing, ensuring subject confidentiality (using multi-tiered identifiers).Querying capabilities with multiple levels of single study and institutional permissions, allowing public data sharing for all consented and de-identified subject data.Configurable pipelines and flags to facilitate acquisition and analysis, as well as access to High Performance Computing clusters for rapid data processing and sharing of software tools.Robust Workflows and Quality Control mechanisms ensuring transparency and consistency in best practices.Long term storage (and web access) of data, reducing loss of institutional data assets.Enhanced web-based visualization of imaging, genomic, and phenotypic data, allowing for real-time viewing and manipulation of data from anywhere in the world.Numerous modules for data filtering, summary statistics, and personalized and configurable dashboards. Implementing

  2. Annual report of national institute of radiological sciences, April 1990 - March 1991

    International Nuclear Information System (INIS)

    1991-07-01

    This annual report is a compilation of the research activities and achievement in the National Institute of Radiological Sciences (NIRS) in Japan during the fiscal year 1990 (from April 1990 through March 1991). The research covers a wide range of radiological sciences from molecular to environmental studies and medicine including engineering. Topics consists of physics, chemistry, bio-medical science, clinical research, and environmental sciences, covering a total of 86 titles. A list of publications by staff members, activities of research divisions, and organization chart of the NIRS are given in Appendix. (J.P.N.) 102 refs

  3. The Swedish Radiation Protection Institute's regulations concerning the final management of spent nuclear fuel and nuclear waste - with background and comments

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-11-01

    This report presents and comments on the Swedish Radiation Protection Institute's Regulations concerning the Protection of Human Health and the Environment in connection with the Final Management of Spent Nuclear Fuel or Nuclear Waste, SSI FS 1998: 1.

  4. Communicating Ocean Sciences to Informal Audiences (COSIA): Universities, Oceanographic Institutions, Science Centers and Aquariums Working Together to Improve Ocean Education and Public Outreach

    Science.gov (United States)

    Glenn, S.; McDonnell, J.; Halversen, C.; Zimmerman, T.; Ingram, L.

    2007-12-01

    Ocean observatories have already demonstrated their ability to maintain long-term time series, capture episodic events, provide context for improved shipboard sampling, and improve accessibility to a broader range of participants. Communicating Ocean Sciences, an already existing college course from COSEE-California has demonstrated its ability to teach future scientists essential communication skills. The NSF-funded Communicating Ocean Sciences to Informal Audiences (COSIA) project has leveraged these experiences and others to demonstrate a long-term model for promoting effective science communication skills and techniques applicable to diverse audiences. The COSIA effort is one of the pathfinders for ensuring that the new scientific results from the increasing U.S. investments in ocean observatories is effectively communicated to the nation, and will serve as a model for other fields. Our presentation will describe a long-term model for promoting effective science communication skills and techniques applicable to diverse audiences. COSIA established partnerships between informal science education institutions and universities nationwide to facilitate quality outreach by scientists and the delivery of rigorous, cutting edge science by informal educators while teaching future scientists (college students) essential communication skills. The COSIA model includes scientist-educator partnerships that develop and deliver a college course that teaches communication skills through the understanding of learning theory specifically related to informal learning environments and the practice of these skills at aquariums and science centers. The goals of COSIA are to: provide a model for establishing substantive, long-term partnerships between scientists and informal science education institutions to meet their respective outreach needs; provide future scientists with experiences delivering outreach and promoting the broader impact of research; and provide diverse role models

  5. Annual report of National Institute of Radiological Science, April 1994 -March 1995

    International Nuclear Information System (INIS)

    1996-03-01

    This annual report summarizes briefly the research activities and the achievement in the Institute for fiscal year of 1994 (from April 1994 to March 1995). As the middle of this period, commissioning of the new clinical trial of cancer treatment was successfully started using heavy ion beams of the HIMAC (heavy ion medical accelerator in Chiba) which was completed at the end of fiscal year 1993. At the same time, various kinds of basic research projects using the same heavy ion beams were also begun in an open use system available to many facilities outside the Institute. The Institute is covering a very wide area of comprehensive radiological sciences from molecular biology to environmental studies and radiation medicine including physics and engineering related to therapy and diagnosis. Therefore, the collected topics have been classified into several categories from physics to environmental science. The appendix of this report includes recent publication in each area, list of keywords, author, index, and organization and staff. (M.N.)

  6. Annual report of National Institute of Radiological Science, April 1994 - March 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-03-01

    This annual report summarizes briefly the research activities and the achievement in the Institute for fiscal year of 1994 (from April 1994 to March 1995). As the middle of this period, commissioning of the new clinical trial of cancer treatment was successfully started using heavy ion beams of the HIMAC (heavy ion medical accelerator in Chiba) which was completed at the end of fiscal year 1993. At the same time, various kinds of basic research projects using the same heavy ion beams were also begun in an open use system available to many facilities outside the Institute. The Institute is covering a very wide area of comprehensive radiological sciences from molecular biology to environmental studies and radiation medicine including physics and engineering related to therapy and diagnosis. Therefore, the collected topics have been classified into several categories from physics to environmental science. The appendix of this report includes recent publication in each area, list of keywords, author, index, and organization and staff. (M.N.)

  7. Annual report of National Institute for Fusion Science. April 2013 - March 2014

    International Nuclear Information System (INIS)

    2014-01-01

    This annual report summarizes achievements from research activities at the National Institute for Fusion Science (NIFS) between April 2013 and March 2014. NIFS is an inter-university research organization and conducts open collaboration research under three frameworks which are the General Collaboration Research, the Large Helical Device Collaboration Research and the Bilateral Collaboration Research. More than 500 collaborating studies were implemented during the covered period. About 2,400 collaborators studies were implemented during the covered period. About 2,400 collaborators participated in joint research from 220 external institutions. Many intensively advanced results in plasma physics, fusion science and related fields have been obtained from these studies. Not only NIFS, but also 6 university centers serve as joint research laboratories/centers under bilateral collaboration research. NIFS also organizes diversified frameworks for international collaboration through 6 bilateral agreements, 3 multi-lateral agreements and academic exchange agreements with 18 institutes abroad for the global development of the function of inter-university research organization. (J.P.N.)

  8. The systemic roles of SKI and SSI in the Swedish nuclear waste management system. Syncho's report for project RISCOM

    International Nuclear Information System (INIS)

    Espejo, R.; Gill, A.

    1998-01-01

    The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section 'A problem of identity'. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI's regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions

  9. Radiological and Medical Sciences Research Institute, Ghana Atomic Energy Commission: Annual Report 2014

    International Nuclear Information System (INIS)

    2014-01-01

    The Radiological and Medical Sciences Research Institute was established in 2009, as the forth research institute of the Ghana Atomic Energy Commission. This Annual Report provides an overview of the major activities of the Institutes in the year 2014. Major items covered in the report include: Strategic objectives; Collaborations; Personnel and Organisational Structure; Facilities and Technical Services; Summary of Research and Development Projects; Human Resource Development; Publications and Technical Reports.

  10. 76 FR 19104 - National Institute of General Medical Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2011-04-06

    ... General Medical Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... clearly unwarranted invasion of personal privacy. Name of Committee: National Institute of General Medical Sciences Special Emphasis Panel; 2011 NIH Director's Pioneer Awards. Date: May 2-4, 2011. Time: 7:45 a.m...

  11. NATO Advanced Research Institute on the Application of Systems Science to Energy Policy Planning

    CERN Document Server

    Cherniavsky, E; Laughton, M; Ruff, L

    1981-01-01

    The Advanced Research Institute (ARI) on "The Application of Systems Science to Energy Policy Planning" was held under the auspices of the NATO Special Programme Panel on Systems Science in collaboration with the National Center for Analysis of Energy Sys­ tems, Brookhaven National Laboratory, USA, as a part of the NATO Science Committee's continuous effort to promote the advancement of science through international cooperation. Advanced Research Institutes are sponsored by the NATO Science Committee for the purposes of bringing together senior scientists to seek consensus on an assessment of the present state of knowl­ edge on a specific topic and to make recommendations for future research directions. Meetings are structured to encourage inten­ sive group discussion. Invitees are carefully selected so that the group as a whole will contain the experience and expertise neces­ sary to make the conclusions valid and significant. A final report is published presenting the various viewpoints and conclusions....

  12. Science Hall of Atomic Energy in Research Reactor Institute, Kyoto University

    International Nuclear Information System (INIS)

    Hayashi, Takeo

    1979-01-01

    The Science Hall of Atomic Energy was built as a subsidiary facility of the Research Reactor Institute, Kyoto University. The purpose of this facility is to accept outside demands concerning the application of the research reactor. The building is a two story building, and has the floor area of 901.47 m 2 . There are an exhibition room, a library, and a big lecture room. In the exhibition room, models of the Kyoto University Research Reactor and the Kyoto University Critical Assembly are placed. Various pictures concerning the application of the reactor are on the wall. In the library, people from outside of the Institute can use various books on science. Books for boys and girls are also stocked and used for public use. At the lecture room, various kinds of meeting can be held. (Kato, T.)

  13. Relationships between academic institutions and industry in the life sciences--an industry survey.

    Science.gov (United States)

    Blumenthal, D; Causino, N; Campbell, E; Louis, K S

    1996-02-08

    Despite growing acceptance of relationships between academia and industry in the life sciences, systematic, up-to-date information about their extent and the consequences for the parties involved remains scarce. We attempted to collect information about the prevalence, magnitude, commercial benefits, and potential risks of such relationships by surveying a representative sample of life-science companies in the United States to determine their relationships with academic institutions. We collected data by telephone from May through September 1994 from senior executives of 210 life-science companies (of 306 companies surveyed; response rate, 69 percent). The sample contained all Fortune 500 companies in the fields of agriculture, chemicals, and pharmaceuticals; all international pharmaceutical companies with sales volumes similar to those of the Fortune 500 companies; and a random sample of non-Fortune 500 companies in the life sciences drawn from multiple commercial and noncommercial directories. Both the survey instrument and the survey methods resembled those of our 1984 study of 106 biotechnology companies, allowing us to assess the evolution of relationships between academia and industry over the past decade. Ninety percent of companies conducting life-science research in the United States had relationships involving the life sciences with an academic institution in 1994. Fifty-nine percent supported research in such institutions, providing an estimated $1.5 billion, or approximately 11.7 percent of all research-and-development funding received that year. The agreements with universities tended to be short-term and to involve small amounts, implying that most such relationships supported applied research or development. Over 60 percent of companies providing support for life-science research in universities had received patents, products, and sales as a result of those relationships. At the same time, the companies reported that their relationships with

  14. Development of generic soil profiles and soil data development for SSI analyses

    Energy Technology Data Exchange (ETDEWEB)

    Parker, Josh, E-mail: jparker@nuscalepower.com [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States); Khan, Mohsin; Rajagopal, Raj [ARES Corporation, 1990N California Boulevard, Suite 500, Walnut Creek, CA 94596 (United States); Groome, John [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States)

    2014-04-01

    This paper presents the approach to developing generic soil profiles for the design of reactor building for small modular reactor (SMR) nuclear power plant developed by NuScale Power. The reactor building is a deeply embedded structure. In order to perform soil structure interaction (SSI) analyses, generic soil profiles are required to be defined for the standardized Nuclear Power Plant (NPP) designs for the United States Nuclear Regulatory Commission (NRC) in a design control document (DCD). The development of generic soil profiles is based on utilization of information on generic soil profiles from the new standardized nuclear power plant designs already submitted to the NRC for license certification. Eleven generic soil profiles have been recommended, and those profiles cover a wide range of parameters such as soil depth, shear wave velocity, unit weight, Poisson's ratio, water table, and depth to rock strata. The soil profiles are developed for a range of shear wave velocities between bounds of 1000 fps and 8000 fps as inferred from NRC Standard Review Plan (NUREG 0800) Sections 3.7.1 and 3.7.2. To account for the soil degradation due to seismic events, the strain compatible soil properties are based on the EPRI generic soil degradation curves. In addition, one dimensional soil dynamic response analyses were performed to study the soil layer input motions for performing the SSI analyses.

  15. Summary of research conducted at the Institute for Computer Applications in Science and Engineering in applied mathematics, numerical analysis and computer science

    Science.gov (United States)

    1989-01-01

    Research conducted at the Institute for Computer Applications in Science and Engineering in applied mathematics, numerical analysis, and computer science during the period October 1, 1988 through March 31, 1989 is summarized.

  16. SSI response of a typical shear wall structure

    International Nuclear Information System (INIS)

    Johnson, J.J.; Maslenikov, O.R.; Schewe, E.C.

    1985-01-01

    The seismic response of a typical shear structure in a commercial nuclear power plant was investigated for a series of site and foundation conditions using best estimate and design procedures. The structure selected is a part of the Zion AFT complex which is a connected group of reinforced concrete shear wall buildings, typical of nuclear power plant structures. Comparisons between best estimate responses quantified the effects of placing the structure on different sites and founding it in different manners. Calibration factors were developed by comparing simplified SSI design procedure responses to responses calculated by best estimate procedures. Nineteen basic cases were analyzed - each case was analyzed for ten earthquakes targeted to the NRC R.G. 1.60 design response spectra. The structure is a part of the Zion auxiliary-fuel handling turbine building (AFT) complex to the Zion nuclear power plants. (orig./HP)

  17. Forty years of the Institute for Nuclear Research (Scientific session of the Physical Sciences Division of the Russian Academy of Sciences, 22 December 2010)

    International Nuclear Information System (INIS)

    2011-01-01

    On 22 December 2010, the scientific session of the Physical Sciences Division of the Russian Academy of Sciences (RAS), devoted to the 40th anniversary of the Institute for Nuclear Research, RAS, was held at the Institute for Nuclear Research, RAS in Troitsk. The agenda of the session announced on the website www.gpad.ac.ru of the RAS Physical Sciences Division listed the following reports: (1) Matveev V A (Institute for Nuclear Research, RAS, Moscow) ''Introductory word''; (2) Gavrin V N (Institute for Nuclear Research, RAS, Moscow) ''Contribution of the SAGE results to the understanding of solar physics and neutrino physics''; (3) Domogatsky G V (Institute for Nuclear Research, RAS, Moscow) ''Baikal neutrino experiment''; (4) Tkachev I I (Institute for Nuclear Research, RAS, Moscow) ''Observation of the Greisen - Zatsepin - Kuz'min effect at the Telescope Array Observatory''; (5) Kudenko Yu G (Institute for Nuclear Research, RAS, Moscow) ''Neutrino T2K experiment: the first results''; (6) Sadykov R A (Institute for Nuclear Research, RAS, Moscow) ''Fields of study of condensed media at the neutron facility at the INR, RAS''; (7) Zhuikov B L (Institute for Nuclear Research, RAS, Moscow) ''Production of isotopes at the INR, RAS: reality and prospects''. The papers written on the base of reports 1-5 and 7 are published below. In addition, the paper ''High-power diode-pumped alkali lasers'' by A M Shalagin is published. The paper is based on the report presented at the scientific session of the General Assembly of the Physical Sciences Division, RAS (13 December 2010) devoted to the 50th anniversary of the laser, the main materials of the session having been published in Usp. Fiz. Nauk 181 (8) 867 (2011) [Phys. Usp. 54 837 (2011)]. . Institute for Nuclear Research of the Russian Academy of Sciences turns 40, V A Matveev Physics-Uspekhi, 2011, Volume 54, Number 9, Pages 939-940 . The Russian-American gallium experiment SAGE, V N Gavrin Physics-Uspekhi, 2011, Volume 54

  18. Science Production in Germany, France, Belgium, and Luxembourg: Comparing the Contributions of Research Universities and Institutes to Science, Technology, Engineering, Mathematics, and Health.

    Science.gov (United States)

    Powell, Justin J W; Dusdal, Jennifer

    2017-01-01

    Charting significant growth in science production over the 20th century in four European Union member states, this neo-institutional analysis describes the development and current state of universities and research institutes that bolster Europe's position as a key region in global science. On-going internationalization and Europeanization of higher education and science has been accompanied by increasing competition as well as collaboration. Despite the policy goals to foster innovation and further expand research capacity, in cross-national and historical comparison neither the level of R&D investments nor country size accounts completely for the differential growth of scientific productivity. Based on a comprehensive historical database from 1900 to 2010, this analysis uncovers both stable and dynamic patterns of production and productivity in Germany, France, Belgium, and Luxembourg. Measured in peer-reviewed research articles collected in Thomson Reuters' Science Citation Index Expanded, which includes journals in the fields of Science, Technology, Engineering, Mathematics, and Health, we show the varying contributions of different organizational forms, especially research universities and research institutes. Comparing the institutionalization pathways that created the conditions necessary for continuous and strong growth in scientific productivity in the European center of global science emphasizes that the research university is the key organizational form across countries.

  19. Recent fusion research in the National Institute for Fusion Science

    International Nuclear Information System (INIS)

    Komori, Akio; Sakakibara, Satoru; Sagara, Akio; Horiuchi, Ritoku; Yamada, Hiroshi; Takeiri, Yasuhiko

    2011-01-01

    The National Institute for Fusion Science (NIFS), which was established in 1989, promotes academic approaches toward the exploration of fusion science for steady-state helical reactor and realizes the establishment of a comprehensive understanding of toroidal plasmas as an inter-university research organization and a key center of worldwide fusion research. The Large Helical Device (LHD) Project, the Numerical Simulation Science Project, and the Fusion Engineering Project are organized for early realization of net current free fusion reactor, and their recent activities are described in this paper. The LHD has been producing high-performance plasmas comparable to those of large tokamaks, and several new findings with regard to plasma physics have been obtained. The numerical simulation science project contributes understanding and systemization of the physical mechanisms of plasma confinement in fusion plasmas and explores complexity science of a plasma for realization of the numerical test reactor. In the fusion engineering project, the design of the helical fusion reactor has progressed based on the development of superconducting coils, the blanket, fusion materials and tritium handling. (author)

  20. 20 CFR 416.1826 - Showing that you are not married when you apply for SSI.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Showing that you are not married when you apply for SSI. 416.1826 Section 416.1826 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL... used on mail for each of you? (iv) Who owns or rents the place where you live? (v) Do any deeds, leases...

  1. Investigation of the Reliability of the SSI-3 for Preschool Persian-Speaking Children Who Stutter

    Science.gov (United States)

    Bakhtiar, Mehdi; Seifpanahi, Sadegh; Ansari, Hossein; Ghanadzade, Mehdi; Packman, Ann

    2010-01-01

    There is a pressing need in Iran for the translation of widely used speech-language assessment tools into Persian. This study reports the interjudge and intrajudge reliability of a Persian translation of the Stuttering Severity Instrument-3 (SSI-3) (Riley, 1994). There was greater than 80% interjudge and intrajudge agreement on scale scores for…

  2. SKI's and SSI's experiences from their participation in the siting of a final repository for spent nuclear fuel

    International Nuclear Information System (INIS)

    Westerlind, M.; Hedberg, B.

    2000-01-01

    This paper summarises some experiences gained by the SKI and SSI during the ongoing process for siting a final repository for spent nuclear fuel. The focus is on activities in the municipalities involved in the siting process. In order to give the proper context some basic elements in the legislation, which are important for public participation and confidence in the siting process, are outlined. The importance of clearly defined responsibilities and early participation of the regulators in the siting process are emphasised. It should be pointed out that this paper is not a comprehensive review of the Swedish situation but only contains a few selected issues and personal remarks from the authors. Thus, the views and opinions do not necessarily coincide with those of SKI and SSI. (authors)

  3. Radioactive waste treatment at the Boris Kidric Institute of nuclear sciences

    International Nuclear Information System (INIS)

    Vukovic, Z.

    1989-01-01

    The results of many years work on the problems of treatment and interim storage of radioactive waste at the Boris Kidric Institute of nuclear sciences are presented. The main R/D work based on chemical treatment, solidification and pressing is described (author)

  4. Radioactive waste treatment at the Boris Kidric Institute of nuclear sciences

    Energy Technology Data Exchange (ETDEWEB)

    Vukovic, Z [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1989-07-01

    The results of many years work on the problems of treatment and interim storage of radioactive waste at the Boris Kidric Institute of nuclear sciences are presented. The main R/D work based on chemical treatment, solidification and pressing is described (author)

  5. The effects of integrating service learning into computer science: an inter-institutional longitudinal study

    Science.gov (United States)

    Payton, Jamie; Barnes, Tiffany; Buch, Kim; Rorrer, Audrey; Zuo, Huifang

    2015-07-01

    This study is a follow-up to one published in computer science education in 2010 that reported preliminary results showing a positive impact of service learning on student attitudes associated with success and retention in computer science. That paper described how service learning was incorporated into a computer science course in the context of the Students & Technology in Academia, Research, and Service (STARS) Alliance, an NSF-supported broadening participation in computing initiative that aims to diversify the computer science pipeline through innovative pedagogy and inter-institutional partnerships. The current paper describes how the STARS Alliance has expanded to diverse institutions, all using service learning as a vehicle for broadening participation in computing and enhancing attitudes and behaviors associated with student success. Results supported the STARS model of service learning for enhancing computing efficacy and computing commitment and for providing diverse students with many personal and professional development benefits.

  6. 75 FR 1271 - Technical Revisions to the Supplemental Security Income (SSI) Regulations on Income and Resources

    Science.gov (United States)

    2010-01-11

    ... extend the home exclusion to beneficiaries who, because of domestic abuse, leave a home that had... Domestic Abuse An SSI applicant's or beneficiary's home and associated land are excluded from resources by... abuse leaves the home and resides elsewhere. Currently, a victim fleeing from domestic abuse may return...

  7. 78 FR 56902 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2013-09-16

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Institute of Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory Committee Act, as amended (5 U.S.C. App.), notice is hereby given of the following meeting. The meeting will be closed to the public in accordance...

  8. 78 FR 64221 - National Institute of Environmental Health Sciences; Notice of Closed Meetings

    Science.gov (United States)

    2013-10-28

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Institute of Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory Committee Act, as amended (5 U.S.C. App.), notice is hereby given of the following meetings. The meetings will be closed to the public in accordance...

  9. Preservice Science Teachers' Efficacy Regarding a Socioscientific Issue: A Belief System Approach

    Science.gov (United States)

    Kilinç, Ahmet; Kartal, Tezcan; Eroglu, Baris; Demiral, Ümit; Afacan, Özlem; Polat, Dilber; Demirci Guler, Mutlu P.; Görgülü, Özkan

    2013-01-01

    The aim of the present study was to understand the nature of teaching efficacy beliefs related to a socioscientific issue (SSI). We investigated Turkish preservice science teachers' teaching efficacy beliefs about genetically modified (GM) foods using a belief system approach. We assumed that preservice teachers' beliefs about GM foods (content…

  10. Aryabhatta Research Institute of Observational Sciences: reincarnation of a 50 year old State Observatory of Nainital

    Science.gov (United States)

    Sagar, Ram

    2006-03-01

    The fifty year old State Observatory, well known as U.P. State Observatory till the formation of Uttaranchal in November 2000, was reincarnated on March 22, 2004 as Aryabhatta Research Institute of Observational Sciences with acronym ARIES, an autonomous institute, under the Department of Science & Technology, Government of India. The growth of academic and technical activities and new mandate of the Institute are briefly described. In early 60's, the Institute was one of the 12 centres established by the Smithsonian Astrophysical Observatory, USA, all over the globe but the only centre in India for imaging artificial earth satellites. Commensurating with its observing capabilities, the Institute started a number of front-line research programmes during the last decade, e.g., optical follow up observations of GRB afterglows, radio and space borne astronomical resources, intra-night optical variability in active galactic nuclei as well as gravitational microlensing and milli-magnitude variations in the rapidly oscillating peculiar A type stars. As a part of atmospheric studies, characterisation of aerosol at an altitude of about 2 km is going on since 2002. ARIES has plans for establishing modern observing facilities equipped with latest backend instruments in the area of both astrophysics and atmospheric science. Formation of ARIES, therefore augurs well for the overall development of astrophysics and atmospheric science in India.

  11. Annual report-2011. Institute for Nuclear Research National Academy of Sciences of Ukraine

    International Nuclear Information System (INIS)

    Iivanyuk, F.O.

    2012-01-01

    Annual report contains information on the fundamental, scientific and applied investigations carried out in the Institute for Nuclear Research of the National Academy of Sciences of Ukraine in the year 2010. The report contains abstracts of research works in the fields of nuclear physics, atomic energy, radiation physics and radiation material science, physics of plasma, radiation ecology and biology.

  12. 78 FR 66947 - National Institute of General Medical Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2013-11-07

    ... Person: Robert Horowits, Ph.D., Senior Investigator, National Institute of General Medical Sciences..., Pharmacology, Physiology, and Biological Chemistry Research; 93.862, Genetics and Developmental Biology...

  13. Cl@ssi 2.0: experience in Emilia Romagna

    Directory of Open Access Journals (Sweden)

    Elena Pacetti

    2013-06-01

    Full Text Available This article presents some of the results of the Ministerial Initiative Cl@ssi 2.0 in the Emilia Romagna Region. Having described the reference field in which the scaffolding action of the research group of the University of Bologna, coordinated by Prof. Luigi Guerra, is positioned, the paper presents the coaching model through which the design and documentation of the teaching practices adopted in schools was supported. Analysing the experiences of the ER classes, we have identified eight project themes, subsequently modelled on two levels: the didactic modelling of the experiences (construction of interpretation hypotheses; and the construction of a themes/models map (checking/adapting the hypotheses, experimentation through which each school was able to describe and publish processes, products, etc. which characterised their specific project experience. The paper concludes with a series of general reflections on the three years' work.

  14. 75 FR 14565 - NIST Summer Institute for Middle School Science Teachers; Availability of Funds

    Science.gov (United States)

    2010-03-26

    ... areas of science, technology, engineering and mathematics (STEM) at the middle school level (grades 6-8... encourage them to inspire students to pursue careers in STEM fields. DATES: Proposals must be received at... educational institutions that are teaching students in the areas of Science, Technology, Engineering and...

  15. SSI and structural benchmarks

    International Nuclear Information System (INIS)

    Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.

    1987-01-01

    This paper presents the latest results of the ongoing program entitled, Standard Problems for Structural Computer Codes, currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to cut-off depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils. Further, the paper presents some key aspects of the Soil-Structure Interaction Workshop (NUREG/CP-0054) which was held in Bethesda, MD on June 1, 1986. Finally, recent efforts related to the task on the structural benchmarks are described

  16. Building Worlds and Learning Astronomy on Facebook Part III: Testing, Launch, and Evaluation

    Science.gov (United States)

    Harold, J.; Hines, D.; Vidugiris, E.; Goldman, K. H.

    2015-11-01

    James Harold (SSI), Dean Hines (STScI/SSI) and a team at the National Center for Interactive Learning at the Space Science Institute are developing Starchitect, an end-to-end stellar and planetary evolution game for the Facebook platform. Supported by NSF and NASA, and based in part on a prototype presented at ASP several years ago, Starchitect uses the “sporadic play” model of games such as Farmville, where players might only take actions a few times a day, but may continue playing for months. This paper is an update to a presentation at last year's ASP conference.

  17. Earth-based and Galileo SSI multispectral observations of eastern mare serenitatis and the Apollo 17 landing site

    Science.gov (United States)

    Hiesinger, H.; Jaumann, R.; Neukum, G.

    1993-01-01

    Both the Apollo 17 and the Mare Serenitatis region were observed by Galileo during its fly-by in December 1992. We used earth-based multispectral data to define mare units which then can be compared with the results of the Galileo SSI data evaluation.

  18. 75 FR 5771 - Institute of Education Sciences; Overview Information; Education Research and Special Education...

    Science.gov (United States)

    2010-02-04

    ... DEPARTMENT OF EDUCATION Institute of Education Sciences; Overview Information; Education Research and Special Education Research Grant Programs; Notice Inviting Applications for New Awards for Fiscal....305D, 84.305E, 84.324A, 84.324B, and 84.324C. Summary: The Director of the Institute of Education...

  19. Annual report of National Institute for Fusion Science. April 2011 - March 2012

    International Nuclear Information System (INIS)

    2012-01-01

    This annual report summarizes the research activities at NIFS (the National Institute for Fusion Science) between April 2011 and March 2012. NIFS is pursuing the integration of science and technology to realize a fusion power plant. The systematization of plasma physics, and research and development of reactor relevant engineering are key elements in our strategy. NIFS has been exploiting its role as an inter-university research organization and executing a variety of excellent collaborating studies together with universities and research institutes abroad as well as in Japan. The major projects of NIFS are the Large Helical Device (LHD) Project, the Numerical Simulation Research Project, the Fusion Engineering Research Project and the Coordination Research Project. These major projects are accompanied by unique supporting research. Advanced engineering and fusion reactor design studies are strongly promoted. (J.P.N.)

  20. Annual report of National Institute for Fusion Science. April 2009 - March 2010

    International Nuclear Information System (INIS)

    2010-01-01

    This annual report summarizes the research activities at NIFS (the National Institute for Fusion Science) between April 2009 and March 2010. NIFS is pursuing the integration of science and technology to realize a fusion power plant. The systematization of plasma physics, and research and development of reactor relevant engineering are key elements in our strategy. NIFS has been exploiting its role as an inter-university research organization and executing a variety of excellent collaborating studies together with universities and research institutes abroad as well as in Japan. The major projects of NIFS are the Large Helical Device (LHD) Project, the Numerical Simulation Research Project, the Fusion Engineering Research Project and the Coordination Research Project. These major projects are accompanied by unique supporting research. Advanced engineering and fusion reactor design studies are strongly promoted. (J.P.N.)

  1. Annual report of National Institute for Fusion Science. April 2012 - March 2013

    International Nuclear Information System (INIS)

    2013-01-01

    This annual report summarizes the research activities at NIFS (the National Institute for Fusion Science) between April 2012 and March 2013. NIFS is pursuing the integration of science and technology to realize a fusion power plant. The systematization of plasma physics, and research and development of reactor relevant engineering are key elements in our strategy. NIFS has been exploiting its role as an inter-university research organization and executing a variety of excellent collaborating studies together with universities and research institutes abroad as well as in Japan. The major projects of NIFS are the Large Helical Device (LHD) Project, the Numerical Simulation Research Project, the Fusion Engineering Research Project and the Coordination Research Project. These major projects are accompanied by unique supporting research. Advanced engineering and fusion reactor design studies are strongly promoted. (J.P.N.)

  2. Activities of the Research Institute for Advanced Computer Science

    Science.gov (United States)

    Oliger, Joseph

    1994-01-01

    The Research Institute for Advanced Computer Science (RIACS) was established by the Universities Space Research Association (USRA) at the NASA Ames Research Center (ARC) on June 6, 1983. RIACS is privately operated by USRA, a consortium of universities with research programs in the aerospace sciences, under contract with NASA. The primary mission of RIACS is to provide research and expertise in computer science and scientific computing to support the scientific missions of NASA ARC. The research carried out at RIACS must change its emphasis from year to year in response to NASA ARC's changing needs and technological opportunities. Research at RIACS is currently being done in the following areas: (1) parallel computing; (2) advanced methods for scientific computing; (3) high performance networks; and (4) learning systems. RIACS technical reports are usually preprints of manuscripts that have been submitted to research journals or conference proceedings. A list of these reports for the period January 1, 1994 through December 31, 1994 is in the Reports and Abstracts section of this report.

  3. Secondary surgical-site infection after coronary artery bypass grafting: A multi-institutional prospective cohort study.

    Science.gov (United States)

    Gulack, Brian C; Kirkwood, Katherine A; Shi, Wei; Smith, Peter K; Alexander, John H; Burks, Sandra G; Gelijns, Annetine C; Thourani, Vinod H; Bell, Daniel; Greenberg, Ann; Goldfarb, Seth D; Mayer, Mary Lou; Bowdish, Michael E

    2018-04-01

    To analyze patient risk factors and processes of care associated with secondary surgical-site infection (SSI) after coronary artery bypass grafting (CABG). Data were collected prospectively between February and October 2010 for consenting adult patients undergoing CABG with saphenous vein graft (SVG) conduits. Patients who developed a deep or superficial SSI of the leg or groin within 65 days of CABG were compared with those who did not develop a secondary SSI. Among 2174 patients identified, 65 (3.0%) developed a secondary SSI. Median time to diagnosis was 16 days (interquartile range 11-29) with the majority (86%) diagnosed after discharge. Gram-positive bacteria were most common. Readmission was more common in patients with a secondary SSI (34% vs 17%, P < .01). After adjustment, an open SVG harvest approach was associated with an increased risk of secondary SSI (adjusted hazard ratio [HR], 2.12; 95% confidence interval [CI], 1.28-3.48). Increased body mass index (adjusted HR, 1.08, 95% CI, 1.04-1.12) and packed red blood cell transfusions (adjusted HR, 1.13; 95% CI, 1.05-1.22) were associated with a greater risk of secondary SSI. Antibiotic type, antibiotic duration, and postoperative hyperglycemia were not associated with risk of secondary SSI. Secondary SSI after CABG continues to be an important source of morbidity. This serious complication often occurs after discharge and is associated with open SVG harvesting, larger body mass, and blood transfusions. Patients with a secondary SSI have longer lengths of stay and are readmitted more frequently. Copyright © 2017 The American Association for Thoracic Surgery. Published by Elsevier Inc. All rights reserved.

  4. The role of Swedish Radiation Protection Authority in the field of public health; SSI:s roll i folkhaelsoarbetet - redovisning av regeringsuppdrag inom folkhaelsoomraadet

    Energy Technology Data Exchange (ETDEWEB)

    Cederlund, Torsten; Finck, Robert; Mjoenes, Lars; Moberg, Leif; Soederman, Ann-Louis; Wiklund, Aasa; Yuen Katarina; Oelander Guer, Hanna

    2004-09-01

    The Swedish Government has requested the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures.

  5. Science self-efficacy of African Americans enrolled in freshman level physical science courses in two historically black institutions

    Science.gov (United States)

    Prihoda, Belinda Ann

    2011-12-01

    Science education must be a priority for citizens to function and be productive in a global, technological society. African Americans receive fewer science degrees in proportion to the Caucasian population. The primary purposes of this study were to determine the difference between the pretest and posttest science self-efficacy scores of African-American nonscience majors, the difference between the pretest and posttest science self-efficacy scores of African-American science majors, the relationship between science self-efficacy and course grade, the relationship between gender and science self-efficacy score, and the relationship between science self-efficacy score and course withdrawal. This study utilized a Likert survey instrument. All participants were enrolled in freshman level courses in the physical sciences at a historically black institution: a college or university. Participants completed the pretest survey within two weeks after the 12th class day of the semester. Initially, 458 participants completed the pretest survey. The posttest was administered within two weeks before the final exam. Only 245 participants completed the posttest survey. Results indicate that there is a difference in science self-efficacy of science majors and nonscience majors. There was no significant difference between the pretest and posttest science self-efficacy scores of African-American science majors and nonscience majors. There was no significant relationship between science self-efficacy and course grade, gender and science self-efficacy score, and course withdrawal and science self-efficacy score.

  6. Central Scientific and Research Institute of Nuclear Information as the branch centre of information on nuclear science and engineering

    International Nuclear Information System (INIS)

    Arkhangel'skij, I.A.; Sokolov, D.D.; Kalinin, V.F.; Nikiforov, V.S.

    1982-01-01

    The main tasks are considered in the scope of the Central Scientific-Research Institute for Information and Technological and Economic Studies on Nuclear Science and Technology. (TsNIIAtominform). The institute coordinates scientific research and information activity of information agencies of all the USSR organizations engaged in nuclear science and technology, excercises a centralized completion of their libraries, develops and puts into practice the most progressive methods for the information servicing. The institute is a national INIS center of the USSR. Here a system for the automatic information dissemination has been successfully elaborated and employed. Much of the institute activity is given to the estimation and analysis of information and to the determination of tendencies in the nuclear science and technology development. A conclusion is drawn to the effect that TsNIIAtominform, within 15 years of its existence, has formed as a center ensuring functioning of the system of scientific and technical information on nuclear science and technology

  7. Science on the net: an analysis of the websites of the European public research institutions

    Directory of Open Access Journals (Sweden)

    Laura Massoli

    2007-09-01

    Full Text Available This article introduces a study on the websites of several European public research institutions that aims at identifying the science communication model chosen and implemented online with the purpose of reaching different target publics. The analytical approach takes into account a number of indicators: from the institutional identity to the scientific features, from the interactive services to the internationalisation level, in order to evaluate whether the web provides an added value in the adopted communication model and in building a relation with the users. Lights and shades emerge from this study in which good practices side examples of a much weaker science communication approach, outlining a general context where a public research institution website has been still used as a presentation tool and its interactive opportunities have not been capitalised.

  8. The systematic roles of SKI and SSI in the Swedish nuclear waste management system. Syncho`s report for project RISCOM

    Energy Technology Data Exchange (ETDEWEB)

    Espejo, R. [Syncho, Solihull (United Kingdom); Gill, A. [Syncho, Oxon (United Kingdom)

    1998-01-01

    The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section `A problem of identity`. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI`s regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions.

  9. Towards Strategic Actorhood? The Execution of Institutional Positioning Strategies at Finnish Universities of Applied Sciences

    Science.gov (United States)

    Vuori, Johanna

    2016-01-01

    Given the emerging interest in institutional positioning and to augment the small number of empirical studies in this field, this paper presents discussion about how Finnish universities of applied sciences implement their profiling strategies. The analysis is based on an examination of documents recently submitted by these institutions when…

  10. "Wow! Look at That!": Discourse as a Means to Improve Teachers' Science Content Learning in Informal Science Institutions

    Science.gov (United States)

    Holliday, Gary M.; Lederman, Judith S.; Lederman, Norman G.

    2014-01-01

    Currently, it is not clear whether professional development staff at Informal Science Institutions (ISIs) are considering the way exhibits contribute to the social aspects of learning as described by the contextual model of learning (CML) (Falk & Dierking in "The museum experience." Whalesback, Washington, 1992; "Learning from…

  11. Annual report of Nuclear Science Research Institute, JFY2005

    International Nuclear Information System (INIS)

    2007-04-01

    Japan Atomic Energy Agency (JAEA) was inaugurated on October 1st, 2005. Works for the operation and maintenance of various research facilities as well as safety management, radiation protection, and radioactive wastes management, which have been undertaken by departments in Tokai Research Establishment of Japan Atomic Energy Research Institute (JAERI), were inherited by newly established departments of Nuclear Science Research Institute (NSRI). The NSRI is composed of Planning and Coordination Office and seven departments such as Department of Operational Safety Administration, Department of Radiation Protection, Department of Research Reactor and Tandem Accelerator, Department of Hot Laboratories and Facilities, Department of Criticality and Fuel Cycle Research Facilities, Department of Decommissioning and Waste Management, and Engineering Services Department. This annual report of JFY 2005 summarizes the activities of NSRI and is expected to be referred to and utilized by R and D departments and project promotion sectors at NSRI site for the enhancement of their own research and management activities to attain their goals according to Middle-term Plan' successfully and effectively. In chapter 1, outline of organization and administrative activities of NSRI is described. In chapter 2, the following activities made by the departments in NSRI are summarized, i.e., (1) operation and maintenance of research reactors (JRR-3, JRR-4, NSRR), criticality assemblies (STACY, TRACY, FCA, TCA), hot laboratories, (BECKY, Reactor Fuel Examination Facility, WASTEF, Research Laboratory 4, Plutonium Research Laboratory 1, Tokai Hot Laboratory, etc), and large-scale facilities (Tandem accelerator, LSTF, THYNC, TPTF, etc), and (2) safety management, radiation protection, management of radioactive wastes, decommissioning of nuclear facilities, engineering services, utilities and maintenance, etc, all of which are indispensable for the stable and safe operation and utilization of the

  12. Development of atomic spectroscopy methods in geological institutes of Faculty of Natural Sciences Comenius University and Slovak Academy of Science

    International Nuclear Information System (INIS)

    Medved, E.

    1998-01-01

    Development of atomic spectrochemistry methods in Geological Institute of Faculty of Natural Sciences, Comenius University (GI FNS CU) is connected with its establishment in 1957. Its instrumental equipment and location resulted from the already existing Laboratory in the Chair for Mineralogy and Crystallography of FNS CU. In Geological Institute of Slovak Academy of Science (GI SAS) the development of atomic spectroscopy methods started later, only since 1963, when the Member of Academy, Prof. RNDr. B. Cambel, DrSc. became its director. In both institutes the methods of atomic emission spectrography were used as first. A new quality in the development started since 1969 when the Institutes moved to common buildings in Petrzalka (Bratislava), the first atomic absorption spectrometers were acquired and the Institutes were 'strengthened' by coming of Prof. Ing. E. Plsko, DrSc. In the following years the Institutes started to collaborate with some other organisations which were equipped with new facilities, e.g. in 1975 with X-ray fluorescence spectrometer, electron microprobe and in 1985 with inductively coupled plasma atomic emission spectrometer. This enabled to improve essentially the quality of research activities of both institutes in the chemical characterisation of geological materials, as well as in pedagogical work (students practice, diploma works and dissertations). In the present time characterized by new economic conditions a reduction of GI SAS laboratory activities has been realised. The laboratories of the GI FNS CU have, thanks to their director Ing. V. Stresko, PhD. shown also hence-forward a rich research, pedagogical and society activities what can be documented by numerous publications, citations, obtained awards, representations in professional societies and commissions, local and foreign advisory boards, accreditation boards etc. (author)

  13. Aspen Global Change Institute Summer Science Sessions

    Energy Technology Data Exchange (ETDEWEB)

    Katzenberger, John; Kaye, Jack A

    2006-10-01

    The Aspen Global Change Institute (AGCI) successfully organized and convened six interdisciplinary meetings over the course of award NNG04GA21G. The topics of the meetings were consistent with a range of issues, goals and objectives as described within the NASA Earth Science Enterprise Strategic Plan and more broadly by the US Global Change Research Program/Our Changing Planet, the more recent Climate Change Program Strategic Plan and the NSF Pathways report. The meetings were chaired by two or more leaders from within the disciplinary focus of each session. 222 scholars for a total of 1097 participants-days were convened under the auspices of this award. The overall goal of each AGCI session is to further the understanding of Earth system science and global environmental change through interdisciplinary dialog. The format and structure of the meetings allows for presentation by each participant, in-depth discussion by the whole group, and smaller working group and synthesis activities. The size of the group is important in terms of the group dynamics and interaction, and the ability for each participant's work to be adequately presented and discussed within the duration of the meeting, while still allowing time for synthesis

  14. Annual report of National Institute of Radiological Sciences, April 1989 - March 1990

    International Nuclear Information System (INIS)

    1990-07-01

    This annual report is a compilation of the research activities and achievement in the National Institute of Radiological Sciences (NIRS) in Japan during the fiscal year 1990 (from April 1989 through March 1990). Efforts at the NIRS are particularly aimed at three long term projects: 'risk due to low level radiation exposure to the general population', 'assessment of radiation exposure of the public to radioactivities as related to the environment', and 'food chain and medical use of accelerated heavy ions'. The research covers a wide range of radiological sciences from molecular to environmental studies and medicine including engineering. Topics consists of physics, chemistry, bio-medical science, clinical research, and environmental sciences, covering a total of 80 titles. A list of publications by staff members, activities of research divisions, and organization chart of the NIRS are given in Appendix. (N.K.)

  15. Case Studies of Secondary School Teachers Designing Socioscientific Issues-Based Instruction and Their Students' Socioscientific Reasoning

    Science.gov (United States)

    Karahan, Engin

    Addressing socioscientific issues (SSI) has been one of the main focuses in science education since the Science, Technology, and Society (STS) movement in the 1970s (Levinson, 2006); however, teaching controversial socioscientific issues has always been challenging for teachers (Dillon, 1994; Osborne, Duschl, & Fairbrother, 2002). Although teachers exhibit positive attitudes for using controversial socioscientific issues in their science classrooms, only a small percentage of them actually incorporate SSI content into their science curricula on a regular basis (Sadler, Amirshokoohi, Kazempour, & Allspaw, 2006; Lee & Witz, 2009). The literature in science education has highlighted the signi?cant relationships among teacher beliefs, teaching practices, and student learning (Bryan & Atwater, 2002; King, Shumow, & Lietz, 2001; Lederman, 1992). Despite the fact that the case studies present a relatively detailed picture of teachers' values and motivations for teaching SSI (e.g. Lee, 2006; Lee & Witz, 2009; Reis & Galvao, 2004), these studies still miss the practices of these teachers and potential outcomes for their students. Therefore, there is a great need for in-depth case studies that would focus on teachers' practices of designing and teaching SSI-based learning environments, their deeper beliefs and motivations for teaching SSI, and their students' response to these practices (Lee, 2006). This dissertation is structured as three separate, but related, studies about secondary school teachers' experiences of designing and teaching SSI-based classes and their students' understanding of science and SSI reasoning. The case studies in this dissertation seek answers for (1) teachers' practices of designing and teaching SSI-based instruction, as well as its relation to their deeper personal beliefs and motivations to teach SSI, and (2) how their students respond to their approaches of teaching SSI in terms of their science understanding and SSI reasoning. The first paper

  16. Developing institutional collaboration between Wageningen University and the Chinese Academy of Agricultural Sciences

    OpenAIRE

    Bonnema, A.B.; Lin, Zhai; Qu, Liang; Jacobsen, E.

    2006-01-01

    Scientific co-operation between the Chinese Academy of Agricultural Sciences (CAAS) and Wageningen University (WU) has been underway since 1990, especially in the field of plant sciences. In 2001, CAAS and WU initiated a formal joint PhD training programme to further structure their co-operation. The goals of this co-operation are to: (1) initiate long-term institutional collaboration through capacity building; (2) jointly establish a modern laboratory; (3) jointly develop a cross-cultural sc...

  17. The final Galileo SSI observations of Io: Orbits G28-I33

    Science.gov (United States)

    Turtle, E.P.; Keszthelyi, L.P.; McEwen, A.S.; Radebaugh, J.; Milazzo, M.; Simonelli, D.P.; Geissler, P.; Williams, D.A.; Perry, J.; Jaeger, W.L.; Klaasen, K.P.; Breneman, H.H.; Denk, T.; Phillips, C.B.

    2004-01-01

    We present the observations of Io acquired by the Solid State Imaging (SSI) experiment during the Galileo Millennium Mission (GMM) and the strategy we used to plan the exploration of Io. Despite Galileo's tight restrictions on data volume and downlink capability and several spacecraft and camera anomalies due to the intense radiation close to Jupiter, there were many successful SSI observations during GMM. Four giant, high-latitude plumes, including the largest plume ever observed on Io, were documented over a period of eight months; only faint evidence of such plumes had been seen since the Voyager 2 encounter, despite monitoring by Galileo during the previous five years. Moreover, the source of one of the plumes was Tvashtar Catena, demonstrating that a single site can exhibit remarkably diverse eruption styles - from a curtain of lava fountains, to extensive surface flows, and finally a ??? 400 km high plume - over a relatively short period of time (??? 13 months between orbits 125 and G29). Despite this substantial activity, no evidence of any truly new volcanic center was seen during the six years of Galileo observations. The recent observations also revealed details of mass wasting processes acting on Io. Slumping and landsliding dominate and occur in close proximity to each other, demonstrating spatial variation in material properties over distances of several kilometers. However, despite the ubiquitous evidence for mass wasting, the rate of volcanic resurfacing seems to dominate; the floors of paterae in proximity to mountains are generally free of debris. Finally, the highest resolution observations obtained during Galileo's final encounters with Io provided further evidence for a wide diversity of surface processes at work on Io. ?? 2003 Elsevier Inc. All rights reserved.

  18. Waste management in the Institute for Nuclear Sciences 'Vinca' - Belgrade

    International Nuclear Information System (INIS)

    Raicevic, J.; Avramovic, I.; Plecas, I.; Mandic, M.; Goldammer, W.

    2004-01-01

    The Vinca Institute of Nuclear Sciences served for many years as the only Yugoslav (Serbia and Montenegro) nuclear institute. Therefore, it acted for many years as national storage facility for the radioactive waste from all institutional (medical, military, etc.) activities. The interim storage was situated within the Vinca Institute historically at several different places. The main fraction of the wastes is stored in two metallic hangars. In addition, underground stainless steel tanks in concrete shields have been constructed to accept all processed liquid waste from the research reactor RA. The current situation of the interim storage facilities is not satisfactory. However, the principle limitation for improvements of the waste management at the Vinca Institute lies in the fact that long-term solutions cannot be addressed at the moment. Plans for a final repository for radioactive waste do not exist yet in the Serbia and Montenegro. Consequently, waste management can only address an interim solution. In order to conduct all waste management activities in a safe manner, an overall strategy and study for improvement/rearrangement of radioactive waste storage facilities was developed which addresses all wastes and their management. The IAEA is providing assistance to these activities. This support includes a project which has been initiated by the IAEA to improve the waste management at the Vinca Institute. This paper describes the current status of the development of this overall strategy and study for improvement/rearrangement of radioactive waste storage facilities. The information available and the current status of the development of concepts for the processing and storage of the waste are summarised. (author)

  19. Annual report of National Institute of Radiological Sciences, 2001

    International Nuclear Information System (INIS)

    2002-10-01

    From this year, National Institute of Radiological Sciences (NIRS) started as an administrative corporation independent of the Government and concomitant internal re-organization was conducted: Three major Centers for Radiation safety, Radiation Emergency Medicine and Charged Particle Therapy were made. This report contains the summary of NIRS activities; research and development including studies of important project, fundamental research, fundamental and frontier research, contract research and fact-finding; management; organization/budget/finance; and appendix. Important projects are radiological studies in advanced medicine, on sensitivity, of effects on human and of hazard. Fundamental research concerns studies of environmental radiation, radiobiology, heavy particle ion therapy, diagnostic imaging, dose assessment and protection in medical radiation, brain function, systematic basic technology of nuclear sciences and international cooperation. Fact-finding studies are on the present situations of people exposed by nuclear experiment at Bikini Atoll in 1954 and of patients treated with thorotrast in past. Appendix cites the personnel name list, honorable events, cooperative studies, patent situation and others. (N.I.)

  20. Section 7033 of the America COMPETES Act: Hispanic-Serving Institutions and Science, Technology, Engineering and Mathematics (STEM)

    Science.gov (United States)

    Gartrell, Sandra

    2009-01-01

    On March 1, 2009 from 2 pm to 5 pm at the Madison Hotel in Washington, DC, the National Science Foundation hosted a listening session, requesting input on Section 7033 of the America COMPETES (Creating Opportunities to Meaningfully Promote Excellence in Technology, Education, and Science) Act regarding Hispanic-serving institutions and science,…

  1. Member Perceptions of Informal Science Institution Graduate Certificate Program: Case Study of a Community of Practice

    Science.gov (United States)

    Ball, Lois A.

    This research attempted to understand the experiences of a cohort of informal and formal science educators and informal science institution (ISI) community representatives during and after completion of a pilot graduate certificate program. Informal science educators (ISEs) find limited opportunities for professional development and support which influence their contributions to America's science literacy and school science education. This emergent design nested case study described how an innovative program provided professional development and enabled growth in participants' abilities to contribute to science literacy. Data were collected through interviews, participant observations, and class artifacts. The program by design and constituency was the overarching entity that accounted for members' experiences. Three principal aspects of the ISI certificate program and cohort which influenced perceptions and reported positive outcomes were (1) the cohort's composition and their collaborative activities which established a vigorous community of practice and fostered community building, mentoring, and networking, (2) long term program design and implementation which promoted experiential learning in a generative classroom, and (3) ability of some members who were able to be independent or autonomous learners to embrace science education reform strategies for greater self-efficacy and career advancement. This research extends the limited literature base for professional development of informal science educators and may benefit informal science institutions, informal and formal science educators, science education reform efforts, and public education and science-technology-society understanding. The study may raise awareness of the need to establish more professional development opportunities for ISEs and to fund professional development. Further, recognizing and appreciating informal science educators as a diverse committed community of professionals who positively

  2. New Developments At The Science Archives Of The NASA Exoplanet Science Institute

    Science.gov (United States)

    Berriman, G. Bruce

    2018-06-01

    The NASA Exoplanet Science Institute (NExScI) at Caltech/IPAC is the science center for NASA's Exoplanet Exploration Program and as such, NExScI operates three scientific archives: the NASA Exoplanet Archive (NEA) and Exoplanet Follow-up Observation Program Website (ExoFOP), and the Keck Observatory Archive (KOA).The NASA Exoplanet Archive supports research and mission planning by the exoplanet community by operating a service that provides confirmed and candidate planets, numerous project and contributed data sets and integrated analysis tools. The ExoFOP provides an environment for exoplanet observers to share and exchange data, observing notes, and information regarding the Kepler, K2, and TESS candidates. KOA serves all raw science and calibration observations acquired by all active and decommissioned instruments at the W. M. Keck Observatory, as well as reduced data sets contributed by Keck observers.In the coming years, the NExScI archives will support a series of major endeavours allowing flexible, interactive analysis of the data available at the archives. These endeavours exploit a common infrastructure based upon modern interfaces such as JuypterLab and Python. The first service will enable reduction and analysis of precision radial velocity data from the HIRES Keck instrument. The Exoplanet Archive is developing a JuypterLab environment based on the HIRES PRV interactive environment. Additionally, KOA is supporting an Observatory initiative to develop modern, Python based pipelines, and as part of this work, it has delivered a NIRSPEC reduction pipeline. The ensemble of pipelines will be accessible through the same environments.

  3. 78 FR 7794 - National Institute of Environmental Health Sciences; Notice of Closed Meeting

    Science.gov (United States)

    2013-02-04

    ... Health Sciences Special Emphasis Panel, Sentinel Animal Study for Public Health. Date: February 27, 2013... from Environmental Exposures; 93.142, NIEHS Hazardous Waste Worker Health and Safety Training; 93.143...; 93.114, Applied Toxicological Research and Testing, National Institutes of Health, HHS) Dated...

  4. The role of Swedish Radiation Protection Authority in the field of public health 2008; SSI:s roll i folkhaelsoarbetet 2008 - redovisning av regeringsuppdrag inom folkhaelsoomraadet

    Energy Technology Data Exchange (ETDEWEB)

    Hyrke, Lena; Almen, Anja; Blixt, Anders; Brewitz, Erica; Mjoenes, Lars; Moberg, Leif; Skeppstroem, Kirlna; Wester, Ulf

    2008-04-15

    The Swedish Government has requested that the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures

  5. Science at Hampton Normal and Agricultural Institute, 1868-1893

    Science.gov (United States)

    Tucker, Linda Bart

    Science had a variety of uses at Hampton Normal and Agricultural Institute, a private, missionary school supported by northern whites and Virginia's black land grant school from 1872 to 1920. Samuel Chapman Armstrong, principal for the first twenty-five years (1868-1893), advocated not classical but scientific studies, primarily as applied science to improve lives and "civilize" blacks and Indians. Agriculture and mechanics were practiced in Hampton's industries, where students worked their way through school. They were organized for production rather than instruction, though Armstrong claimed that labor had a moral value and that practical experience was valuable learning. In contrast to works by James D. Anderson and Donald Spivey, this study stresses the pragmatic, business purposes of Hampton's industries rather than any ideological agenda. Problems with providing specialized facilities, apparatus, and teachers made it difficult for Hampton to provide rigorous, graded science instruction. Students learned of practical applications of science in agricultural lectures and in such classes as physiology. However, the curriculum was designed for teacher training, using broad, elementary science for general knowledge, to train minds, and to make adult remedial language lessons more effective. Not surprisingly, very few graduates pursued careers which required more than general science studies. Besides the utilitarian and disciplinary purposes, Hampton used science to discourage superstitious ideas in religion. Armstrong also argued for racially distinctive education for blacks and Indians on the basis of scientific ideas about cultural evolution and inheritance of the experience of past generations. In practice, however, Hampton teachers adapted mainstream tools and methods of instruction. Not all teachers shared Armstrong's racial views, and several demonstrated concern for students, confidence in their ability, and professional interest in advancing them as

  6. The Nuclear Security Science and Policy Institute at Texas A&M University

    Directory of Open Access Journals (Sweden)

    Claudio A. Gariazzo

    2015-07-01

    Full Text Available The Nuclear Security Science and Policy Institute (NSSPI is a multidisciplinary organization at Texas A&M University and was the first U.S. academic institution focused on technical graduate education, research, and service related to the safeguarding of nuclear materials and the reduction of nuclear threats. NSSPI employs science, engineering, and policy expertise to: (1 conduct research and development to help detect, prevent, and reverse nuclear and radiological proliferation and guard against nuclear terrorism; (2 educate the next generation of nuclear security and nuclear nonproliferation leaders; (3 analyze the interrelationships between policy and technology in the field of nuclear security; and (4 serve as a public resource for knowledge and skills to reduce nuclear threats. Since 2006, over 31 Doctoral and 73 Master degrees were awarded through NSSPI-sponsored research. Forty-one of those degrees are Master of Science in Nuclear Engineering with a specialization in Nuclear Nonproliferation and 16 were Doctorate of Philosophy degrees with a specific focus on nuclear nonproliferation. Over 200 students from both technical and policy backgrounds have taken classes provided by NSSPI at Texas A&M. The model for creating safeguards and security experts, which has in large part been replicated worldwide, was established at Texas A&M by NSSPI faculty and staff. In addition to conventional classroom lectures, NSSPI faculty have provided practical experiences; advised students on valuable research projects that have contributed substantially to the overall nuclear nonproliferation, safeguards and security arenas; and engaged several similar academic and research institutes around the world in activities and research for the benefit of Texas A&M students. NSSPI has had an enormous impact on the nuclear nonproliferation workforce (across the international community in the past 8 years, and this paper is an attempt to summarize the activities

  7. Annual report of National Institute of Radiological Sciences, April 1988 - March 1989

    International Nuclear Information System (INIS)

    1989-07-01

    The Annual Report of April 1988 - March 1989 provides the information on up-to-date research activities of the National Institute of Radiological Sciences (NIRS) in Japan. Researches undertaken in the NIRS aim at promoting medical application of radiation and at investigating health effects of radiation and radiation protection. The research scope is therefore widely ranging from physics to genetics and from environmental science to clinical medicine. In addition to basic researches carried out by 14 research divisions. This volume is divided into the following scientific categories for ease of reader's understanding: physics, chemistry, biochemistry and biophysics, cell biology, immunology and hematology, pathology and physiology, genetics, clinical research, and environmental science, covering a total of 84 titles. Activities of each research division and organization of the NIRS are given in appendix. (J.P.N.)

  8. Computer Science Research Institute 2004 annual report of activities.

    Energy Technology Data Exchange (ETDEWEB)

    DeLap, Barbara J.; Womble, David Eugene; Ceballos, Deanna Rose

    2006-03-01

    This report summarizes the activities of the Computer Science Research Institute (CSRI) at Sandia National Laboratories during the period January 1, 2004 to December 31, 2004. During this period the CSRI hosted 166 visitors representing 81 universities, companies and laboratories. Of these 65 were summer students or faculty. The CSRI partially sponsored 2 workshops and also organized and was the primary host for 4 workshops. These 4 CSRI sponsored workshops had 140 participants--74 from universities, companies and laboratories, and 66 from Sandia. Finally, the CSRI sponsored 14 long-term collaborative research projects and 5 Sabbaticals.

  9. Computer Science Research Institute 2003 annual report of activities.

    Energy Technology Data Exchange (ETDEWEB)

    DeLap, Barbara J.; Womble, David Eugene; Ceballos, Deanna Rose

    2006-03-01

    This report summarizes the activities of the Computer Science Research Institute (CSRI) at Sandia National Laboratories during the period January 1, 2003 to December 31, 2003. During this period the CSRI hosted 164 visitors representing 78 universities, companies and laboratories. Of these 78 were summer students or faculty members. The CSRI partially sponsored 5 workshops and also organized and was the primary host for 3 workshops. These 3 CSRI sponsored workshops had 178 participants--137 from universities, companies and laboratories, and 41 from Sandia. Finally, the CSRI sponsored 18 long-term collaborative research projects and 5 Sabbaticals.

  10. Computer Science Research Institute 2005 annual report of activities.

    Energy Technology Data Exchange (ETDEWEB)

    Watts, Bernadette M.; Collis, Samuel Scott; Ceballos, Deanna Rose; Womble, David Eugene

    2008-04-01

    This report summarizes the activities of the Computer Science Research Institute (CSRI) at Sandia National Laboratories during the period January 1, 2005 to December 31, 2005. During this period, the CSRI hosted 182 visitors representing 83 universities, companies and laboratories. Of these, 60 were summer students or faculty. The CSRI partially sponsored 2 workshops and also organized and was the primary host for 3 workshops. These 3 CSRI sponsored workshops had 105 participants, 78 from universities, companies and laboratories, and 27 from Sandia. Finally, the CSRI sponsored 12 long-term collaborative research projects and 3 Sabbaticals.

  11. Foreign Science and Engineering Presence in U.S. Institutions and the Labor Force

    Science.gov (United States)

    2008-07-23

    United States, Washington, DC, May 2005, pp. 17-65. 8 Center for Immigration Studies, Davis, Donald R. and David E. Weinstein , United States Technological...Academy of Sciences, Wm. A. Wulf, President, National Academy of Engineering, and Harvey Fineberg, President, Institute of Medicine, December 13, 2002

  12. Status of ion sources at National Institute of Radiological Sciences.

    Science.gov (United States)

    Kitagawa, A; Fujita, T; Goto, A; Hattori, T; Hamano, T; Hojo, S; Honma, T; Imaseki, H; Katagiri, K; Muramatsu, M; Sakamoto, Y; Sekiguchi, M; Suda, M; Sugiura, A; Suya, N

    2012-02-01

    The National Institute of Radiological Sciences (NIRS) maintains various ion accelerators in order to study the effects of radiation of the human body and medical uses of radiation. Two electrostatic tandem accelerators and three cyclotrons delivered by commercial companies have offered various life science tools; these include proton-induced x-ray emission analysis (PIXE), micro beam irradiation, neutron exposure, and radioisotope tracers and probes. A duoplasmatron, a multicusp ion source, a penning ion source (PIG), and an electron cyclotron resonance ion source (ECRIS) are in operation for these purposes. The Heavy-Ion Medical Accelerator in Chiba (HIMAC) is an accelerator complex for heavy-ion radiotherapy, fully developed by NIRS. HIMAC is utilized not only for daily treatment with the carbon beam but also for fundamental experiments. Several ECRISs and a PIG at HIMAC satisfy various research and clinical requirements.

  13. Annual report of National Institute of Radiological Science in 1997

    International Nuclear Information System (INIS)

    1999-03-01

    The research activities of National Institute of Radiological Science (NIRS) in 1997 are described, being divided into 14 categories: (1) heavy ion project research, (2) group research, (3) special research, (4) designated research, (5) ordinary research, (6) safety analysis research, (7) actual situation investigation, (8) accepted research, (9) general technology research for nuclear energy, (10) radioactivity investigation and research, (11) research for science and technology promotion, (12) international research cooperation, (13) safety evaluation for radioactive liquid waste reprocessing test, (14) human brain function research. The heavy ion project research is divided into 5 categories, further; (1) clinical research, (2) medical treatment research, (3) diagnosis research, (4) biological research, (5) physics and engineering research. A great number of research papers published are listed. Organization, personnel, budget and accounts of the NIRS are also mentioned in the report. (M. Suetake)

  14. Developing Earth System Science Courses and Programs at Minority Serving Institutions

    Science.gov (United States)

    Johnson, D. R.; Jackson, C.; Ruzek, M.

    2004-12-01

    In the current NASA/USRA ESSE21 Program, emphasis is placed on the development of Earth System Science courses and degree offerings in Minority Serving Institutions (MSIs). Of the 18 colleges/universities being supported by NASA through USRA, 10 colleges/universities are MSIs. While there is recognition of the need for Earth system science courses, minors and degree programs by NASA and other agencies, within MSIs, a central challenge is how to provide a vision of the future opportunities in ESS and STEM disciplines that attracts and motivates students to these studies. Students need career guidance, role models and mentoring to encourage entry into STEM in general, and Earth system science in particular. Then there is the question of how to bring interested faculty together in institutions to form a critical mass that would forego the breadth and depth of disciplinary interests to undertake the development of multi/cross and interdisciplinary courses, minors and degree programs in ESS. Within the ESSE21 Diversity Working Group, the question has been raised as to how will MSIs ever be mainstream participants in ESS without teaching and engaging in research in remote sensing, modeling of the Earth's climate system and other like endeavors. Two other related questions raised within the Working Group are what are the long-term objectives of MSI adoption of ESS and what course corrections are needed to make ESS viable at MSIs. Within these considerations there are unresolved questions concerning the need and availability of resources from NASA, other agencies and local institutions. Apart from these larger considerations, efforts are underway within the ESSE21 Program that provide for sharing of resources among participants, organization of and access to materials that already exist, online resources, course outlines and successful listings for online resources by topics for particular courses and subject areas. The Lesson Learned Working Group, as well as the program

  15. 20th International Conference on Solid State Ionics (SSI 20)

    Science.gov (United States)

    2016-05-20

    Italy; 2CNST @PoliMI, Istituto Italiano di Tecnologia , Milano, Italy; 3Physical Chemistry of Solids, Max Planck Institute for Solid State Research...Coughlin5; 1Chemical Sciences, University of Padova, Padova, Italy; 2Consorzio Interuniversitario Nazionale per la Scienza e la Tecnologia dei Materiali...Germany; 2Instituto de Tecnologia Quimica , Valencia, Spain; 3Ernst Ruska Center, Jülich, Germany. 4:50 PM J5.05 Hydrogen Permeation through CO2-Stable

  16. Networking of institutions in India to promote research and education in nuclear science and engineering

    International Nuclear Information System (INIS)

    Puri, R.R.

    2007-01-01

    Full text: The Programme of Nuclear Energy and its Applications (NEA) is knowledge intensive requiring engineers and scientists having special education and training for its implementation. The paucity of manpower in managing this programme is partly due to limitations of the university system in catering to the needs of the nuclear industry. Those limitations arise due to several reasons, like, regulatory requirements which make it difficult to set up nuclear facilities in university environment, capital intensive nature of nuclear set-ups, paucity of teaching staff having hands-on experience and limited employment opportunities making nuclear option unattractive for talented youngsters. The Department of Atomic Energy of India (DAE) established in 1954 for shaping and managing the Indian NEA programme realized those limitations and opted for an in-house education and training programme leading to assured employment for young Engineering Graduates and Science Post Graduates. Called the Bhabha Atomic Research Centre (BARC) Training School Programme, it is in place since 1957. The Indian NEA programme is thus fortunate to be supported by a visionary human resource development (HRD) programme in nuclear science and technology practically right since its inception. The success of HRD programme of DAE lies in its broader outlook based on the premise that technology development and basic research go hand-in-hand. This outlook is reflected also in the way DAE has been managing the implementation of its programme in that on one hand it has set up centres for technological Research and Development and, on the other, it is providing Grant-in-Aid to several Institutes for carrying basic research. Moreover, DAE has not lost sight of the fact that success of its initiatives lies as much in the vibrant university system as in its own training and educational efforts. It has, therefore, created avenues for extra-mural funding for supporting research activities in universities in

  17. Understanding bureaucracy in health science ethics: toward a better institutional review board.

    Science.gov (United States)

    Bozeman, Barry; Slade, Catherine; Hirsch, Paul

    2009-09-01

    Research involving human participants continues to grow dramatically, fueled by advances in medical technology, globalization of research, and financial and professional incentives. This creates increasing opportunities for ethical errors with devastating effects. The typical professional and policy response to calamities involving human participants in research is to layer on more ethical guidelines or strictures. We used a recent case-the Johns Hopkins University/Kennedy Kreiger Institute Lead Paint Study-to examine lessons learned since the Tuskegee Syphilis Study about the role of institutionalized science ethics in the protection of human participants in research. We address the role of the institutional review board as the focal point for policy attention.

  18. Sintered silicon carbides for sliding applications in pumps; Pumpenbauteile aus SSiC

    Energy Technology Data Exchange (ETDEWEB)

    Fundus, M. [Wacker Engineer Ceramics, Inc., Adrian, MI (United States)

    2000-07-01

    The focus of the paper is on enhancement and optimization of the tribological properties of SSiC materials based on field experience obtained with the materials EKasic {sup trademark} D, TRIBO 2000, and TRIBO 2000-1. Current product development activities discussed in this paper concentrate on slide bearings and seal rings. (orig./cB) [German] Mit EKasic {sup trademark} D, TRIBO 2000 und TRIBO 2000-1 stehen drei SiC-Werkstoffe zur Verfuegung, die in der Lage sind die ganze Bandbreite der Anwendungen abzudecken. Durch eine konsequente Fortsetzung der tribologischen Optimierung der SiC-Werkstoffe koennen auch die in den naechsten Jahren weiter steigenden Anforderungen im Lager- und Dichtungsbereich erfuellt werden (Gleitringdichtungen, Gleitlager). (orig./MM)

  19. Liaison activities with the Institute of Physical Chemistry, Russian Academy of Sciences: FY 1997

    International Nuclear Information System (INIS)

    Delegard, C.H.; Elovich, R.J.

    1997-09-01

    The Institute of Physical Chemistry of the Russian Academy of Sciences is conducting a program of fundamental and applied research into the chemistry of the actinides and technetium in alkaline media such as are present in the Hanford Site underground waste storage tanks. This work is being coordinated and the results disseminated through a technical liaison maintained at the Pacific Northwest National Laboratory. The technical liaison is performing laboratory studies on plutonium chemistry in alkaline media. The activities at the Institute of Physical Chemistry and through the liaison are pursued to improve understanding of the chemical behavior of key long-lived radioactive elements under current operating and proposed tank waste processing conditions. Both activities are supported by the Efficient Separations and Processing Crosscutting Program under the Office of Science and Technology of the U.S. Department of Energy

  20. Annual report of National Institute of Radiological Sciences, 2005

    International Nuclear Information System (INIS)

    2006-10-01

    Five years have passed since the National Institute of Radiological Sciences (NIRS) was reformed as an Independent Administrative Institution (IAI) in April 2001, and this fiscal year (2005-2006) is the last year in the first Mid-term Plan of NIRS. The main items of this report, being the same as the previous year's, are: the summary of NIRS activities; research and development including studies of important project, fundamental research, fundamental and frontier research, contract research and fact-finding; management; organization/budget/finance; and appendix. Important projects are radiological studies in advanced medicine, on sensitivity, of effects on human and of hazard. Fundamental research concerns studies of environmental radiation, radiobiology, heavy particle ion therapy, diagnostic imaging, dose assessment and protection in medical radiation, brain function, development of High-Coverage Expression Profiling (HiCEP) technique and new crossover studies. Fact-finding studies are on the present situations of people exposed by nuclear experiment at Bikini Atoll in 1954 and of patients treated with thorotrast in past. Appendix cites the personnel name list, honorable events, cooperative studies, patent situation and others. (J.P.N.)

  1. 75 FR 38100 - National Institute of Environmental Health Sciences Superfund Hazardous Substance Research and...

    Science.gov (United States)

    2010-07-01

    ...- traditional communication methods to make the significance and applicability of SRP-funded research... and Social Sciences Research, and National Institute of Biomedical Imaging and Bioengineering. [cir... Superfund Hazardous Substance Research and Training Program Strategic Plan; Request for Comments ACTION...

  2. Annual report of the National Institute of Radiological Sciences

    Science.gov (United States)

    1992-01-01

    The annual report for the activities of the National Institute of Radiological Sciences in Japan in the fiscal year 1990 is presented. The activities are divided into research, technical aids, training, medical services, management affairs at the Nakaminato Laboratory Branch Office, library or editing, international cooperation, and general affairs. Research activities are described under the following sections: (1) special researches covering biological risk evaluation in public exposure and exposure assessment in the environment and the public involved in food chain, medical use of accelerated heavy ions, and survey for the demonstration of dose-response relationships in low dose irradiation; (2) five assigned researches; (3) ordinary researches concerning physics, pharmacochemistry, biology, genetics, pathology and physiology, cell biology, internal exposure, environmental science, clinical research, clinical research for radiation injuries, medical use of heavy particles, environmental radiation ecology, and aquatic radiation ecology; (4) risk estimation of radiation; (5) survey for radiation response phenomena in fish and in immunity associated with low dose irradiation; (6) actual surveys for Bikini victims, population doses of medical and occupational exposure, and thorotrast exposure; (7) project research; (8) integrated atomic energy-based technological research; (9) radioactivity survey; (10) research supported by Science and Technology Agency aids; (11) International research cooperation; and (12) government-private joint cooperative study. Appendices include the personnel list and the bibliography of articles reported by the staff.

  3. Stimulating translational research: several European life science institutions put their heads together.

    Science.gov (United States)

    Bentires-Alj, Mohamed; Rajan, Abinaya; van Harten, Wim; van Luenen, Henri G A M; Kubicek, Stefan; Andersen, Jesper B; Saarela, Janna; Cook, Simon J; Van Minnebruggen, Geert; Roman-Roman, Sergio; Maurer, Cornelia; Erler, Janine T; Bertero, Michela G

    2015-09-01

    Translational research leaves no-one indifferent and everyone expects a particular benefit. We as EU-LIFE (www.eu-life.eu), an alliance of 13 research institutes in European life sciences, would like to share our experience in an attempt to identify measures to promote translational research without undermining basic exploratory research and academic freedom. Copyright © 2015 Elsevier Ltd. All rights reserved.

  4. Training trainers in health and human rights: implementing curriculum change in South African health sciences institutions.

    Science.gov (United States)

    Ewert, Elena G; Baldwin-Ragaven, Laurel; London, Leslie

    2011-07-25

    The complicity of the South African health sector in apartheid and the international relevance of human rights as a professional obligation prompted moves to include human rights competencies in the curricula of health professionals in South Africa. A Train-the-Trainers course in Health and Human Rights was established in 1998 to equip faculty members from health sciences institutions nationwide with the necessary skills, attitudes and knowledge to teach human rights to their students. This study followed up participants to determine the extent of curriculum implementation, support needed as well as barriers encountered in integrating human rights into health sciences teaching and learning. A survey including both quantitative and qualitative components was distributed in 2007 to past course participants from 1998-2006 via telephone, fax and electronic communication. Out of 162 past participants, 46 (28%) completed the survey, the majority of whom were still employed in academic settings (67%). Twenty-two respondents (48%) implemented a total of 33 formal human rights courses into the curricula at their institutions. Respondents were nine times more likely (relative risk 9.26; 95% CI 5.14-16.66) to implement human rights education after completing the training. Seventy-two extracurricular activities were offered by 21 respondents, many of whom had successfully implemented formal curricula. Enabling factors for implementation included: prior teaching experience in human rights, general institutional support and the presence of allies - most commonly coworkers as well as deans. Frequently cited barriers to implementation included: budget restrictions, time constraints and perceived apathy of colleagues or students. Overall, respondents noted personal enrichment and optimism in teaching human rights. This Train-the-Trainer course provides the historical context, educational tools, and collective motivation to incorporate human rights educational initiatives at health

  5. Training Trainers in health and human rights: Implementing curriculum change in South African health sciences institutions

    Directory of Open Access Journals (Sweden)

    Baldwin-Ragaven Laurel

    2011-07-01

    Full Text Available Abstract Background The complicity of the South African health sector in apartheid and the international relevance of human rights as a professional obligation prompted moves to include human rights competencies in the curricula of health professionals in South Africa. A Train-the-Trainers course in Health and Human Rights was established in 1998 to equip faculty members from health sciences institutions nationwide with the necessary skills, attitudes and knowledge to teach human rights to their students. This study followed up participants to determine the extent of curriculum implementation, support needed as well as barriers encountered in integrating human rights into health sciences teaching and learning. Methods A survey including both quantitative and qualitative components was distributed in 2007 to past course participants from 1998-2006 via telephone, fax and electronic communication. Results Out of 162 past participants, 46 (28% completed the survey, the majority of whom were still employed in academic settings (67%. Twenty-two respondents (48% implemented a total of 33 formal human rights courses into the curricula at their institutions. Respondents were nine times more likely (relative risk 9.26; 95% CI 5.14-16.66 to implement human rights education after completing the training. Seventy-two extracurricular activities were offered by 21 respondents, many of whom had successfully implemented formal curricula. Enabling factors for implementation included: prior teaching experience in human rights, general institutional support and the presence of allies - most commonly coworkers as well as deans. Frequently cited barriers to implementation included: budget restrictions, time constraints and perceived apathy of colleagues or students. Overall, respondents noted personal enrichment and optimism in teaching human rights. Conclusion This Train-the-Trainer course provides the historical context, educational tools, and collective motivation

  6. Post-doctoral research work developed at the National Institute for Fusion Science - Japan

    International Nuclear Information System (INIS)

    Ueda, M.

    1992-05-01

    This is a research report report on the work developed at the National Institute for Fusion Science - Japan, involving study of Beam Emission Spectroscopy. It describes the use of a fast neutral lithium beam (8 KeV) to measure the density profile in a Compact Helical Device. (A.C.A.S.)

  7. Gender Equality in Public Higher Education Institutions of Ethiopia: The Case of Science, Technology, Engineering, and Mathematics

    Science.gov (United States)

    Egne, Robsan Margo

    2014-01-01

    Ensuring gender equality in higher education system is high on the agenda worldwide particularly in science disciplines. This study explores the problems and prospects of gender equality in public higher education institutions of Ethiopia, especially in science, technology, engineering, and mathematics. Descriptive survey and analytical research…

  8. The chain reaction: a golden jubilee commemorative volume on research in basic sciences at DAE Institutions. V. 1

    International Nuclear Information System (INIS)

    2005-01-01

    This book has been chosen to metaphorically reflect how research in basic sciences in various institutions of the Department of Atomic Energy (DAE) has evolved over the years, closely mimicking what goes on in a nuclear chain reactor. Since, for harnessing atomic energy for peaceful uses, nuclear physics and atomic physics are the two core activities, work was undertaken in these areas during initial days at the Tata Institute of Fundamental Research. These activities then promoted the growth of major programmes in a number of areas, such as, reactor physics, accelerator physics, condensed matter physics and materials science, theoretical physics and mathematical physics, astronomy and astrophysics, laser and plasma physics, radiation chemistry, photochemistry, chemical dynamics, nuclear chemistry, radiation biology and health sciences, molecular and cellular biology, structural biology and biophysics, agriculture and food sciences etc. In turn, all these programmes have been fostering the growth in several other domains of science, engineering and technology

  9. Annual report of National Institute of Radiological Science, April 1996 - March 1997

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    This report presents a brief summary of the research activities and the achievements in the Institute for the fiscal year of 1996. The clinical trial of cancer therapy using heavy ion beams have been progressed with promising results. Various kinds of basic studies using the heavy ion beams have been performed in an open use system and remarkable outcomes have been derived from many collaborative researchers. The reported topics extended over several categories including physics, chemistry, biology, medicine, radiopharmacy and environmental science. As another important role of the Institute, training of personnels who are being engaged in and willing to come into the radiation-related fields such as radiation protection, nursing, emergency measures, biomedicine, etc. was carried out. This report presents a total of 91 abstracts of researches made in the institute and the list of publications in the fiscal year of 1996. (M.N.)

  10. Overview of graduate training program of John Adams Institute for Accelerator Science

    Science.gov (United States)

    Seryi, Andrei

    The John Adams Institute for Accelerator Science is a center of excellence in the UK for advanced and novel accelerator technology, providing expertise, research, development and training in accelerator techniques, and promoting advanced accelerator applications in science and society. We work in JAI on design of novel light sources upgrades of 3-rd generation and novel FELs, on plasma acceleration and its application to industrial and medical fields, on novel energy recovery compact linacs and advanced beam diagnostics, and many other projects. The JAI is based on three universities - University of Oxford, Imperial College London and Royal Holloway University of London. Every year 6 to 10 accelerators science experts, trained via research on cutting edge projects, defend their PhD thesis in JAI partner universities. In this presentation we will overview the research and in particular the highly successful graduate training program in JAI.

  11. Saudi Science Teachers' Views and Teaching Strategies of Socioscientific Issues

    Science.gov (United States)

    Alamri, Aziz S.

    Scientific developments such as cloning and nuclear energy have generated many controversial issues pertain to many political, social, environmental, ethical and cultural values in different societies around the globe. These controversies delimited and encircled the potential of including and teaching some important aspects of science in schools and therefore caused less consideration to the influence of these issues on enhancing the scientific literacy of people in general. The purpose of this study was to investigate how Saudi science teachers in the city of Tabuk in Saudi Arabia view and teach SSI in Saudi Arabia. This study employed semi-structured interviews with Saudi science teachers. Methodologically, this study used a constructivist grounded theory as a method for analysis to generate in-depth descriptive data about Saudi science teachers' views and teaching strategies of socio-scientific issues. Some direct and indirect benefits pertain to teaching science, understanding the relationship between science, religion, and society and some other topics are discussed in this study.

  12. National Institutes of Health addresses the science of diversity

    Science.gov (United States)

    Valantine, Hannah A.; Collins, Francis S.

    2015-01-01

    The US biomedical research workforce does not currently mirror the nation’s population demographically, despite numerous attempts to increase diversity. This imbalance is limiting the promise of our biomedical enterprise for building knowledge and improving the nation’s health. Beyond ensuring fairness in scientific workforce representation, recruiting and retaining a diverse set of minds and approaches is vital to harnessing the complete intellectual capital of the nation. The complexity inherent in diversifying the research workforce underscores the need for a rigorous scientific approach, consistent with the ways we address the challenges of science discovery and translation to human health. Herein, we identify four cross-cutting diversity challenges ripe for scientific exploration and opportunity: research evidence for diversity’s impact on the quality and outputs of science; evidence-based approaches to recruitment and training; individual and institutional barriers to workforce diversity; and a national strategy for eliminating barriers to career transition, with scientifically based approaches for scaling and dissemination. Evidence-based data for each of these challenges should provide an integrated, stepwise approach to programs that enhance diversity rapidly within the biomedical research workforce. PMID:26392553

  13. Annual report: AEC Institute for Life Sciences, 1986

    International Nuclear Information System (INIS)

    1987-08-01

    The AEC-Institute for life sciences research programme can be divided into four divisions: experimental nuclear medicine, radiobiology, radiopharmacy and hormone receptor studies. The experimental nuclear medicine division investigates and undertakes new developments in nuclear diagnostics with a view to clinical application, especially developments in dataprocessing techniques and radiopharmaceuticals. Physiological, biochemical and pharmacological problems are also investigated by using tracers and nuclear diagnostic techniques. The radiobiology division is concerned with the development of biochemical techniques for determining radiosensitivity amongst radiation workers as well as clinical-biochemical, diagnostic procedures for identifying exposure to ionizing types of radiation (X- or gamma radiation). The hormone receptor division is concerned with the study of the role of steroid hormone receptors, steroids and carcinogenes in the etiology of breast cancer. Research projects as well as completed and ongoing research are listed in this report

  14. [Activities of Research Institute for Advanced Computer Science

    Science.gov (United States)

    Gross, Anthony R. (Technical Monitor); Leiner, Barry M.

    2001-01-01

    The Research Institute for Advanced Computer Science (RIACS) carries out basic research and technology development in computer science, in support of the National Aeronautics and Space Administrations missions. RIACS is located at the NASA Ames Research Center, Moffett Field, California. RIACS research focuses on the three cornerstones of IT research necessary to meet the future challenges of NASA missions: 1. Automated Reasoning for Autonomous Systems Techniques are being developed enabling spacecraft that will be self-guiding and self-correcting to the extent that they will require little or no human intervention. Such craft will be equipped to independently solve problems as they arise, and fulfill their missions with minimum direction from Earth. 2. Human-Centered Computing Many NASA missions require synergy between humans and computers, with sophisticated computational aids amplifying human cognitive and perceptual abilities. 3. High Performance Computing and Networking Advances in the performance of computing and networking continue to have major impact on a variety of NASA endeavors, ranging from modeling and simulation to analysis of large scientific datasets to collaborative engineering, planning and execution. In addition, RIACS collaborates with NASA scientists to apply IT research to a variety of NASA application domains. RIACS also engages in other activities, such as workshops, seminars, visiting scientist programs and student summer programs, designed to encourage and facilitate collaboration between the university and NASA IT research communities.

  15. Institutional repository in communication: the REPOSCOM project implemented in the digital libraries federation of communication science

    Directory of Open Access Journals (Sweden)

    Sueli Mara Soares Pinto Ferreira

    2007-01-01

    Full Text Available Considering the conceptualization, characterization and context of the institutional repositories (IR this paper discuss the procedures, policies and strategies delineated to the implementation of IR in a research environment. The object of discussion is the project called Reposcom - Institutional Repository of Intercom (Brazilian Society of Interdisciplinary Studies of Communication – which is part of a broader project managed by the Portcom – Information Network in Communication Sciences of Countries of Portuguese Language – and called Digital Libraries Federation in the Communication Sciences. Aiming to share the knowledge and experience acquired with the implementation of the Reposcom, this paper describes its work activities, the decisions made, the customization of the software DSpace (the technological solution and the initial results achieved with the project.

  16. SKI and SSI's recommendations to the government concerning long-term responsibility after closure of a repository for spent nuclear fuel

    International Nuclear Information System (INIS)

    Paeivioe Jonsson, Josefin

    2008-01-01

    Many activities will cease at the closure of a repository, but not responsibilities. The candidate municipalities in Sweden expressed concern about who will take over after the implementer is released from responsibility for the facility. The government thus commissioned SKI (Swedish Nuclear Power Inspectorate) and SSI (Swedish Radiation Protection Authority) to review the legal obligations of institutional players as laid out today in legislation in Sweden. After closure of the repository in about 100 years there will be post-closure monitoring, possibly for a few hundred years. This will be a part of the conditions on SKB (Swedish Nuclear Fuel and Waste Management Company) which will be set out at the time. Some activities will end at the closure of the facility but monitoring and safeguards obligations may continue. The exact nature of this monitoring and safeguard work needs to be discussed and agreed upon. With the proposed approach most of the liabilities rest with the state in the long term, the waste producers only have liabilities in the short term but their decisions could have big impacts on long term liabilities

  17. Summary of researches being performed in the Institute of Mathematics and Computer Science on computer science and information technologies

    Directory of Open Access Journals (Sweden)

    Artiom Alhazov

    2008-07-01

    Full Text Available Evolution of the informatization notion (which assumes automation of majority of human activities applying computers, computer networks, information technologies towards the notion of {\\it Global Information Society} (GIS challenges the determination of new paradigms of society: automation and intellectualization of production, new level of education and teaching, formation of new styles of work, active participation in decision making, etc. To assure transition to GIS for any society, including that from Republic of Moldova, requires both special training and broad application of progressive technologies and information systems. Methodological aspects concerning impact of GIS creation over the citizen, economic unit, national economy in the aggregate demands a profound study. Without systematic approach to these aspects the GIS creation would have confront great difficulties. Collective of researchers from the Institute of Mathematics and Computer Science (IMCS of Academy of Sciences of Moldova, which work in the field of computer science, constitutes the center of advanced researches and activates in those directions of researches of computer science which facilitate technologies and applications without of which the development of GIS cannot be assured.

  18. 75 FR 36111 - Notice of Inventory Completion: Cranbrook Institute of Science, Bloomfield Hills, MI

    Science.gov (United States)

    2010-06-24

    ... the Little Traverse Bay Bands of Odawa Indians, Michigan, on behalf of the Michigan Anishnaabek..., Oakland County Medical Examiner (CIS reference 9738 and 9739). No known individuals were identified. No... to the Cranbrook Institute of Science by the Little Traverse Bay Bands of the Odawa Indians on behalf...

  19. Research in progress and other activities of the Institute for Computer Applications in Science and Engineering

    Science.gov (United States)

    1993-01-01

    This report summarizes research conducted at the Institute for Computer Applications in Science and Engineering in applied mathematics and computer science during the period April 1, 1993 through September 30, 1993. The major categories of the current ICASE research program are: (1) applied and numerical mathematics, including numerical analysis and algorithm development; (2) theoretical and computational research in fluid mechanics in selected areas of interest to LaRC, including acoustic and combustion; (3) experimental research in transition and turbulence and aerodynamics involving LaRC facilities and scientists; and (4) computer science.

  20. American Institute of Biological Sciences

    Science.gov (United States)

    ... Staff Issues AIBS Position Statements Funding for the Biological Sciences Supporting Scientific Collections Advocating for Research Policy ... Public Policy Leadership Award Graduate students in the biological sciences who have demonstrated initiative and leadership in ...

  1. The Relationship of Discipline Background to Upper Secondary Students' Argumentation on Socioscientific Issues

    Science.gov (United States)

    Christenson, Nina; Chang Rundgren, Shu-Nu; Zeidler, Dana L.

    2014-08-01

    In the present STEM (Science, Technology, Engineering, and Mathematics)-driven society, socioscientific issues (SSI) have become a focus globally and SSI research has grown into an important area of study in science education. Since students attending the social and science programs have a different focus in their studies and research has shown that students attending a science program are less familiar with argumentation practice, we make a comparison of the supporting reasons social science and science majors use in arguing different SSI with the goal to provide important information for pedagogical decisions about curriculum and instruction. As an analytical framework, a model termed SEE-SEP covering three aspects (of knowledge, value, and experiences) and six subject areas (of sociology/culture, economy, environment/ecology, science, ethics/morality, and policy) was adopted to analyze students' justifications. A total of 208 upper secondary students (105 social science majors and 103 science majors) from Sweden were invited to justify and expound their arguments on four SSI including global warming, genetically modified organisms (GMO), nuclear power, and consumer consumption. The results showed that the social science majors generated more justifications than the science majors, the aspect of value was used most in students' argumentation regardless of students' discipline background, and justifications from the subject area of science were most often presented in nuclear power and GMO issues. We conclude by arguing that engaging teachers from different subjects to cooperate when teaching argumentation on SSI could be of great value and provide students from both social science and science programs the best possible conditions in which to develop argumentation skills.

  2. SKI's and SSI's review of SKB's safety report SR-Can

    International Nuclear Information System (INIS)

    Dverstorp, Bjoern; Stroemberg, Bo

    2008-03-01

    This report summarises SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned licence application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: -SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be further developed for the licence application. -SKB's quality

  3. DYSFUNCTION OF MODERN RUSSIAN INSTITUTES OF STATE AWARDS IN THE SPHERE OF EDUCATION AND SCIENCE

    Directory of Open Access Journals (Sweden)

    Aleksey V. Ruchkin

    2015-01-01

    Full Text Available The purpose of the study is to analyze the main dysfunctions of the Russian premium institutes in the field of education and science, and to find out its leveling instruments, by examining the experience of foreign countries; to identify the basic requirements for the novitiate for state awards to employees of education and science in modern Russia in comparison with foreign countries. Methods. Neo institutional approach is used by the author. Methods involve comparative analysis, cross-national analysis, and classification. The original solution of tasks associated with the use of a single system-approach to the sociological study of state awards in the sphere of education and science, is extrapolated from institutional economics. Results. The basic approaches to the determination of the nature and functions of awards institutions in the field of education and science are considered; its relationship with other social, economic and political trends of contemporary politics in Russia is noted. The basic conditions of non-material motivation of workers of scientifically-educational area in modern Russia in comparison with other countries, including the post-Soviet territory states are defined. Both officially established rules and other requirements to candidates on reception of the state honourable distinctions, observed with the Soviet period are considered. The study identifies the main factors that influence the perception of the role of changes in modern society awards, offers solutions to the identified problems. Scientific novelty. The critical analysis of working rules of the Russian legislation regulating an order (procedures of rewarding has allowed to reveal major disadvantages of the Russian institute of the state awards: opacity of estimated judgements considering the work of the applicant for the award; absence of accurate hierarchy of the state awards and quantity indicators at measurement of merits and results of activity

  4. For the 100TH Anniversary of the S. P. Timoshenko Institute of Mechanics of the National Academy of Sciences of Ukraine (NASU)

    Science.gov (United States)

    Guz, A. N.

    2018-01-01

    This article is devoted to the forthcoming (11/30/2018) 100th anniversary of the S. P. Timoshenko Institute of Mechanics of the National Academy of Sciences of Ukraine (NASU). The recognition of the scientific results of the S. P. Timoshenko Institute of Mechanics by the world's scientific community is discussed. The historical stages of the institute development are considered. The staff, new books (monographs, textbooks, and tutorials), training achievements (new Doctors of Sciences and PhD), publications in scientific journals, etc. are briefly reviewed. The main scientific awards of the S. P. Timoshenko Institute of Mechanics are listed.

  5. SSI [soil-structure interactions] and structural benchmarks

    International Nuclear Information System (INIS)

    Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.

    1986-01-01

    This paper presents the latest results of the ongoing program entitled, ''Standard Problems for Structural Computer Codes'', currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to ''cut-off'' depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils

  6. The National Teacher Training Institute for Math, Science and Technology: Exemplary Practice in a Climate of Higher Standards.

    Science.gov (United States)

    Donlevy, James G., Ed.; Donlevy, Tia Rice, Ed.

    1999-01-01

    Reviews the NTTI (National Teacher Training Institute) for Math, Science and Technology model that trains teachers to use video and Internet resources to enhance math and science instruction. Discusses multimedia methodology; standards-based training; program impact in schools; and lesson plans available on the NTTI Web site. (Author/LRW)

  7. Repository National Institutes for Quantum and Radiological Science and Technology (QST)

    International Nuclear Information System (INIS)

    Maeda, Takamasa

    2016-01-01

    This paper introduces the facilities of National Institute of Radiological Sciences (NIRS). It was established as an auxiliary organ of the Science and Technology Agency in 1957. In April 2016, it became a comprehensive radiology research and development department of the Quantum Science and Technology Research Organization, and has been performing 'research for medical use of radiation' and 'research for radiation safety and emergency radiation medical care' as the two pillars of research. The laboratory hospital is a sole monotechnic radiation hospital in Japan specializing in radiotherapy. Heavy particle accelerator for medical use has been constructed, and advancement of heavy particle therapy using rotating gantry is expected. At the clinical nuclear medicine department, research facilities involved in molecular imaging are cyclotron building, positron building, imaging diagnostic building, and exploratory research building, and they are equipped with are three large and small cyclotrons, clinical PET device, animal-specialized PET device, 7-tesla MRI. The nuclear medicine laboratory is equipped with four PET/CT devices, one PET device, and one gamma camera, and performing tumor examination and clinical research on psychiatric and neurological diseases. (A.O.)

  8. Translation, Assessment and Deployment of Stuttering Instruments into Different Languages: Comments Arising from Bakhtiar et al., "Investigation of the Reliability of the SSI-3 for Preschool Persian-Speaking Children Who Stutter" ["J. Fluency Disord." 35 (2010) 87-91

    Science.gov (United States)

    Karimi, Hamid; Nilipour, Reza; Shafiei, Bijan; Howell, Peter

    2011-01-01

    Bakhtiar, Seifpanahi, Ansari, Ghanadzade and Packman (2010) reported high inter-, and intra-judge agreement of a translation of the Stuttering Severity Instrument (SSI-3) for preschool Persian-speaking children who stutter. Translation of SSI-3 into Persian is desirable as there is no standardised stuttering severity test for that language.…

  9. 2015 proceedings of the National Heart, Lung, and Blood Institute's State of the Science in Transfusion Medicine symposium

    NARCIS (Netherlands)

    Spitalnik, Steven L.; Triulzi, Darrell; Devine, Dana V.; Dzik, Walter H.; Eder, Anne F.; Gernsheimer, Terry; Josephson, Cassandra D.; Kor, Daryl J.; Luban, Naomi L. C.; Roubinian, Nareg H.; Mondoro, Traci; Welniak, Lisbeth A.; Zou, Shimian; Glynn, Simone; Hendrickson, Jeanne; Zimring, James C.; Yazdanbakhsh, Karina; Delaney, Megan; Ware, Russell E.; Tinmouth, Alan; Doctor, Allan; Migliaccio, Anna Rita; Fergusson, Dean A.; Widness, John A.; Carson, Jeffrey L.; Hess, John; Roback, John D.; Waters, Jonathan H.; Cancelas, Jose A.; Gladwin, Mark T.; Rogers, Mary A. M.; Ness, Paul M.; Rao, Sunil; Watkins, Timothy R.; Spinella, Philip C.; Kaufman, Richard M.; Slichter, Sherrill J.; McCullough, Jeffrey; Blumberg, Neil; Webert, Kathryn E.; Fitzpatrick, Michael; Shander, Aryeh; Corash, Laurence M.; Murphy, Michael; Silberstein, Leslie E.; Dumont, Larry J.; Mitchell, W. Beau; Juffermans, Nicole P.; Vlaar, Alexander P. J.; de Kort, Wim

    2015-01-01

    On March 25 and 26, 2015, the National Heart, Lung, and Blood Institute sponsored a meeting on the State of the Science in Transfusion Medicine on the National Institutes of Health (NIH) campus in Bethesda, Maryland, which was attended by a diverse group of 330 registrants. The meeting's goal was to

  10. Research Institute for Advanced Computer Science

    Science.gov (United States)

    Gross, Anthony R. (Technical Monitor); Leiner, Barry M.

    2000-01-01

    The Research Institute for Advanced Computer Science (RIACS) carries out basic research and technology development in computer science, in support of the National Aeronautics and Space Administration's missions. RIACS is located at the NASA Ames Research Center. It currently operates under a multiple year grant/cooperative agreement that began on October 1, 1997 and is up for renewal in the year 2002. Ames has been designated NASA's Center of Excellence in Information Technology. In this capacity, Ames is charged with the responsibility to build an Information Technology Research Program that is preeminent within NASA. RIACS serves as a bridge between NASA Ames and the academic community, and RIACS scientists and visitors work in close collaboration with NASA scientists. RIACS has the additional goal of broadening the base of researchers in these areas of importance to the nation's space and aeronautics enterprises. RIACS research focuses on the three cornerstones of information technology research necessary to meet the future challenges of NASA missions: (1) Automated Reasoning for Autonomous Systems. Techniques are being developed enabling spacecraft that will be self-guiding and self-correcting to the extent that they will require little or no human intervention. Such craft will be equipped to independently solve problems as they arise, and fulfill their missions with minimum direction from Earth; (2) Human-Centered Computing. Many NASA missions require synergy between humans and computers, with sophisticated computational aids amplifying human cognitive and perceptual abilities; (3) High Performance Computing and Networking. Advances in the performance of computing and networking continue to have major impact on a variety of NASA endeavors, ranging from modeling and simulation to data analysis of large datasets to collaborative engineering, planning and execution. In addition, RIACS collaborates with NASA scientists to apply information technology research to a

  11. Annual report of national institute of radiological science in 1998

    International Nuclear Information System (INIS)

    1999-11-01

    The research activities of National Institute of Radiological Science (NIRS) in 1998 can be divided into 16 categories: (1) general research-heavy ion project research, (2) group research, (3) special research, (4) designed research, (5) ordinary research, (6) safety analysis research, (7) investigation of actual situation, (8) general research for the basic technology of nuclear energy, (9) human brain function research, (10) investigation and research of radioactivity, (11) research for science and technology promotion, (12) international research cooperation, (13) specific joint research, (14) technological evaluation for radioactive liquid waste decontamination test, (15) strategic basis research, (16) general research for emergency medical treatment. The heavy ion project research is divided into 5 categories further; (1) clinical research, (2) medical treatment research, (3) diagnosis research, (4) biological research, (5) physics and engineering research. The detailed subjects of study are described in the report. A great number of research papers are published in Japan and all over the world. Organization, personnel, budget and accounts of the NIRS are also mentioned in the report. (Suetake, M.)

  12. Role of Institutes of Social Sciences in Enhancing the Quality of Postgraduate Education

    Directory of Open Access Journals (Sweden)

    Yılmaz TONBUL

    2017-04-01

    Full Text Available This study aimed to develop suggestions for the management of the Institute of Social Sciences on the effective execution of postgraduate education. A ‘mixed’ design was used. Data collection tools were applied directly to student population without the use of any sampling method. For advisors, criterion sampling was used.The participants of the study were composed of 207 postgraduate students registered at the Institute of Social Sciences and 39 instructors at Ege University. The student data were collected via the Supervisor Evaluation Scale and interview guide consisting of open-ended questions. The instructor data were collected during semi-structured focus group interviews. The participants stressed the informative, supportive and instructional roles of the institute for improving the quality of graduate education. In addition, differences as well as commonalities between the expectations of the students and those of the instructors were detected. The students’ expectations from the institute were the protection of students’ rights, mediation, ensuring the diversity of elective courses, the proper teaching of the courses in accordance with the nature of graduate education, and provision of information about career, time and stress management. Besides, the instructors’ expectations included attracting qualified candidates to programs, informing students, supporting the students with cadre and scholarship, reducing bureaucratic procedures, regulating the processes of supervisor selection and thesis proposal, providing access to resources during the processes of both course work and thesis writing, and forming colloquiums. The institute’s existing structure, authority distribution, staff and budget resources were found to be inadequate for increasing the quality of postgraduate education. Regarding the course and thesis stages, one third of the supervisors were evaluated as insufficient by the students. Many suggestions related to

  13. A science confidence gap: Education, trust in scientific methods, and trust in scientific institutions in the United States, 2014.

    Science.gov (United States)

    Achterberg, Peter; de Koster, Willem; van der Waal, Jeroen

    2017-08-01

    Following up on suggestions that attitudes toward science are multi-dimensional, we analyze nationally representative survey data collected in the United States in 2014 ( N = 2006), and demonstrate the existence of a science confidence gap: some people place great trust in scientific methods and principles, but simultaneously distrust scientific institutions. This science confidence gap is strongly associated with level of education: it is larger among the less educated than among the more educated. We investigate explanations for these educational differences. Whereas hypotheses deduced from reflexive-modernization theory do not pass the test, those derived from theorizing on the role of anomie are corroborated. The less educated are more anomic (they have more modernity-induced cultural discontents), which not only underlies their distrust in scientific institutions, but also fuels their trust in scientific methods and principles. This explains why this science confidence gap is most pronounced among the less educated.

  14. Public science policy and administration. [cooperation of government industry, foundations, and educational institutions

    Science.gov (United States)

    Rosenthal, A. H. (Editor)

    1973-01-01

    Science, the overwhelming concern of our time, is no longer a matter of private research and development but one of public policy and administration, in which government, industry, foundations, and educational institutions must all work together as never before. Few other single tasks are of such decisive importance to the collective and individual welfare of American citizens as the formulation of public science policy and the administration of scientific programs. Eleven national authorities of varied background in science, education, and government administration contribute their experience and their judgment in an effort to deal with the major aspects of the subject. Their focus is on the meeting of actual problems; they consider the decision making process in both public and public-private organizations. Topics are grouped in three general categories: personnel needs and resources, organizational problems and techniques, and the administrative role in policy leadership.

  15. Biological Dosimetry Methods Employed at the Boris Kidric Institute of Nuclear Sciences; Application de Quelques Methodes Particulieres de Dosimetrie Biologique a l'Institut des Sciences Nucleaires Boris Kidric

    Energy Technology Data Exchange (ETDEWEB)

    Aleksic, B.; Veljkovic, D.; Djordjevic, O.; Djukic, Z. [Institut des Sciences Nucleaires Boris Kidric, Belgrade, Yugoslavia (Serbia)

    1971-06-15

    In addition to the more usual methods, the following methods are used at the Boris Kidric Institute of Nuclear Sciences in the medical supervision of occupationally exposed staff: analysis of bi nucleated lymphocytes and chromosome aberrations; physical examination (for example, determination of the pain sensitivity threshold, adaptation to pain, discrimination of sensitivity); capillaroscopy. These methods are described briefly and their practical application discussed. (author) [French] Outre les methodes habituelles, on a utilise a l'Institut Boris Kidric, pour le controle medical des travailleurs professionnellement exposes, des methodes d'analyse des lymphocytes binuclees et des aberrations chromosomiques, ainsi que des methodes d'examen physique telles que la determination du seuil de sensibilite douloureuse, de l'adaptation a la douleur et de la discrimination de la sensibilite, et la capillaroscopie. Ces methodes sont brievement decrites et leurs applications pratiques discutees. (author)

  16. NASA LWS Institute GIC Working Group: GIC science, engineering and applications readiness

    Science.gov (United States)

    Pulkkinen, A. A.; Thomson, A. W. P.; Bernabeu, E.

    2016-12-01

    In recognition of the rapidly growing interest on the topic, this paper is based on the findings of the very first NASA Living With a Star (LWS) Institute Working Group that was specifically targeting the GIC issue. The new LWS Institutes program element was launched 2014 and the concept is built around small working group style meetings that focus on well defined problems that demand intense, direct interactions between colleagues in neighboring disciplines to facilitate the development of a deeper understanding of the variety of processes that link the solar activity to Earth's environment. The LWS Institute Geomagnetically Induced Currents (GIC) Working Group (WG) led by A. Pulkkinen (NASA GSFC) and co-led by E. Bernabeu (PJM) and A. Thomson (BGS) was selected competitively as the pilot activity for the new LWS element. The GIC WG was tasked to 1) identify, advance, and address the open scientific and engineering questions pertaining to GIC, 2) advance predictive modeling of GIC, 3) advocate and act as a catalyst to identify resources for addressing the multidisciplinary topic of GIC. In this paper, we target the goal 1) of the GIC WG. More specifically, the goal of this paper is to review the current status and future challenges pertaining to science, engineering and applications of the GIC problem. Science is understood here as the basic space and Earth sciences research that allow improved understanding and physics-based modeling of physical processes behind GIC. Engineering in turn is understood here as the "impact" aspect of GIC. The impact includes any physical effects GIC may have on the performance of the manmade infrastructure. Applications is understood as the models, tools and activities that can provide actionable information to entities such as power systems operators for mitigating the effects of GIC and government for managing any potential consequences from GIC impact to critical infrastructure. In this sense, applications can be considered as

  17. 78 FR 20666 - Food and Drug Administration/National Institutes of Health/National Science Foundation Public...

    Science.gov (United States)

    2013-04-05

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration [Docket No. FDA-2013-N-0345] Food and Drug Administration/National Institutes of Health/ National Science Foundation Public Workshop... public workshop; request for comments. SUMMARY: The Food and Drug Administration (FDA) is announcing its...

  18. Students' understandings of nature of science and their arguments in the context of four socio-scientific issues

    Science.gov (United States)

    Khishfe, Rola; Alshaya, Fahad S.; BouJaoude, Saouma; Mansour, Nasser; Alrudiyan, Khalid I.

    2017-02-01

    The purpose of this study was to examine students understandings about nature of science (NOS) and their arguments in context of controversial socio-scientific issue (SSI). A total of 74 11th graders in six schools in Saudi Arabia participated in the study. The instrument used was a questionnaire consisting of four scenarios addressing SSI about global warming, genetically modified food, acid rain, and human cloning. The scenarios were followed by questions relating to argumentation and NOS. Quantitative and qualitative measures were employed to analyze the data related to participants understandings of three NOS aspects (subjective, tentative, and empirical) and their arguments components (argument, counterargument, and rebuttal). Results showed no significant correlations between argument components and the NOS aspects. On the other hand, qualitative data showed that participants who generated well-developed arguments across the four SSI also exhibited more informed understandings of the NOS aspects, especially for female participants. Further, the chi-square analyses did not show significant differences in participants arguments and NOS understandings across the four scenarios. Again, the qualitative data from questionnaires showed differences in participants responses to the different scenarios. The results were interpreted along contextual factors, emotional factors, and cultural factors. Implications for the teaching of NOS and arguments were discussed.

  19. Polish Academy of Sciences. Institute of Biochemistry and Biophysics. Research Report 1998-1999

    International Nuclear Information System (INIS)

    2000-01-01

    The report presented research activities of the Institute of Biochemistry and Biophysics, Polish Academy of Sciences, in 1998-1999. Research interests focus on: replication, mutagenesis and repair of DNA, regulation of gene expression, biosynthesis and post-translational modifications of proteins, gene sequencing and functional gene analysis, structure and function of enzymes, conformation of proteins and peptides, modeling of structures and prediction of function of proteins

  20. Polish Academy of Sciences. Institute of Biochemistry and Biophysics. Research Report 1998-1999

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-07-01

    The report presented research activities of the Institute of Biochemistry and Biophysics, Polish Academy of Sciences, in 1998-1999. Research interests focus on: replication, mutagenesis and repair of DNA, regulation of gene expression, biosynthesis and post-translational modifications of proteins, gene sequencing and functional gene analysis, structure and function of enzymes, conformation of proteins and peptides, modeling of structures and prediction of function of proteins.

  1. The compact AMS facility at Guangzhou Institute of Geochemistry, Chinese Academy of Sciences

    Science.gov (United States)

    Zhu, Sanyuan; Ding, Ping; Wang, Ning; Shen, Chengde; Jia, Guodong; Zhang, Gan

    2015-10-01

    A compact 14C AMS facility manufactured by the National Electrostatics Corporation (NEC) has been installed at Guangzhou Institute of Geochemistry, Chinese Academy of Sciences (GIGCAS). The system is based on a Model 1.5SDH-1 Pelletron accelerator with a maximum terminal volt 0.6 MV. This paper reports the performance and the operation of this machine in the first several months after installation.

  2. The compact AMS facility at Guangzhou Institute of Geochemistry, Chinese Academy of Sciences

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Sanyuan [State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Ding, Ping; Wang, Ning; Shen, Chengde [State Key Laboratory of Isotopic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Jia, Guodong [Key laboratory of Marginal Sea Geology, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Zhang, Gan [State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China)

    2015-10-15

    A compact {sup 14}C AMS facility manufactured by the National Electrostatics Corporation (NEC) has been installed at Guangzhou Institute of Geochemistry, Chinese Academy of Sciences (GIGCAS). The system is based on a Model 1.5SDH-1 Pelletron accelerator with a maximum terminal volt 0.6 MV. This paper reports the performance and the operation of this machine in the first several months after installation.

  3. Evolutionary institutionalism.

    Science.gov (United States)

    Fürstenberg, Dr Kai

    Institutions are hard to define and hard to study. Long prominent in political science have been two theories: Rational Choice Institutionalism (RCI) and Historical Institutionalism (HI). Arising from the life sciences is now a third: Evolutionary Institutionalism (EI). Comparative strengths and weaknesses of these three theories warrant review, and the value-to-be-added by expanding the third beyond Darwinian evolutionary theory deserves consideration. Should evolutionary institutionalism expand to accommodate new understanding in ecology, such as might apply to the emergence of stability, and in genetics, such as might apply to political behavior? Core arguments are reviewed for each theory with more detailed exposition of the third, EI. Particular attention is paid to EI's gene-institution analogy; to variation, selection, and retention of institutional traits; to endogeneity and exogeneity; to agency and structure; and to ecosystem effects, institutional stability, and empirical limitations in behavioral genetics. RCI, HI, and EI are distinct but complementary. Institutional change, while amenable to rational-choice analysis and, retrospectively, to criticaljuncture and path-dependency analysis, is also, and importantly, ecological. Stability, like change, is an emergent property of institutions, which tend to stabilize after change in a manner analogous to allopatric speciation. EI is more than metaphorically biological in that institutional behaviors are driven by human behaviors whose evolution long preceded the appearance of institutions themselves.

  4. National Science and Technology Institute for Translational Medicine (INCT-TM): advancing the field of translational medicine and mental health.

    Science.gov (United States)

    Hallak, Jaime E C; Crippa, José Alexandre S; Quevedo, João; Roesler, Rafael; Schröder, Nadja; Nardi, Antonio Egidio; Kapczinski, Flávio

    2010-03-01

    Translational medicine has been described as the integrated application of innovative pharmacology tools, biomarkers, clinical methods, clinical technologies and study designs to improve the understanding of medical disorders. In medicine, translational research offers an opportunity for applying the findings obtained from basic research to every-day clinical applications. The National Science and Technology Institute for Translational Medicine is comprised of six member institutions (Universidade Federal do Rio Grande do Sul, Universidade de São Paulo-Ribeirão Preto, Universidade Federal do Rio de Janeiro, Pontifícia Universidade Católica do Rio Grande do Sul, Universidade Estadual de Santa Catarina and a core facility that serves all centers). The objectives of the project are divided into four areas: Institutional, Research, Human Resources and Technology for the Community and Productive Sector. In this manuscript, we describe some of the approaches used to attain the main objectives of the National Science and Technology Institute for Translational Medicine, which include the development of 1) animal models for bipolar disorder; 2) strategies to investigate neurobehavioral function and cognitive dysfunction associated with brain disorders; 3) experimental models of brain function and behavior, neuropsychiatric disorders, cell proliferation, and cancer; 4) Simulated Public Speaking and 5) Virtual reality simulation for inducing panic disorder and agoraphobia. The main focus of the National Science and Technology Institute for Translational Medicine is the development of more useful methods that allow for a better application of basic research-based knowledge to the medical field.

  5. Retention and promotion of women and underrepresented minority faculty in science and engineering at four large land grant institutions.

    Science.gov (United States)

    Gumpertz, Marcia; Durodoye, Raifu; Griffith, Emily; Wilson, Alyson

    2017-01-01

    In the most recent cohort, 2002-2015, the experiences of men and women differed substantially among STEM disciplines. Female assistant professors were more likely than men to leave the institution and to leave without tenure in engineering, but not in the agricultural, biological and biomedical sciences and natural resources or physical and mathematical sciences. In contrast, the median times to promotion from associate to full professor were similar for women and men in engineering and the physical and mathematical sciences, but one to two years longer for women than men in the agricultural, biological and biomedical sciences and natural resources. URM faculty hiring is increasing, but is well below the proportions earning doctoral degrees in STEM disciplines. The results are variable and because of the small numbers of URM faculty, the precision and power for comparing URM faculty to other faculty were low. In three of the four institutions, lower fractions of URM faculty than other faculty hired in the 2002-2006 time frame left without tenure. Also, in the biological and biomedical and physical and mathematical sciences no URM faculty left without tenure. On the other hand, at two of the institutions, significantly more URM faculty left before their tenth anniversary than other faculty and in engineering significantly more URM faculty than other faculty left before their tenth anniversary. We did not find significant differences in promotion patterns between URM and other faculty.

  6. Annual report of National Institute of Radiological Sciences, April, 1982 - March, 1983

    International Nuclear Information System (INIS)

    1983-10-01

    This report gives the information on the investigation conducted by the scientific staffs of the Institute during this period. The total budget of the NIRS for fiscal year 1982 was 5.85 billion yen, 800 million yen more than that for the previous year. Several new and important projects as well as the existing commitments were carried out by the prudent allocation of the budget. Three long term research projects were carried out, that is, exposure to the environment radiation due to nuclear power generation, estimation of the risk due to low level radiation exposure, and medial application of particle accelerators, in addition to basic research. The former two projects were completed by the end of fiscal year 1982. A research on the biological effect of tritium began as a new project for five years at the beginning of fiscal year 1982. As this year was the silver jubilee of the Institute, the commemorative meeting was held in October, 1982. The gists of 11 reports related to physics, 6 reports related to chemistry, 8 reports related to biochemistry and biophysics, 11 reports related to cell biology, 6 reports related to immunology and hematology, 12 reports related to pathology, 9 reports related to genetics, 7 reports related to clinical science and 18 reports related to environmental science are collected. (Kako, I.)

  7. Report on the work of the Institute of Nuclear Sciences 27 January - December 1976

    International Nuclear Information System (INIS)

    1977-10-01

    The work of the New Zealand Institute of Nuclear Sciences during the period January-June 1975 is summarized under the following headings: A) Nuclear Physics; B) Radiation Research; C) Isotope Geochemistry - Stable Isotopes; D) Radiocarbon Dating and Fallout; E) Radioisotope Applications; F) Instrumentation. Appendices on current research projects, staff publications and library holdings are included. (D.C.R.)

  8. Report on the work of the Institute of Nuclear Sciences 26 July - December 1975

    International Nuclear Information System (INIS)

    1976-04-01

    The work of the New Zealand Institute of Nuclear Sciences during the period January-June 1975 is summarized under the following headings: A) Nuclear Physics; B) Radiation Research; C) Isotope Geochemistry - Stable Isotopes; D) Radiocarbon Dating and Fallout; E) Radioisotope Applications; F) Instrumentation. Appendices on current research projects, staff publications and library holdings are included. (D.C.R.)

  9. [Eugène-Humbert Guitard and French Institute of History of Science (1932-1939)].

    Science.gov (United States)

    Lefebvre, Thierry

    2015-01-01

    Named "membre-conseil" of the French Institute of History of Science in April 1932, Guitard gives there, from January 1935 to February 1939, a dozen history of pharmacy conferences. Those conferences will give birth to her especially valuable Manuel d'histoire de la littérature pharmaceutique, published in 1942 by Caffin. The author re-examines this intellectual adventure.

  10. Bathyodontus mirus (Andrássy, 1956, first record of a representative of the suborder Bathyodontina (Nematoda, Mononchida in the Iberian fauna

    Directory of Open Access Journals (Sweden)

    Peña-Santiago, R.

    2010-12-01

    Full Text Available Bathyodontus mirus (Andrássy, 1956 Hopper & Cairns, 1956, collected in sand dunes of SW Iberian peninsula, is studied. Description, measurements and illustrations (LM pictures are provided. Iberian specimens are briefly compared to other known populations of the species. And a compendium of Bathyodontus species, including a key to their identification, is also given. This is the first record of a representative of the nematode suborder Bathyodontina in the Iberian-Balearic range and in the Mediterranean region.Se estudia la especie Bathyodontus mirus (Andrássy, 1956 Hopper y Cairns, 1956, recolectada en dunas de arena en el suroeste peninsular. Se presentan una descripción, medidas e ilustraciones (fotografías con microscopía óptica. Los ejemplares ibéricos se comparan brevemente con otras poblaciones conocidas de la misma especie. Y se ofrece un compendio de las especies del género Bathyodontus, incluida una clave para su identification. Se trata de la primera cita de un miembro del suborden Bathyodontina en el ámbito Ibero-balear y en la región Mediterránea.

  11. Annual report of Nuclear Science Research Institute, JFY2006

    International Nuclear Information System (INIS)

    2008-03-01

    Nuclear Science Research Institute (NSRI) is composed of Planning and Coordination Office and seven departments such as Department of Operational Safety Administration, Department of Radiation Protection, Department of Research Reactor and Tandem Accelerator, Department of Hot Laboratories and Facilities, Department of Criticality and Fuel Cycle Research Facilities, Department of Decommissioning and Waste Management, and Engineering Services Department. This annual report of JFY2006 summarizes the activities of NSRI, the R and D activities of the Research and Development Directorates and human resources development at site, and is expected to be referred to and utilized by R and D departments and project promotion sectors at NSRI site for the enhancement of their own research and management activities to attain their goals according to 'Middle-term Plan' successfully and effectively. In chapter 1, outline of JFY2006 activities of NSRI is described. In chapter 2, the following activities made by the departments in NSRI are summarized, i.e., (1) operation and maintenance of research reactors (JRR-3, JRR-4, NSRR), criticality assemblies (STACY, TRACY, FCA, TCA), hot laboratories (BECKY, Reactor Fuel Examination Facility, WASTEF, Research Laboratory 4, Plutonium Research Laboratory 1, Tokai Hot Laboratory, etc), and large-scale facilities (Tandem accelerator, LSTF, THYNC, TPTF, etc), and (2) safety management, radiation protection, management of radioactive wastes, decommissioning of nuclear facilities, engineering services, utilities and maintenance, etc, all of which are indispensable for the stable and safe operation and utilization of the research facilities. The technical developments for the advancement of the related technologies are also summarized. In chapter 3, the R and D and human resources development activities are described including the topics of the research works and projects performed by the Research and Development Directorates at site, such as

  12. 1992 Environmental Summer Science Camp Program evaluation. The International Environmental Institute of Westinghouse Hanford Company

    Energy Technology Data Exchange (ETDEWEB)

    1993-07-01

    This report describes the 1992 Westinghouse Hanford Company/US Department of Energy Environmental Summer Science Camp. The objective of the ``camp`` was to motivate sixth and seventh graders to pursue studies in math, science, and the environment. This objective was accomplished through hands-on fun activities while studying the present and future challenges facing our environment. The camp was funded through Technical Task Plan, 424203, from the US Department of Energy-Headquarters, Office of Environmental Restoration and Waste Management, Technology Development,to Westinghouse Hanford Company`s International Environmental Institute, Education and Internship Performance Group.

  13. Paul Scherrer Institute Scientific Report 1999. Volume II: Life Sciences

    Energy Technology Data Exchange (ETDEWEB)

    Jaussi, Rolf; Gschwend, Beatrice [eds.

    2000-07-01

    The existing activities of the Department of Life Sciences have grown out of the specific know how and the unique experimental possibilities available at PSI. Primarily, these have been and are complex facilities for using particle beams (protons, neutrons) on the one hand and know how in the production, handling and chemistry of radionuclides on the other. The common theme of the department has thus been the study and use of various types of radiation in therapy and diagnostics of human disease and in particular of cancer. The four units active in this area are: The major activity in the Radiation Medicine unit is Proton Therapy, which aims to further develop and optimise the world-wide unique spot scanning facility for irradiating malignant tumours with minimal damage to surrounding healthy tissues, including the established OPTIS program for the treatment of eye tumours. The Centre for Radiopharmaceutical Science represents a joint activity of PSI with the Swiss Federal Institute of Technology (ETHZ) and the University of Zurich. Its major goals are the development of novel tumour targeted radioconjugates for cancer diagnosis and therapy and the production and evaluation of new PET (positron emission tomography) radiotracers for various applications in neuro physiology and drug development. The Institute of Medical Radiobiology analyses questions of the molecular biology of DNA repair. It is a joint activity of PSI and the University of Zurich. The Structural Biology unit is currently being established. A strong in-house research activity in macromolecular crystallography will complement the more user-oriented protein crystallography beam line, which is being built at the Swiss Light Source (SLS). In particular, tumour targeting by molecular vehicles and DNA repair are areas where structural information can provide important insights. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  14. Paul Scherrer Institute Scientific Report 1999. Volume II: Life Sciences

    International Nuclear Information System (INIS)

    Jaussi, Rolf; Gschwend, Beatrice

    2000-01-01

    The existing activities of the Department of Life Sciences have grown out of the specific know how and the unique experimental possibilities available at PSI. Primarily, these have been and are complex facilities for using particle beams (protons, neutrons) on the one hand and know how in the production, handling and chemistry of radionuclides on the other. The common theme of the department has thus been the study and use of various types of radiation in therapy and diagnostics of human disease and in particular of cancer. The four units active in this area are: The major activity in the Radiation Medicine unit is Proton Therapy, which aims to further develop and optimise the world-wide unique spot scanning facility for irradiating malignant tumours with minimal damage to surrounding healthy tissues, including the established OPTIS program for the treatment of eye tumours. The Centre for Radiopharmaceutical Science represents a joint activity of PSI with the Swiss Federal Institute of Technology (ETHZ) and the University of Zurich. Its major goals are the development of novel tumour targeted radioconjugates for cancer diagnosis and therapy and the production and evaluation of new PET (positron emission tomography) radiotracers for various applications in neuro physiology and drug development. The Institute of Medical Radiobiology analyses questions of the molecular biology of DNA repair. It is a joint activity of PSI and the University of Zurich. The Structural Biology unit is currently being established. A strong in-house research activity in macromolecular crystallography will complement the more user-oriented protein crystallography beam line, which is being built at the Swiss Light Source (SLS). In particular, tumour targeting by molecular vehicles and DNA repair are areas where structural information can provide important insights. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  15. The Impact of a Summer Institute on Inservice Early Childhood Teachers' Knowledge of Earth and Space Science Concepts

    Science.gov (United States)

    Sackes, Mesut; Trundle, Kathy Cabe; Krissek, Lawrence A.

    2011-01-01

    This study investigated inservice PreK to Grade two teachers' knowledge of some earth and space science concepts before and after a short-term teacher institute. A one-group pre-test-post-test design was used in the current study. Earth science concepts targeted during the professional development included properties of rocks and soils, and the…

  16. Looking in the Right Places: Minority-Serving Institutions as Sources of Diverse Earth Science Learners

    Science.gov (United States)

    McDaris, John R.; Manduca, Cathryn A.; Iverson, Ellen R.; Orr, Cailin Huyck

    2017-01-01

    Despite gains over the last decade, the geoscience student population in the United States today continues to lag other science, technology, engineering, and mathematics disciplines in terms of diversity. Minority-serving institutions (MSIs) can play an important role in efforts to broaden underrepresented student engagement with Earth Science…

  17. Center for Medicare and Medicaid Services (CMS) Nursing Home Match (MDS)

    Data.gov (United States)

    Social Security Administration — The purpose of the project is to detect unreported Supplemental Security Income (SSI) recipient admissions to Title XIX institutions. A file containing SSN's of SSI...

  18. Designing and Implementing Web-Based Scaffolding Tools for Technology-Enhanced Socioscientific Inquiry

    Science.gov (United States)

    Shin, Suhkyung; Brush, Thomas A.; Glazewski, Krista D.

    2017-01-01

    This study explores how web-based scaffolding tools provide instructional support while implementing a socio-scientific inquiry (SSI) unit in a science classroom. This case study focused on how students used web-based scaffolding tools during SSI activities, and how students perceived the SSI unit and the scaffolding tools embedded in the SSI…

  19. Postdoctoral Mentoring at the Space Telescope Science Institute

    Science.gov (United States)

    Peeples, Molly

    2018-01-01

    The Space Telescope Science Institute (STScI) has, on average, about 30 postdoctoral researchers. This groups is funded primarily by individual grants but includes independent Fellows (Giacconi, Lasker, and Hubble Fellows) and postdocs based at neighboring Johns Hopkins University but with supervisors based at STScI. Our mentoring program aims to support the intellectual and career development of this entire group, outside of the scientific and career mentoring they receive from their direct supervisors or fellowship sponsors. Our mentoring program consists of two parts. First and foremost, each postdoc has a mentor (someone on the research staff) with whom they meet regularly. Ideally, the mentor is not someone with whom the postdoc collaborates scientifically and can therefore provide an outside, independent, fresh perspective. As different postdocs require different kinds of mentoring, we try to best pair postdocs and mentors according to the postdocs’ needs and the mentors’ backgrounds, skills, and mentoring styles. Second, we conduct several career guidance seminars and related events throughout the year. These have included proposal writing workshops, formalized practice talks, academic job application seminars, and discussion sessions on career paths outside of academia (featuring colleagues who are no longer in academia). These workshops have the added benefit of providing the postdocs with a wider support network of staff members. Finally, we have begun to conduct an annual survey of the postdocs to gauge their experience and integration at STScI, the efficacy of the mentoring program, and to collect feedback on how to improve postdoctoral life at the Institute.

  20. Annual report of National Institute of Radiological Sciences of the fiscal year 1985

    International Nuclear Information System (INIS)

    1986-05-01

    The activities of National Institute of Radiological Sciences in fiscal year 1985 was carried out on the basis of the total budget of 5,550.597 million yen and 404 regular staffs. The ordinary research was carried out on 65 subjects, and the results of internationally high level were obtained. The special research was carried out by selecting four subjects: the biological effect of tritium accompanying fusion reactor development, the probabilistic effect of radiation and risk evaluation, the evaluation of exposure to environmental radiation, and the medical application of heavy particle beam. In addition to these, the specified research and the research based on the science and technology promotion coordination expense were carried out. In this institute, research has been advanced by collective discipline method, and the results have obtained high reputation. This fact owes much to the efforts of Administration Division, Technical Division and Hospital Division as well as Research Division. The total number of trainees who finished various courses reached 3651 in fiscal year 1985, and this has contributed largely to the protection from and the utilization of radiation in Japan. Recently, the importance of international exchange has increased, and efforts have been exerted to take part in various international activities overcoming all difficulties. (Kako, I.)

  1. Ghana Space Science and Technology Institute (GSSTI),Ghana Atomic Energy Commission: Annual Report 2013/2014

    International Nuclear Information System (INIS)

    2014-01-01

    The report presents the structure as well as the research projects of the newly established Ghana Space Science and Technology Institute of the Ghana Atomic Energy Commission from January to December 2014. Research projects listed are in the areas of Astronomy and Astrophysics; Remote Sensing; Electronics and Instrumentation; and Satellite Communication.

  2. Crossing Science-Policy-Societal Boundaries to Reduce Scientific and Institutional Uncertainty in Small-Scale Fisheries

    Science.gov (United States)

    Sutton, Abigail M.; Rudd, Murray A.

    2016-10-01

    The governance of small-scale fisheries (SSF) is challenging due to the uncertainty, complexity, and interconnectedness of social, political, ecological, and economical processes. Conventional SSF management has focused on a centralized and top-down approach. A major criticism of conventional management is the over-reliance on `expert science' to guide decision-making and poor consideration of fishers' contextually rich knowledge. That is thought to exacerbate the already low governance potential of SSF. Integrating scientific knowledge with fishers' knowledge is increasingly popular and is often assumed to help reduce levels of biophysical and institutional uncertainties. Many projects aimed at encouraging knowledge integration have, however, been unsuccessful. Our objective in this research was to assess factors that influence knowledge integration and the uptake of integrated knowledge into policy-making. We report results from 54 semi-structured interviews with SSF researchers and practitioners from around the globe. Our analysis is framed in terms of scientific credibility, societal legitimacy, and policy saliency, and we discuss cases that have been partially or fully successful in reducing uncertainty via push-and-pull-oriented boundary crossing initiatives. Our findings suggest that two important factors affect the science-policy-societal boundary: a lack of consensus among stakeholders about what constitutes credible knowledge and institutional uncertainty resulting from shifting policies and leadership change. A lack of training for scientific leaders and an apparent `shelf-life' for community organizations highlight the importance of ongoing institutional support for knowledge integration projects. Institutional support may be enhanced through such investments, such as capacity building and specialized platforms for knowledge integration.

  3. Crossing Science-Policy-Societal Boundaries to Reduce Scientific and Institutional Uncertainty in Small-Scale Fisheries.

    Science.gov (United States)

    Sutton, Abigail M; Rudd, Murray A

    2016-10-01

    The governance of small-scale fisheries (SSF) is challenging due to the uncertainty, complexity, and interconnectedness of social, political, ecological, and economical processes. Conventional SSF management has focused on a centralized and top-down approach. A major criticism of conventional management is the over-reliance on 'expert science' to guide decision-making and poor consideration of fishers' contextually rich knowledge. That is thought to exacerbate the already low governance potential of SSF. Integrating scientific knowledge with fishers' knowledge is increasingly popular and is often assumed to help reduce levels of biophysical and institutional uncertainties. Many projects aimed at encouraging knowledge integration have, however, been unsuccessful. Our objective in this research was to assess factors that influence knowledge integration and the uptake of integrated knowledge into policy-making. We report results from 54 semi-structured interviews with SSF researchers and practitioners from around the globe. Our analysis is framed in terms of scientific credibility, societal legitimacy, and policy saliency, and we discuss cases that have been partially or fully successful in reducing uncertainty via push-and-pull-oriented boundary crossing initiatives. Our findings suggest that two important factors affect the science-policy-societal boundary: a lack of consensus among stakeholders about what constitutes credible knowledge and institutional uncertainty resulting from shifting policies and leadership change. A lack of training for scientific leaders and an apparent 'shelf-life' for community organizations highlight the importance of ongoing institutional support for knowledge integration projects. Institutional support may be enhanced through such investments, such as capacity building and specialized platforms for knowledge integration.

  4. Socioscientific Argumentation: The effects of content knowledge and morality

    Science.gov (United States)

    Sadler, Troy D.; Donnelly, Lisa A.

    2006-10-01

    Broad support exists within the science education community for the incorporation of socioscientific issues (SSI) and argumentation in the science curriculum. This study investigates how content knowledge and morality contribute to the quality of SSI argumentation among high school students. We employed a mixed-methods approach: 56 participants completed tests of content knowledge and moral reasoning as well as interviews, related to SSI topics, which were scored based on a rubric for argumentation quality. Multiple regression analyses revealed no statistically significant relationships among content knowledge, moral reasoning, and argumentation quality. Qualitative analyses of the interview transcripts supported the quantitative results in that participants very infrequently revealed patterns of content knowledge application. However, most of the participants did perceive the SSI as moral problems. We propose a “Threshold Model of Knowledge Transfer” to account for the relationship between content knowledge and argumentation quality. Implications for science education are discussed.

  5. A Framework for Teachers' Assessment of Socio-Scientific Argumentation: An Example Using the GMO Issue

    Science.gov (United States)

    Christenson, Nina; Chang Rundgren, Shu-Nu

    2015-01-01

    Socio-scientific issues (SSI) have proven to be suitable contexts for students to actively reflect on and argue about complex social issues related to science. Research has indicated that explicitly teaching SSI argumentation is a good way to help students develop their argumentation skills and make them aware of the complexity of SSI. However,…

  6. Annual report of National Institute of Radiological Sciences, April 1986 - March 1987

    International Nuclear Information System (INIS)

    1987-07-01

    The Annual Report of April 1986-March 1987 provides the information on up-to-date research activities of the National Institute of Radiological Sciences (NIRS) in Japan. Researches undertaken in the NIRS aim at promoting medical application of radiation and at investigating health effects of radiation and radiation protection especially for the medical purpose. The research scope is therefore widely ranging from physics to genetics and from environmental science to clinical medicine. In addition to basic researches carried out by 14 research divisions, the following longterm projects which were organized by scientists recruited from several divisions are currently in progress: (1) biological effects of tritium; (2) stochastic effects of radiation and risk estimation; (3) assessment of human exposure to environmental radiation; and (4) medical use of accelerated heavy ions. This volume is divided into the following scientific categories for ease of reader's understanding: physics, chemistry, biochemistry and biophysics, cell biology, immunology and hematology, pathology and physiology, genetics, clinical research, and environmental science, covering a total of 97 titles. Activities of each research division and organization of the NIRS are given in Appendices. (N.K.)

  7. Annual report of National Institute of Radiological Sciences, April 1987 - March 1988

    International Nuclear Information System (INIS)

    1988-07-01

    The Annual Report of April 1987-March 1988 provides the information on up-to-date research activities of the National Institute of Radiological Sciences (NIRS) in Japan. Researches undertaken in the NIRS aim at promoting medical application of radiation and at investigating health effects of radiation and radiation protection. The research scope is therefore widely ranging from physics to genetics and from environmental science to clinical medicine. In addition to basic researches carried out by 14 research divisions, the following three longterm projects which were organized by scientists recruited from several divisions are currently in progress: (1) stochastic effects of radiation and risk estimation; (2) assessment of human exposure to environmental radiation; and (3) medical use of accelerated heavy ions. Projects (1) and (2) were finalized in this fiscal year. This volume is divided into the following scientific categories for ease of reader's understanding: physics, chemistry, biochemistry and biophysics, cell biology, immunology and hematology, pathology and physiology, genetics, clinical research, and environmental science, covering a total of 93 titles. Activities of each research division and organization of the NIRS are given in Appendices. (N.K.)

  8. Research Advances at the Institute for Nutritional Sciences at Shanghai, China12

    Science.gov (United States)

    Chen, Yan; Lin, Xu; Liu, Yong; Xie, Dong; Fang, Jing; Le, Yingying; Ke, Zunji; Zhai, Qiwei; Wang, Hui; Guo, Feifan; Wang, Fudi; Liu, Yi

    2011-01-01

    Nutrition-related health issues have emerged as a major threat to public health since the rebirth of the economy in China starting in the 1980s. To meet this challenge, the Chinese Academy of Sciences established the Institute for Nutritional Sciences (INS) at Shanghai, China ∼8 y ago. The mission of the INS is to apply modern technologies and concepts in nutritional research to understand the molecular mechanism and provide means of intervention in the combat against nutrition-related diseases, including type 2 diabetes, metabolic syndrome, obesity, cardiovascular diseases, and many types of cancers. Through diligent and orchestrated efforts by INS scientists, graduate students, and research staff in the past few years, the INS has become the leading institution in China in the areas of basic nutritional research and metabolic regulation. Scientists at the INS have made important progress in many areas, including the characterization of genetic and nutritional properties of the Chinese population, metabolic control associated with nutrient sensing, molecular mechanisms underlying glucose and lipid metabolism, regulation of metabolism by adipokines and inflammatory pathways, disease intervention using functional foods or extracts of Chinese herbs, and many biological studies related to carcinogenesis. The INS will continue its efforts in understanding the optimal nutritional needs for Chinese people and the molecular causes associated with metabolic diseases, thus paving the way for effective and individualized intervention in the future. This review highlights the major research endeavors undertaken by INS scientists in recent years. PMID:22332084

  9. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Editorial Board. Sadhana. Editor. N Viswanadham, Indian Institute of Science, Bengaluru. Senior Associate Editors. Arakeri J H, Indian Institute of Science, Bengaluru Hari K V S, Indian Institute of Science, Bengaluru Mujumdar P P, Indian Institute of Science, Bengaluru Manoj Kumar Tiwari, Indian Institute of Technology, ...

  10. TTI Phase 2 Institutional Support: Indian Institute of Dalit Studies ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This funding will enhance the Indian Institute of Dalit Studies' (IIDS) role as a credible public policy institution in India by strengthening its ability to provide high-quality, influential, and policy-relevant research. About the Indian Institute of Dalit Studies IIDS is a social sciences research centre with a focus on development ...

  11. Summer Teacher Enhancement Institute for Science, Mathematics, and Technology Using the Problem-Based Learning Model

    Science.gov (United States)

    Petersen, Richard H.

    1997-01-01

    The objectives of the Institute were: (a) increase participants' content knowledge about aeronautics, science, mathematics, and technology, (b) model and promote the use of scientific inquiry through problem-based learning, (c) investigate the use of instructional technologies and their applications to curricula, and (d) encourage the dissemination of TEI experiences to colleagues, students, and parents.

  12. Annual report for FY 2012 on the activities of radiation safety in Nuclear Science Research Institute etc. April 1, 2012 - March 31, 2013

    International Nuclear Information System (INIS)

    2014-02-01

    This annual report describes the activities in the 2012 fiscal year of Department of Radiation Protection in Nuclear Science Research Institute, Safety Section in Takasaki Advanced Radiation Research Institute, Safety Section in Kansai Photon Science Institute, Operation Safety Administration Section in Aomori Research and Development Center and Safety Section in Naka Fusion Institute. The activities described are environmental monitoring, radiation protection practices in workplaces, individual monitoring, maintenance of monitoring instruments, and research and development of radiation protection. At these institutes the occupational exposures did not exceed the dose limits. The radioactive gaseous and liquid discharges from the facilities were well below the prescribed limits. The radiological situations at the institutes in Tokai, Aomori and Naka have been affected by the Fukushima Dai-ichi nuclear power plant accident in March 2011. The research and development activities produced certain results in the fields of radiation protection technique. The radiation protection experts in the institutes actively participated in the projects after the Fukushima nuclear power plant accident. (author)

  13. Annual report for FY 2012 on the activities of radiation safety in Nuclear Science Research Institute etc. April 1, 2012 - March 31, 2013

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2014-02-15

    This annual report describes the activities in the 2012 fiscal year of Department of Radiation Protection in Nuclear Science Research Institute, Safety Section in Takasaki Advanced Radiation Research Institute, Safety Section in Kansai Photon Science Institute, Operation Safety Administration Section in Aomori Research and Development Center and Safety Section in Naka Fusion Institute. The activities described are environmental monitoring, radiation protection practices in workplaces, individual monitoring, maintenance of monitoring instruments, and research and development of radiation protection. At these institutes the occupational exposures did not exceed the dose limits. The radioactive gaseous and liquid discharges from the facilities were well below the prescribed limits. The radiological situations at the institutes in Tokai, Aomori and Naka have been affected by the Fukushima Dai-ichi nuclear power plant accident in March 2011. The research and development activities produced certain results in the fields of radiation protection technique. The radiation protection experts in the institutes actively participated in the projects after the Fukushima nuclear power plant accident. (author)

  14. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Editorial Board. Proceedings – Mathematical Sciences. Chief Editor. B V Rajarama Bhat, Indian Statistical Institute, Bengaluru (bhat@isibang.ac.in). Associate Editor. Parameswaran Sankaran, The Institute of Mathematical Sciences, Chennai (sankaran@imsc.res.in). Advisory Board. M S Raghunathan, Indian Institute of ...

  15. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 29; Issue 5 ... Polyester urethane; scaffold; tensile strength; swelling; degradation; cell culture. ... Materials Science Centre, Indian Institute of Technology, Kharagpur 721 302, India; School of Medical Science and Technology, Indian Institute of Technology, Kharagpur ...

  16. 77 FR 48506 - Notice of Submission for OMB Review; Institute of Education Sciences; What Works Clearinghouse

    Science.gov (United States)

    2012-08-14

    ... DEPARTMENT OF EDUCATION Notice of Submission for OMB Review; Institute of Education Sciences; What... request to continue a currently approved collection under OMB Control Number 1850-0788 for the What Works... considered public records. Title of Collection: What Works Clearinghouse. OMB Control Number: 1850-0788. Type...

  17. Annual report of National Institute of Radiological Sciences of the fiscal year 1988

    International Nuclear Information System (INIS)

    1990-03-01

    This annual report presents the activities of the National Institute of Radiological Sciences in Japan in the fiscal year 1988. The activities are divided into research, technical aids, training, medical services, management, library or editing, and international cooperation. Research activities are described under the following sections: (I) newly started special researches for 'biological risk evaluation in public exposure' and 'exposure assessment in the environment and the public involved in food chain', and the continuing special research for 'medical use of accelerated heavy ions'; (II) five assigned researches; (III) ordinary researches concerning physics, pharmachochemistry, biology, genetics, pathology and physiology, cell biology, internal exposure, environmental science, clinical research, clinical research for radiation injuries, medical use of heavy particles, environmental radiation ecology, and aquatic radiation ecology; (IV) risk estimation of radiation; (V) actual surveys for Bikini victims, population doses of medical and occupational exposure, and thorotrast exposure; (VI) project research; (VII) radioactivity survey; (VIII) research supported by Science and Technology Agency aids. Appendices include the personnel list and the bibliography of articles reported by the staff. (N.K.)

  18. Annual report of National Institute of Radiological Sciences of the fiscal year 1987

    International Nuclear Information System (INIS)

    1988-12-01

    This annual report presents the activities of the National Institute of Radiological Sciences in Japan in the fiscal year 1987. The activities are divided into research, technical aids, training, medical services, management, library or editing, and international cooperation. Research activities are described under the following sections: (1) 5-year special projects concerning 'stochastic effects of radiation and risk estimation', 'assessment of human exposure to environmental radiation' and 'medical use of accelerated heavy ions'; (2) 6 titles in assigned research; (3) 60 titles in ordinary research covering physics, chemistry, biology, genetics, pathology and physiology, cell biology, internal exposure, environmental science, clinical research, clinical research for radiation injuries, medical use of heavy particles, environmental radiation ecology, and aquatic radiation ecology; (4) risk estimation of radiation; (5) actual surveys for Bikini victims, population doses of medical and occupational exposure, and thorotrast exposure; (6) project research; (7) radioactivity survey; (8) research supported by Science and Technology Agency aids. An outline of technical aids is given in terms of technical services, radiation safety, animal and plant management, and cyclotron management. Appendices give publications, organization, and staff. (N.K.)

  19. Annual report of National Institute of Radiological Sciences of the fiscal year 1989

    International Nuclear Information System (INIS)

    1990-12-01

    This annual report presents the activities of the National Institute of Radiological Sciences in Japan in the fiscal year 1989. The activities are divided into research, technical aids, training, medical services, management, library or editing, and international cooperation. Research activities are described under the following sections: (I) newly started special researches for 'biological risk evaluation in public exposure' and 'exposure assessment in the environment and the public involved in food chain', and the continuing special research for 'medical use of accelerated heavy ions'; (II) six assigned researches; (III) ordinary researches concerning physics, pharmachochemistry, biology, genetics, pathology and physiology, cell biology, internal exposure, environmental science, clinical research, clinical research for radiation injuries, medical use of heavy particles, environmental radiation ecology, and aquatic radiation ecology; (IV) risk estimation of radiation; (V) actual surveys for Bikini victims, population doses of medical and occupational exposure, and thorotrast exposure; (VI) project research; (VII) radioactivity survey; (VIII) research supported by Science and Technology Agency aids. Appendices include the personnel list and the bibliography of articles reported by the staff. (N.K.) 809 refs

  20. Coevolution of economic behaviour and institutions: towards a theory of institutional change

    NARCIS (Netherlands)

    van den Bergh, J.C.J.M.

    2003-01-01

    Traditionally, economics has regarded institutions, notably norms and regulations, as fixed or exogenous. Surprisingly few insights on institutional evolution from natural and social sciences have made their way into economics. This article gives an overview of evolutionary theories of institutions

  1. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... XIONG1 WEIHUA ZHU1 HEMING XIAO1. Institute for Computation in Molecular and Materials Science and Department of Chemistry, School of Chemical Engineering, Nanjing University of Science and Technology, Nanjing 210094, China; School of Materials Science and Engineering, Nanjing Institute of Technology, ...

  2. Artificial climate experiment facility in Institute for Environmental Sciences

    Energy Technology Data Exchange (ETDEWEB)

    Hisamatsu, Shunichi [Department of Radioecology, Institute for Environmental Sciences, Rokkasho, Aomori (Japan)

    1999-03-01

    The Institute for Environmental Sciences is now constructing the artificial climate experiment facility (ACEF) to research the effect of climate on movement of elements in the various environments. The ACEF will have one large, and five small artificial climate experiment chambers. The large chamber is designed to simulate climate conditions in all Japan. It will equip systems to simulate sunshine, rainfall (including acid rain), snowfall and fog (including acid fog). `Yamase` condition will also be reproduced in it. Yamase is a Japanese term describing the characteristic weather condition occurring mainly on the Pacific Ocean side at the northern Japan. While the small chamber will not have rainfall, snowfall and fog systems, radioisotopes will be used in the two small chambers which will be set up in a radioisotope facility. We describe here the outline of the ACEF and the preliminary research programs being undertaken using both kinds of chambers. (author)

  3. Artificial climate experiment facility in Institute for Environmental Sciences

    International Nuclear Information System (INIS)

    Hisamatsu, Shunichi

    1999-01-01

    The Institute for Environmental Sciences is now constructing the artificial climate experiment facility (ACEF) to research the effect of climate on movement of elements in the various environments. The ACEF will have one large, and five small artificial climate experiment chambers. The large chamber is designed to simulate climate conditions in all Japan. It will equip systems to simulate sunshine, rainfall (including acid rain), snowfall and fog (including acid fog). 'Yamase' condition will also be reproduced in it. Yamase is a Japanese term describing the characteristic weather condition occurring mainly on the Pacific Ocean side at the northern Japan. While the small chamber will not have rainfall, snowfall and fog systems, radioisotopes will be used in the two small chambers which will be set up in a radioisotope facility. We describe here the outline of the ACEF and the preliminary research programs being undertaken using both kinds of chambers. (author)

  4. Fiscal 1982 plans of works in National Institute of Radiological Sciences, Science and Technology Agency

    International Nuclear Information System (INIS)

    1982-01-01

    National Institute of Radiological Sciences, since its establishment in 1957, has engaged in the research and other works on the radiation injuries in human bodies, the medical utilization of radiation and the training and education of personnel in the field. The plans of works in fiscal 1982 in the NIRS are described. As special research works, there are the estimation of the degree of danger due to low level radiation for human bodies, environmental radiation exposure due to nuclear facilities, etc., the medical utilization of particle accelerators, and the biological effects of tritium in nuclear fusion reactor development. Ordinary research works include physics, chemistry, genetics, pharmacy, clinical research, etc. In other areas of activities are radiation risk evaluation, radioactivity investigation, technological aid, personnel education and training, and medical work. (Mori, K.)

  5. Why Principal Investigators Funded by the U.S. National Institutes of Health Publish in the Public Library of Science Journals

    Science.gov (United States)

    Pontika, Nancy

    2015-01-01

    Introduction: The National Institutes of Health public access policy requires the principal investigators of any Institutes-funded research to submit their manuscript to PubMed Central, and the open access publisher Public Library of Science submits all articles to PubMed Central, irrespective of funder. Whether the investigators, who made the…

  6. Interdisciplinary and inter-institutional differences in learning preferences among Malaysian medical and health sciences students.

    Science.gov (United States)

    Wong, Rebecca S Y; Siow, Heng Loke; Kumarasamy, Vinoth; Shaherah Fadhlullah Suhaimi, Nazrila

    2017-10-01

    The learner-centred approach in medical and health sciences education makes the study of learning preferences relevant and important. This study aimed to investigate the interdisciplinary, inter-institutional, gender and racial differences in the preferred learning styles among Malaysian medical and health sciences students in three Malaysian universities, namely SEGi University (SEGi), University of Malaya (UM) and Universiti Tunku Abdul Rahman (UTAR). It also investigated the differences in the preferred learning styles of these students between high achievers and non-high achievers. This cross-sectional study was carried out on medical and health sciences students from three Malaysian universities following the approval of the Research and Ethics Committee, SEGi University. Purposive sampling was used and the preferred learning styles were assessed using the VARK questionnaire. The questionnaire was validated prior to its use. Three disciplines (medicine, pharmacy and dentistry) were chosen based on their entry criteria and some similarities in their course structure. The three participating universities were Malaysian universities with a home-grown undergraduate entry medical program and students from a diverse cultural and socioeconomic background. The data were analysed using the Statistical Package for the Social Sciences (SPSS) software, version 22. VARK subscale scores were expressed as mean+standard deviation. Comparisons of the means were carried out using t-test or ANOVA. A p value of 0.05). This study gives an insight into the learner characteristics of more than one medical school in Malaysia. Such multi-institutional studies are lacking in the published literature and this study gives a better representation of the current situation in the learning preferences among medical students in Malaysia.

  7. Science in democracy: expertise, institutions, and representation

    National Research Council Canada - National Science Library

    Brown, Mark B

    2009-01-01

    ...? In Science in Democracy, Mark Brown draws on science and technology studies, democratic theory, and the history of political thought to show why an adequate response to politicized science depends...

  8. [Research Conducted at the Institute for Computer Applications in Science and Engineering for the Period October 1, 1999 through March 31, 2000

    Science.gov (United States)

    Bushnell, Dennis M. (Technical Monitor)

    2000-01-01

    This report summarizes research conducted at the Institute for Computer Applications in Science and Engineering in applied mathematics, computer science, fluid mechanics, and structures and materials during the period October 1, 1999 through March 31, 2000.

  9. Paul Scherrer Institute Scientific Report 2000. Volume II: Life Sciences

    Energy Technology Data Exchange (ETDEWEB)

    Jaussi, Rolf; Gschwend, Beatrice [eds.

    2001-07-01

    The existing activities of the Department of Life Sciences have grown out of the specific know-how and the unique experimental possibilities available at PSI. Primarily, these have been and are complex facilities for using particle beams (protons, neutrons) on the one hand and know-how in the production, handling and chemistry of radionuclides on the other. The common theme of the department has thus been the study and use of various types of radiation in therapy and diagnostics of human disease and in particular of cancer. The four units active in this area are: The major activity in the Radiation Medicine unit is Proton Therapy, which aims to further develop and optimise the world-wide unique spot scanning facility for irradiating malignant tumours with minimal damage to surrounding healthy tissues, including the established OPTIS program for the treatment of eye tumours. The Centre for Radiopharmaceutical Science represents a joint activity of PSI with the Swiss Federal Institute of Technology (ETHZ) and the University of Zurich. Its major goals are the development of novel tumour targeted radioconjugates for cancer diagnosis and therapy and the production and evaluation of new PET (positron emission tomography) radiotracers for various applications in neuro physiology and drug development. The Institute of Medical Radiobiology analyses questions of the molecular biology of DNA repair. It is a joint activity of PSI and the University of Zurich. The newly established Structural Biology group is still in the build-up phase. A strong in-house research activity in macromolecular crystallography will complement the more user-oriented protein crystallography beam line, which is being built at the Swiss Light Source (SLS). In particular, tumour targeting by molecular vehicles and DNA repair are areas where structural information can provide important insights. Progress in 2000 in these topical areas is described in this report. A list of scientific publications in 2000

  10. Paul Scherrer Institute Scientific Report 2000. Volume II: Life Sciences

    International Nuclear Information System (INIS)

    Jaussi, Rolf; Gschwend, Beatrice

    2001-01-01

    The existing activities of the Department of Life Sciences have grown out of the specific know-how and the unique experimental possibilities available at PSI. Primarily, these have been and are complex facilities for using particle beams (protons, neutrons) on the one hand and know-how in the production, handling and chemistry of radionuclides on the other. The common theme of the department has thus been the study and use of various types of radiation in therapy and diagnostics of human disease and in particular of cancer. The four units active in this area are: The major activity in the Radiation Medicine unit is Proton Therapy, which aims to further develop and optimise the world-wide unique spot scanning facility for irradiating malignant tumours with minimal damage to surrounding healthy tissues, including the established OPTIS program for the treatment of eye tumours. The Centre for Radiopharmaceutical Science represents a joint activity of PSI with the Swiss Federal Institute of Technology (ETHZ) and the University of Zurich. Its major goals are the development of novel tumour targeted radioconjugates for cancer diagnosis and therapy and the production and evaluation of new PET (positron emission tomography) radiotracers for various applications in neuro physiology and drug development. The Institute of Medical Radiobiology analyses questions of the molecular biology of DNA repair. It is a joint activity of PSI and the University of Zurich. The newly established Structural Biology group is still in the build-up phase. A strong in-house research activity in macromolecular crystallography will complement the more user-oriented protein crystallography beam line, which is being built at the Swiss Light Source (SLS). In particular, tumour targeting by molecular vehicles and DNA repair are areas where structural information can provide important insights. Progress in 2000 in these topical areas is described in this report. A list of scientific publications in 2000

  11. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Austrian Centre of Competence for Tribology, Viktor Kaplan-Straße 2, A 2700 Wiener Neustadt, Austria; Institute of Industrial Electronics and Material Science, Vienna University of Technology, A 1040 Vienna, Austria; Institute of Material Science and Testing, Vienna University of Technology, A 1040 Vienna, Austria; Institute ...

  12. Annual report for FY 2010 on the activities of radiation safety in Nuclear Science Research Institute etc. April 1, 2010 - March 31, 2011

    International Nuclear Information System (INIS)

    2012-03-01

    This annual report describes the activities of Radiation Protection Sector in Department of Radiation Protection in Nuclear Science Research Institute, Safety Section in Takasaki Advanced Radiation Research Institute, Safety Section in Kansai Photon Science Institute, Operation Safety Administration Section in Aomori Research and Development Center and Safety Section in Naka Fusion Institute. The activities described are environmental monitoring, radiation protection in workplaces, individual monitoring, maintenance of monitoring instruments, and research and development of radiation protection. At these institutes the occupational exposures did not exceed the dose limits. The radioactive gaseous and liquid discharges from the facilities were well below the prescribed limits. The research and development activities obtained certain results in the fields of operational radiation protection technique and the construction of calibration fields for neutron beams. The institutes in Tokai, Takasaki, Aomori and Naka were suffered from the Great East Japan Earthquake and the nuclear power plant accident which followed the earthquake. (author)

  13. Models of Interinstitutional Partnerships between Research Intensive Universities and Minority Serving Institutions (MSI) across the Clinical Translational Science Award (CTSA) Consortium

    Science.gov (United States)

    Fair, Alecia; Norris, Keith; Verbalis, Joseph G.; Poland, Russell; Bernard, Gordon; Stephens, David S.; Dubinett, Steven M.; Imperato‐McGinley, Julianne; Dottin, Robert P.; Pulley, Jill; West, Andrew; Brown, Arleen; Mellman, Thomas A.

    2013-01-01

    Abstract Health disparities are an immense challenge to American society. Clinical and Translational Science Awards (CTSAs) housed within the National Center for Advancing Translational Science (NCATS) are designed to accelerate the translation of experimental findings into clinically meaningful practices and bring new therapies to the doorsteps of all patients. Research Centers at Minority Institutions (RCMI) program at the National Institute on Minority Health and Health Disparities (NIMHD) are designed to build capacity for biomedical research and training at minority serving institutions. The CTSA created a mechanism fostering formal collaborations between research intensive universities and minority serving institutions (MSI) supported by the RCMI program. These consortium‐level collaborations activate unique translational research approaches to reduce health disparities with credence to each academic institutions history and unique characteristics. Five formal partnerships between research intensive universities and MSI have formed as a result of the CTSA and RCMI programs. These partnerships present a multifocal approach; shifting cultural change and consciousness toward addressing health disparities, and training the next generation of minority scientists. This collaborative model is based on the respective strengths and contributions of the partnering institutions, allowing bidirectional interchange and leveraging NIH and institutional investments providing measurable benchmarks toward the elimination of health disparities. PMID:24119157

  14. SSI and the Environmental Code; SSI och miljoebalken - utvaerdering av raettsliga konsekvenser

    Energy Technology Data Exchange (ETDEWEB)

    Loefgren, T

    1997-12-01

    Radiation is, to some extent, included in the environmental code being prepared by the government. As a consequence both the Radiation Protection Institute and the proposed Environmental Court may set legal conditions concerning radiation protection for the proponent. Legal and other matters related to this issue are discussed in the report.

  15. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Santanu Bhattacharya1 Raghavan Varadarajan2. Department of Organic Chemistry, Indian Institute of Science, Bangalore 560 012; Molecular Biophysics Unit, Indian Institute of Science, Bangalore 560 012 ...

  16. 6-33 Optimization of ARP System in Institute of Modern Physics, Chinese Academy of Sciences

    Institute of Scientific and Technical Information of China (English)

    Wang; Yongping[1; Gou; Shizhe[1; Yuan; Chao[1; Yue; Min[1; Ma; Yuan[1

    2015-01-01

    The Academia Resource Planning (hereafter abbreviated as ARP) of the Institute of Modern Physics (IMP), Chinese Academy of Sciences (CAS) was launched in 2005. It is an important scientific research management system of CAS. In order to meet the multiple dimensions and levels application requirements, the second phase of ARP has gradually formed ten management systems, two application platforms and four application projects.

  17. Academic health sciences librarians' contributions to institutional animal care and use committees.

    Science.gov (United States)

    Steelman, Susan C; Thomas, Sheila L

    2014-07-01

    The study gathered data about librarians' membership in institutional animal care and use committees (IACUCs) and their professional activities supporting animal researchers. Libraries affiliated with medical schools that were members of the Association of American Medical Colleges were surveyed. A survey was distributed via library directors' email discussion lists and direct email messages. Sixty surveys were completed: 35 (58%) reported that librarians performed database searches for researchers, and 22 (37%) reported that a librarian currently serves on the IACUC. The survey suggests that academic health sciences librarians provide valuable, yet underutilized, services to support animal research investigators.

  18. Institutional transformation: An analysis of change initiatives at NSF ADVANCE institutions

    Science.gov (United States)

    Plummer, Ellen W.

    The purpose of this study was to examine how institutional culture promoted or impeded the implementation of round one and two NSF ADVANCE initiatives designed to improve academic climates for women in science and engineering. This study was conducted in two phases. In phase one, 35 participants from 18 institutions were interviewed to answer three research questions. Participants identified a policy, process, or program designed to improve academic cultures for women in science and engineering fields. Participants also identified strategies that promoted the implementation of these efforts, and discussed factors that impeded these efforts. In phase two, site visits were conducted at two institutions to answer a fourth research question. How did institutional culture shape the design and implementation of faculty search processes? Policies, processes, and programs were implemented by participants at the institutional, departmental, and individual levels and included family friendly and dual career policies at the institutional level, improved departmental faculty search and climate improvement processes, and mentoring programs and training for department heads at the individual level. Communication and leadership strategies were key to the successful implementation of policies, processes, and programs designed to achieve institutional transformation. Communication strategies involved shaping change messages to reach varied audiences often with the argument that change efforts would improve the climate for everyone not just women faculty members. Administrative and faculty leaders from multiple levels proved important to change efforts. Institutional Transformation Institutional culture shaped initiatives to improve faculty search processes. Faculty leaders in both settings used data to persuade faculty members of the need for change. At one site, data that included national availability information was critical to advancing the change agenda. At the other site

  19. Preventing surgical site infection. Where now?

    LENUS (Irish Health Repository)

    Humphreys, H

    2009-12-01

    Surgical site infection (SSI) is increasingly recognised as a measure of the quality of patient care by surgeons, infection control practitioners, health planners and the public. There is increasing pressure to compare SSI rates between surgeons, institutions and countries. For this to be meaningful, data must be standardised and must include post-discharge surveillance (PDS) as many superficial SSIs do not present to the original institution. Further work is required to determine the best method of conducting PDS. In 2008 two important documents on SSI were published from the Society for Healthcare Epidemiology of America\\/The Infectious Disease Society of America and the National Institute for Health and Clincal Excellence, UK. Both emphasise key aspects during the preoperative, operative and postoperative phases of patient care. In addition to effective interventions known to be important for some time, e.g. not shaving the surgical site until the day of the procedure, there is increasing emphasis on physiological parameters, e.g. blood glucose concentrations, oxygen tensions and body temperature. Laparoscopic procedures are increasingly associated with reduced SSI rates, and the screening and decontamination of meticillin-resistant Staphylococcus aureus carriers is effective for certain surgical procedures but has to be balanced by cost and the risk of mupirocin resistance. Finally, there is a need to convert theory into practice by the rigorous application of SSI healthcare bundles. Recent studies suggest that, with a multidisciplinary approach, simple measures can be effective in reducing SSI rates.

  20. Forensic Science Research and Development at the National Institute of Justice: Opportunities in Applied Physics

    Science.gov (United States)

    Dutton, Gregory

    Forensic science is a collection of applied disciplines that draws from all branches of science. A key question in forensic analysis is: to what degree do a piece of evidence and a known reference sample share characteristics? Quantification of similarity, estimation of uncertainty, and determination of relevant population statistics are of current concern. A 2016 PCAST report questioned the foundational validity and the validity in practice of several forensic disciplines, including latent fingerprints, firearms comparisons and DNA mixture interpretation. One recommendation was the advancement of objective, automated comparison methods based on image analysis and machine learning. These concerns parallel the National Institute of Justice's ongoing R&D investments in applied chemistry, biology and physics. NIJ maintains a funding program spanning fundamental research with potential for forensic application to the validation of novel instruments and methods. Since 2009, NIJ has funded over 179M in external research to support the advancement of accuracy, validity and efficiency in the forensic sciences. An overview of NIJ's programs will be presented, with examples of relevant projects from fluid dynamics, 3D imaging, acoustics, and materials science.

  1. Joint SKI and SSI review of SKB preliminary safety assessment of repository for long-lived low- and intermediate-level waste. Review report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-03-01

    SKI and SSI find that SKB's first proper safety assessment of the SFL 3-5 repositories provides a valuable springboard for continued efforts in this field. Even though the safety assessment is relatively limited in scope, it has numerous merits. The specific problems associated with the chosen repository concept for SFL 3-5 are discussed in a generally transparent manner. On the other hand, the authorities consider that SKB have only partly achieved the expressed goal of studying the significance of the current repository design and the choice of site. The greatest deficiency consists in that neither internal disturbances (such as considerable cracking or degradation of concrete structures) nor external disturbances (such as the effects of climate changes and glaciation) have been addressed in a thorough manner. A coherent report justifying the design choice from a long-term safety perspective is, in large part, not found here. SKI and SSI recommend that SKB provide a comparison with other possible SFL 3-5 repository designs. Depending upon, among other factors, what geospheric and biospheric conditions are assumed, SKB have shown that the calculated dose values could be relatively high for certain cases. More realistic assessments would be needed to draw reasonable comparisons between different sites, and to evaluate the importance of different nuclides in different contexts. Our review of SKBs preliminary safety assessment indicates that a great deal of research and development work remains to be done before the level of knowledge in this field is comparable with that associated with the final repository for spent fuel. This is reflected with unanimity in the international expert committee's review, and in the consultants' reviews. SKI and SSI wish to point out in particular the fact that comparison with SFR is of limited value, since the safety associated with SFL 3- 5 must be assessed on a much longer time scale. SKI and SSI find it remarkable

  2. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... 835 215, India. Centre for Atmospheric and Oceanic Sciences, Indian Institute of Science, Bangalore 560 012, India. Divecha Centre for Climate Change, Indian Institute of Science, Bangalore 560 012, India. Laboratoire Image Ville Environnement, UMR 7362CNRS/UDS, 3, rue de l'Argonne, 67000 Strasbourg, France.

  3. Organizational and training factors that promote team science: A qualitative analysis and application of theory to the National Institutes of Health's BIRCWH career development program.

    Science.gov (United States)

    Guise, Jeanne-Marie; Winter, Susan; Fiore, Stephen M; Regensteiner, Judith G; Nagel, Joan

    2017-04-01

    Research organizations face challenges in creating infrastructures that cultivates and sustains interdisciplinary team science. The objective of this paper is to identify structural elements of organizations and training that promote team science. We qualitatively analyzed the National Institutes of Health's Building Interdisciplinary Research Careers in Women's Health, K12 using organizational psychology and team science theories to identify organizational design factors for successful team science and training. Seven key design elements support team science: (1) semiformal meta-organizational structure, (2) shared context and goals, (3) formal evaluation processes, (4) meetings to promote communication, (5) role clarity in mentoring, (6) building interpersonal competencies among faculty and trainees, and (7) designing promotion and tenure and other organizational processes to support interdisciplinary team science. This application of theory to a long-standing and successful program provides important foundational elements for programs and institutions to consider in promoting team science.

  4. The report of joint research over 20 years of the Bulgarian Academy of Sciences and Hiroshima Institute of Technology

    OpenAIRE

    Tanaka,Takeshi; Vutova,Katia

    2014-01-01

    The Department of Electronics and Computer Engineering, Hiroshima Institute of Technology (EC-HIT) started the international joint research with the Laboratory “Physical Problems of Electron Beam technologies” of the Institute of Electronics, Bulgarian Academy of Sciences (IE-BAS) from 1994. 20 papers, included a book chapter, were published by implementing the international joint research under 5 Agreements for Academic Cooperation and Exchange between HIT and IEBAS. Our international joint ...

  5. Socioscientific Issues and Multidisciplinarity in School Science Textbooks

    Science.gov (United States)

    Morris, Helen

    2014-05-01

    The inclusion of socioscientific issues (SSIs) in the science curriculum is a well-established trend internationally. Apart from claims about its innate value, one of the rationales for this approach is its potential for helping to counter declining interest and participation. SSIs involve the use of science and are of interest to society, also raising ethical and moral dilemmas. Introducing such problems presents a significant and usually cross-disciplinary challenge to curriculum developers and teachers. The aim of this paper is to examine how this challenge has been met when judged against contemporary views of the issues concerned. It first explores how SSIs have been interpreted in an important and innovative science course for students aged 14-16 in England, entitled Twenty First Century Science. This paper analyses the Twenty First Century Science textbooks, focusing in detail on two SSIs, reproductive genetic technology and climate change. For each of these issues, the key ideas present in the social science literature surrounding the problems are outlined. This review is then used as an analytical framework to examine how the issues are presented in the textbooks. It is argued in this paper that the perspectives the textbooks take on these issues largely do not include perspectives from social science disciplines. It goes on to suggest that the development of future SSI-based curricula needs to take account of these wider, often interdisciplinary, perspectives.

  6. The Institute for Mining Science I at the Rhineland-Westphalia Technological University in Aachen; Das Institut fuer Bergbaukunde I der RWTH Aachen

    Energy Technology Data Exchange (ETDEWEB)

    Martens, P.N.; Moellerherm, S.; Rattmann, L. [Technische Hochschule Aachen (Germany). Lehrstuhl und Inst. fuer Bergbaukunde 1

    2001-02-08

    The Institute for Mining Science I has been associated with the extraction of raw materials for over one hundred years. The main areas of work of the Institute have always been adapted to current requirements according to general developments in the raw materials sector and in this environment. The work in research and teaching has recently been extended by new fields. Today mining and sustained handling of resources, geotechnics, raw material management and underground disposal of waste are examples of parts of a comprehensive range of competences. The close interlinking of theory and practice allows students to broaden their knowledge in interdisciplinary and international projects. The graduates are thus prepared in an excellent manner for their future tasks. (orig.) [German] Seit ueber hundert Jahren steht das Institut fuer Bergbaukunde I fuer Gewinnung von Rohstoffen. Schwerpunkte der Arbeiten des Instituts wurden, allgemeinen Entwicklungen in der Rohstoffbranche und in deren Umfeld entsprechend, stets den aktuellen Erfordernissen angepasst. Die Arbeit in Forschung und Lehre ist in den letzten Jahren um neue Bereiche erweitert worden. Heute sind Bergbau und nachhaltiger Umfang mit Ressourcen, Geotechnik, Rohstoffwirtschaft sowie untertaegige Abfallentsorgung als Beispiele fuer Teile eines umfassenden Kompetenzspektrums zu nennen. Die enge Verzahnung von Theorie und Praxis ermoeglicht Studierenden, ihre Kenntnisse fruehzeitig in interdisziplinaeren und internationalen Projekten zu vertiefen. Damit werden die Absolventen auf ihre zukuenftigen Aufgaben in hervorragender Weise vorbereitet. (orig.)

  7. Study of sleep habits and sleep problems among medical students of pravara institute of medical sciences loni, Western maharashtra, India.

    Science.gov (United States)

    Giri, Pa; Baviskar, Mp; Phalke, Db

    2013-01-01

    Good quality sleep and adequate amount of sleep are important in order to have better cognitive performance and avoid health problems and psychiatric disorders. The aim of this study was to describe sleep habits and sleep problems in a population of undergraduates, interns and postgraduate students of Pravara Institute of Medical Sciences (Deemed University), Loni, Maharashtra, India. Sleep habits and problems were investigated using a convenience sample of students from Pravara Institute of Medical Sciences (Deemed University), Loni, Maharashtra, India. The study was carried out during Oct. to Dec. 2011 with population consisted of total 150 medical students. A self-administered questionnaire developed based on Epworth Daytime Sleepiness Scale and Pittsburgh Sleep Quality Index was used. Data was analyzed by using Statistical Package of Social Sciences (SPSS) version 16.0. In this study, out of 150 medical students, 26/150 (17.3%) students had abnormal levels of daytime sleepiness while 20/150 (13.3%) were border line. Sleep quality in females was better than the male. Disorders related to poor sleep qualities are significant problems among medical students in our institution. Caffeine and alcohol ingestion affected sleep and there was high level of daytime sleepiness. Sleep difficulties resulted in irritability and affected lifestyle and interpersonal relationships.

  8. Digital Repository of Research Institutes – RCIN

    Directory of Open Access Journals (Sweden)

    Kamila Kaczyńska

    2014-03-01

    Full Text Available The paper describes the project of Digital Repository of Scientific Institutes RCIN and presents opportunities for promoting science by digitization and sharing them on the Internet. The Repository has been created by the 16 Scientific Institutes in Warsaw, Krakow and Bialowieza to modernize the science-research and IT infrastructure, to increase digital resources of mathematical, technical, natural and medical sciences, and to popularize and promote of Polish science. That dissemination and popularization of science affects its development and competitiveness in the international arena and it allows transfer of research results to the economy. In addition, Institutes of RCIN providing contemporary and archival materials of science, support the intellectual capital of Polish science and raise awareness of professional literature of search on the Internet. Project RCIN is implemented in the years 2010–2014 and financing is provided by the funds of the European Fund of Regional Development.

  9. Soviet scientists in chinese institutes: A historical study of cooperation between the two academies of sciences in 1950s.

    Science.gov (United States)

    Zhang, Jiuchen; Yu, Feklova T

    2018-03-01

    In the 1950s, the Chinese Academy of Sciences (CAS) engaged in close cooperation with the Soviet Academy of Sciences. The CAS sent scientists to the Soviet Academy to work as interns, study for advanced degrees, or engage in academic cooperation, and a large number of Soviet scientists were invited by the various institutes of the CAS to come to China to give lectures, direct research, help make scientific plans, and collaborate. The comprehensive cooperation between the two academies was launched at a time when the CAS institutes were in their embryonic stage, which suggests that the better-established Soviet scientists had the opportunity to play a dominate role. But the reality is not so straightforward. The case studies in this paper suggest that besides the influence of compatible political movements in China and the Soviet Union and bilateral ties between these two nations' scientific institutes, disharmony in actual working relationships prevented Soviet scientists from playing the role they might have envisioned within the CAS institutes. The rapid development of the cooperative relationship in a short span of time, combined with lack of experience on both sides, made for a disharmonious collaboration. Copyright © 2018 Elsevier Ltd. All rights reserved.

  10. Early Surgical Site Infection Following Tissue Expander Breast Reconstruction with or without Acellular Dermal Matrix: National Benchmarking Using National Surgical Quality Improvement Program

    Directory of Open Access Journals (Sweden)

    Sebastian Winocour

    2015-03-01

    Full Text Available BackgroundSurgical site infections (SSIs result in significant patient morbidity following immediate tissue expander breast reconstruction (ITEBR. This study determined a single institution's 30-day SSI rate and benchmarked it against that among national institutions participating in the American College of Surgeons National Surgical Quality Improvement Program (ACS-NSQIP.MethodsWomen who underwent ITEBR with/without acellular dermal matrix (ADM were identified using the ACS-NSQIP database between 2005 and 2011. Patient characteristics associated with the 30-day SSI rate were determined, and differences in rates between our institution and the national database were assessed.Results12,163 patients underwent ITEBR, including 263 at our institution. SSIs occurred in 416 (3.4% patients nationwide excluding our institution, with lower rates observed at our institution (1.9%. Nationwide, SSIs were significantly more common in ITEBR patients with ADM (4.5% compared to non-ADM patients (3.2%, P=0.005, and this trend was observed at our institution (2.1% vs. 1.6%, P=1.00. A multivariable analysis of all institutions identified age ≥50 years (odds ratio [OR], 1.4; confidence interval [CI], 1.1-1.7, body mass index ≥30 kg/m2 vs. 4.25 hours (OR, 1.9; CI, 1.5-2.4 as risk factors for SSIs. Our institutional SSI rate was lower than the nationwide rate (OR, 0.4; CI, 0.2-1.1, although this difference was not statistically significant (P=0.07.ConclusionsThe 30-day SSI rate at our institution in patients who underwent ITEBR was lower than the nation. SSIs occurred more frequently in procedures involving ADM both nationally and at our institution.

  11. Review of SKB's Safety Assessment SR-Can: Contributions in Support of SKI's and SSI's Review by External Consultants

    International Nuclear Information System (INIS)

    2008-03-01

    The Swedish Nuclear Fuel and Waste Management Co (SKB) plans to submit a license application for the construction of a repository for spent nuclear fuel in Sweden 2010. In support of this application SKB will present a safety report, SR-Site, on the repository's long-term safety and radiological consequences. As a preparation for SR-Site, SKB published the preliminary safety assessment SR-Can in November 2006. The purposes were to document a first evaluation of long-term safety for the two candidate sites at Forsmark and Laxemar and to provide feedback to SKB's future programme of work. An important objective of the authorities' review of SR-Can is to provide guidance to SKB on the complete safety reporting for the license application. The authorities have engaged external experts for independent modelling, analysis and review, with the aim to provide a range of expert opinions related to the sufficiency and appropriateness of various aspects of SR-Can. The conclusions and judgments in this report are those of the authors and may not necessarily coincide with those of SKI and SSI. The authorities own review will be published separately (SKI Report 2008:23, SSI Report 2008:04 E). This report compiles contributions from several specific research projects. The separate reviews cover topics regarding the engineered barrier system, the quality assurance, the climate evolution and its effects, and the ecosystems and environmental impacts. All contributions are in English apart from the review concerning ecosystems and environmental impacts, which is presented in Swedish

  12. First 3 years of operation of RIACS (Research Institute for Advanced Computer Science) (1983-1985)

    Science.gov (United States)

    Denning, P. J.

    1986-01-01

    The focus of the Research Institute for Advanced Computer Science (RIACS) is to explore matches between advanced computing architectures and the processes of scientific research. An architecture evaluation of the MIT static dataflow machine, specification of a graphical language for expressing distributed computations, and specification of an expert system for aiding in grid generation for two-dimensional flow problems was initiated. Research projects for 1984 and 1985 are summarized.

  13. Education program at the Massachusetts Institute of Technology research reactor for pre-college science teachers

    International Nuclear Information System (INIS)

    Hopkins, G.R.; Fecych, W.; Harling, O.K.

    1989-01-01

    A Pre-College Science Teacher (PCST) Seminar program has been in place at the Massachusetts Institute of Technology (MIT) Nuclear Reactor Laboratory for 4 yr. The purpose of the PCST program is to educate teachers in nuclear technology and to show teachers, and through them the community, the types of activities performed at research reactors. This paper describes the background, content, and results of the MIT PCST program

  14. SSI sensitivity studies and model improvements for the US NRC Seismic Safety Margins Research Program. Rev. 1

    International Nuclear Information System (INIS)

    Johnson, J.J.; Maslenikov, O.R.; Benda, B.J.

    1984-10-01

    The Seismic Safety Margins Research Program (SSMRP) is a US NRC-funded program conducted by Lawrence Livermore National Laboratory. Its goal is to develop a complete fully coupled analysis procedure for estimating the risk of an earthquake-induced radioactive release from a commercial nuclear power plant. In Phase II of the SSMRP, the methodology was applied to the Zion nuclear power plant. Three topics in the SSI analysis of Zion were investigated and reported here - flexible foundation modeling, structure-to-structure interaction, and basemat uplift. The results of these investigations were incorporated in the SSMRP seismic risk analysis. 14 references, 51 figures, 13 tables

  15. Production technology readiness assessment of surfactant in the research center for Chemistry-Indonesian Institute of Sciences

    Science.gov (United States)

    Setiawan, Arief Ameir Rahman; Sulaswatty, Anny

    2017-11-01

    The common problem faced by the institution working on research, innovation and technology development is lack of quantitative measures to determine the technology readiness of research. No common communication language between R & D Institutions and industry about the level of preparedness of a research resulting a barrier to technology diffusion interaction. This lack of connection between R & D institutes with industry may lead to "sluggishness" occurs in innovating. For such circumstance, assessing technology readiness of research is very important. One of wide spread methods for the assessment is Technology Readiness Level (TRL, also known as Technometer), which is introduced by NASA (National Aeronautics and Space Administration). TRL is a general guide that provides an overview of maturity level of a technology. This study aims to identify and demonstrate the implementation of TRL to assess a number of surfactant researches in the Research Center for Chemistry, Indonesian Institute of Sciences. According to the assessment, it has been obtained the surfactant recommended for further development towards commercialization of R & D results, i.e. Glycerol Mono Stearate (GMS), which has reached the level of TRL 7.

  16. [Analysis on Research Projects Supported by the National Natural Science Foundation of China at the National Institute of Parasitic Diseases during 2003-2013].

    Science.gov (United States)

    Zhou, Xiao-jun; Zheng, Bin; Yi, Feng-yun; Xiong, Yan-hong; Zhang, Min-qi

    2015-04-01

    The data of the National Natural Science Foundation (NSFC) projests obtained by the National Institute of Parasitic Diseases (NIPD), Chinese Center for Disease Control and Prevention (China CDC) during 2003-2013 were collected from internet-based science information system of NSFC, and NSFC search tool of Dingxiang Garden (http://nsfc.biomart.cn/). The number of funded projects, their subject classification and approved amount were analyzed, and compared with the other institutes of China CDC. Furthermore, the rationalization proposals were given in order to enhance the level of foundation management in the future.

  17. Patient Self-Assessment of Surgical Site Infection is Inaccurate.

    Science.gov (United States)

    Richter, Vered; Cohen, Matan J; Benenson, Shmuel; Almogy, Gideon; Brezis, Mayer

    2017-08-01

    Availability of surgical site infection (SSI) surveillance rates challenges clinicians, healthcare administrators and leaders and the public. The purpose of this report is to demonstrate the consequences patient self-assessment strategies have on SSI reporting rates. We performed SSI surveillance among patients undergoing general surgery procedures, including telephone follow-up 30 days after surgery. Additionally we undertook a separate validation study in which we compared patient self-assessments of SSI with surgeon assessment. Finally, we performed a meta-analysis of similar validation studies of patient self-assessment strategies. There were 22/266 in-hospital SSIs diagnosed (8.3%), and additional 16 cases were detected through the 30-day follow-up. In total, the SSI rate was 16.8% (95% CI 10.1-18.5). In the validation survey, we found patient telephone surveillance to have a sensitivity of 66% (95% CI 40-93%) and a specificity of 90% (95% CI 86-94%). The meta-analysis included five additional studies. The overall sensitivity was 83.3% (95% CI 79-88%), and the overall specificity was 97.4% (95% CI 97-98%). Simulation of the meta-analysis results divulged that when the true infection rate is 1%, reported rates would be 4%; a true rate of 50%, the reported rates would be 43%. Patient self-assessment strategies in order to fulfill 30-day SSI surveillance misestimate SSI rates and lead to an erroneous overall appreciation of inter-institutional variation. Self-assessment strategies overestimate SSIs rate of institutions with high-quality performance and underestimate rates of poor performance. We propose such strategies be abandoned. Alternative strategies of patient follow-up strategies should be evaluated in order to provide valid and reliable information regarding institutional performance in preventing patient harm.

  18. "Wow! Look at That!": Discourse as a Means to Improve Teachers' Science Content Learning in Informal Science Institutions

    Science.gov (United States)

    Holliday, Gary M.; Lederman, Judith S.; Lederman, Norman G.

    2014-12-01

    Currently, it is not clear whether professional development staff at Informal Science Institutions (ISIs) are considering the way exhibits contribute to the social aspects of learning as described by the contextual model of learning (CML) (Falk & Dierking in The museum experience. Whalesback, Washington, 1992; Learning from museums: visitor experiences and the making of meaning. Altamira Press, New York, 2000) and recommended in the reform documents (see Cox-Peterson et al. in Journal of Research in Science Teaching 40:200-218, 2003). In order to move beyond only preparing science teachers for field trips, while necessary, it is also important to understand the role exhibits play in influencing teachers' content-related social interactions while engaged in ISI professional development. This study looked at a life science course that was offered at and taught by education staff of a large science and technology museum located in the Midwest, USA. The course was offered to three sections of teachers throughout the school year and met six times for a full day. The courses met approximately once a month from September through the beginning of June and provided 42 contact hours overall. Elementary and middle school teachers ( n = 94) were audio- and videotaped while participating in the content courses and interacting with the museum's exhibits. When considering the two factors within the sociocultural context of CML: within-group sociocultural mediation and facilitated mediation by others, the use of exhibits during both courses generally did not fully take into account these elements. In this study, it seemed that teachers' talk always had a purpose but it is argued that it did not always have a direction or connection to the desired content or exhibit. When freely exploring the museum, teachers often purely reacted to the display itself or the novelty of it. However, when PD staff made explicit connections between exhibits, content, and activities, participants were

  19. The popularization of the nuclear sciences and its impact in the public opinion. Strategies of institutional communication

    International Nuclear Information System (INIS)

    Ortega E, J.M.

    2007-01-01

    A continuous concern that is presented among those responsible for the exercise of the science and the technology in the Westerner entire world is to give to know the chore of their institutions and individuals. As in the case of several Mexican institutions, and particularly of the National Institute of Nuclear Research (ININ), one of their rector axes are to diffuse their achievements among the different social actors. A suitable vehicle to impact positively to the public opinion on the advances and tendencies of the nuclear energy it is the popularization of the science. The purpose of the popularization is to place accessible information in hands of the public and, by this, it requires of the use of talkative techniques derived of the journalism and of the public relationships, mainly, besides a basic knowledge of the scientific activity. In simple terms, it is not possible to achieve a positive image of the incomprehensible thing. By this cause, the correct understanding of the current administration of the nuclear energy represents the success or the failure of a strategy of institutional communication. Additionally, it is necessary a deep knowledge of the public opinion, in order to classify it and to have the option of to diversify the messages, of agreement with the characteristics of each segment of the public. Nevertheless their competition, the scientific popularization is centered in the construction of texts and other talkative tools, for that its acting frequently doesn't reach the effective dissemination of the messages. In this context, the use of a strategy of institutional communication represents the multi-functional option: on one hand and derived of the strategic planning, it will establish objectives, the periods of realization of the actions and the form of evaluating their efficiency; and on the other hand, it will allow the incorporation of creative solutions according with the nature of the origin institution, the space-time conditions

  20. Service Evaluation in a Special Library: Supporting Development Research at the Institute of Social Sciences Library, New Delhi.

    Science.gov (United States)

    Ghosh, Sharmila

    2003-01-01

    Discusses the development of special libraries to meet demands of interdisciplinary information and describes the library at The Institute of Social Sciences, New Delhi (India) which establishes a synergy between research and information derived from research through a computerized information management system. Considers evaluation of special…

  1. [Mycology at the Institute of Microbiology, Russian Academy of Sciences: history and prospects for the future].

    Science.gov (United States)

    Feofilova, E P

    2004-01-01

    This review deals with the historical development of mycology at the Winogradsky Institute of Microbiology (Russian Academy of Sciences). Starting from the works of Academician G.A. Nadson, the review considers from the historical perspective the main achievements of the researchers of the Institute in the field of mycology, including such important subfields as the cytology, genetics, physiology, and biochemistry of mycelial fungi and yeast. The review concerns itself with the major theoretical ideas generated by the team of the Laboratory of Experimental Mycology in the course of their studies of micro- and macromycetes. Special attention is also given to recent developments in biotechnology and medicine, including the development of new drug preparations from biologically active substances of fungi.

  2. Analysis of Surgical Site Infection after Musculoskeletal Tumor Surgery: Risk Assessment Using a New Scoring System

    Directory of Open Access Journals (Sweden)

    Satoshi Nagano

    2014-01-01

    Full Text Available Surgical site infection (SSI has not been extensively studied in musculoskeletal tumors (MST owing to the rarity of the disease. We analyzed incidence and risk factors of SSI in MST. SSI incidence was evaluated in consecutive 457 MST cases (benign, 310 cases and malignant, 147 cases treated at our institution. A detailed analysis of the clinical background of the patients, pre- and postoperative hematological data, and other factors that might be associated with SSI incidence was performed for malignant MST cases. SSI occurred in 0.32% and 12.2% of benign and malignant MST cases, respectively. The duration of the surgery (P=0.0002 and intraoperative blood loss (P=0.0005 was significantly more in the SSI group than in the non-SSI group. We established the musculoskeletal oncological surgery invasiveness (MOSI index by combining 4 risk factors (blood loss, operation duration, preoperative chemotherapy, and the use of artificial materials. The MOSI index (0–4 points score significantly correlated with the risk of SSI, as demonstrated by an SSI incidence of 38.5% in the group with a high score (3-4 points. The MOSI index score and laboratory data at 1 week after surgery could facilitate risk evaluation and prompt diagnosis of SSI.

  3. TOOLS OF KNOWLEDGE DISSEMINATION WITHIN A NATIONAL DEFENSE INSTITUTION FOR INNOVATION, TECHNOLOGY AND SCIENCE

    Directory of Open Access Journals (Sweden)

    Edson Aparecida de Araújo Querido Oliveira

    2006-11-01

    Full Text Available This paper describes and analyzes in a National Defense Institution for Innovation, Technology and Science its tools of knowledge dissemination. The methodology contemplates the period of 2004 and 2005. Qualitative and quantitative information orientate the research in order to understand focal aspects on knowledge dissemination, in comparison with theoretical references of renowned authors and other elaborated research searching for elements to perform an organizational diagnosis, focused on the knowledge dissemination as well as on the forces which promote or obstruct the organizational development. Conclusions are that the tools of knowledge dissemination must suitable to spread the tacit knowledge in such a way as the explicit ones and that, in a National Defense Institution, other important aspects must be considered, a time that, being the spread knowledge of wrong form can, besides bringing damages for the organization, to compromise the national sovereignty.

  4. Liaison activities with the Institute of Physical Chemistry/Russian Academy of Science Fiscal Year 1995

    International Nuclear Information System (INIS)

    Delegard, C.H.

    1995-09-01

    Investigations into the chemistry of alkaline Hanford Site tank waste (TTP RL4-3-20-04) were conducted in Fiscal Year 1995 at Westinghouse Hanford Company under the support of the Efficient Separations and Processing Crosscutting Program (EM-53). The investigation had two main subtasks: liaison with the Institute of Physical Chemistry of the Russian Academy of Science and further laboratory testing of the chemistry of thermal reconstitution of Hanford Site tank waste. Progress, which was achieved in the liaison subtask during Fiscal Year 1995, is summarized as follows: (1) A technical dialogue has been established with Institute scientists. (2) Editing was done on a technical literature review on the chemistry of transuranic elements and technetium in alkaline media written by researchers at the Institute. The report was issued in May 1995 as a Westinghouse Hanford Company document. (3) Four tasks from the Institute were selected for support by the U.S. Department of Energy. Work on three tasks commenced on 1 March 1995; the fourth task commenced on 1 April 1995. (4) Technical information describing the composition of Hanford Site tank waste was supplied to the Institute. (5) A program review of the four tasks was conducted at the Institute during a visit 25 August to 1 September, 1995. A lecture on the origin, composition, and proposed treatment of Hanford Site tank wastes was presented during this visit. Eight additional tasks were proposed by Institute scientists for support in Fiscal Year 1996. (6) A paper was presented at the Fifth International Conference on Radioactive Waste Management and Environmental Remediation (ICEM'95) in Berlin, Germany on 3 to 9 September, 1995 on the solubility of actinides in alkaline media

  5. Risk factors for surgical site infection following nonshunt pediatric neurosurgery: a review of 9296 procedures from a national database and comparison with a single-center experience.

    Science.gov (United States)

    Sherrod, Brandon A; Arynchyna, Anastasia A; Johnston, James M; Rozzelle, Curtis J; Blount, Jeffrey P; Oakes, W Jerry; Rocque, Brandon G

    2017-04-01

    OBJECTIVE Surgical site infection (SSI) following CSF shunt operations has been well studied, yet risk factors for nonshunt pediatric neurosurgery are less well understood. The purpose of this study was to determine SSI rates and risk factors following nonshunt pediatric neurosurgery using a nationwide patient cohort and an institutional data set specifically for better understanding SSI. METHODS The authors reviewed the American College of Surgeons National Surgical Quality Improvement Program-Pediatric (ACS NSQIP-P) database for the years 2012-2014, including all neurosurgical procedures performed on pediatric patients except CSF shunts and hematoma evacuations. SSI included deep (intracranial abscesses, meningitis, osteomyelitis, and ventriculitis) and superficial wound infections. The authors performed univariate analyses of SSI association with procedure, demographic, comorbidity, operative, and hospital variables, with subsequent multivariate logistic regression analysis to determine independent risk factors for SSI within 30 days of the index procedure. A similar analysis was performed using a detailed institutional infection database from Children's of Alabama (COA). RESULTS A total of 9296 nonshunt procedures were identified in NSQIP-P with an overall 30-day SSI rate of 2.7%. The 30-day SSI rate in the COA institutional database was similar (3.3% of 1103 procedures, p = 0.325). Postoperative time to SSI in NSQIP-P and COA was 14.6 ± 6.8 days and 14.8 ± 7.3 days, respectively (mean ± SD). Myelomeningocele (4.3% in NSQIP-P, 6.3% in COA), spine (3.5%, 4.9%), and epilepsy (3.4%, 3.1%) procedure categories had the highest SSI rates by procedure category in both NSQIP-P and COA. Independent SSI risk factors in NSQIP-P included postoperative pneumonia (OR 4.761, 95% CI 1.269-17.857, p = 0.021), immune disease/immunosuppressant use (OR 3.671, 95% CI 1.371-9.827, p = 0.010), cerebral palsy (OR 2.835, 95% CI 1.463-5.494, p = 0.002), emergency operation (OR 1

  6. The National Cancer Institute's Physical Sciences - Oncology Network

    Science.gov (United States)

    Espey, Michael Graham

    In 2009, the NCI launched the Physical Sciences - Oncology Centers (PS-OC) initiative with 12 Centers (U54) funded through 2014. The current phase of the Program includes U54 funded Centers with the added feature of soliciting new Physical Science - Oncology Projects (PS-OP) U01 grant applications through 2017; see NCI PAR-15-021. The PS-OPs, individually and along with other PS-OPs and the Physical Sciences-Oncology Centers (PS-OCs), comprise the Physical Sciences-Oncology Network (PS-ON). The foundation of the Physical Sciences-Oncology initiative is a high-risk, high-reward program that promotes a `physical sciences perspective' of cancer and fosters the convergence of physical science and cancer research by forming transdisciplinary teams of physical scientists (e.g., physicists, mathematicians, chemists, engineers, computer scientists) and cancer researchers (e.g., cancer biologists, oncologists, pathologists) who work closely together to advance our understanding of cancer. The collaborative PS-ON structure catalyzes transformative science through increased exchange of people, ideas, and approaches. PS-ON resources are leveraged to fund Trans-Network pilot projects to enable synergy and cross-testing of experimental and/or theoretical concepts. This session will include a brief PS-ON overview followed by a strategic discussion with the APS community to exchange perspectives on the progression of trans-disciplinary physical sciences in cancer research.

  7. Traveling the road to success: A discourse on persistence throughout the science pipeline with African American students at a predominantly white institution

    Science.gov (United States)

    Russell, Melody L.; Atwater, Mary M.

    2005-08-01

    This study focuses on 11 African American undergraduate seniors in a biology degree program at a predominantly white research institution in the southeastern United States. These 11 respondents shared their journeys throughout the high school and college science pipeline. Participants described similar precollege factors and experiences that contributed to their academic success and persistence at a predominantly white institution. One of the most critical factors in their academic persistence was participation in advanced science and mathematics courses as part of their high school college preparatory program. Additional factors that had a significant impact on their persistence and academic success were family support, teacher encouragement, intrinsic motivation, and perseverance.

  8. Workshop for coordinating South Carolina`s pre-college systemic initiatives

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-26

    The goal of the South Carolina Statewide Systemic Initiative (SC SSI) is to provide quality and effective learning experiences in science and mathematics to all people of South Carolina by affecting systemic change. To accomplish this goal, South Carolina must: (1) coordinate actions among many partners for science and mathematics change; (2) place the instruments of change into the hands of the effectors of change - teachers and schools; and (3) galvanize the support of policy makers, parents, and local communities for change. The SC SSI proposes to establish a network of 13 regional mathematics and science HUBs. The central idea of this plan is the accumulation of Teacher Leaders at each HUB who are prepared in special Curriculum Leadership Institutes to assist other teachers and schools. The HUB becomes a regional nexus for delivering services to schools who request assistance by matching schools with Teacher Leaders. Other initiatives such as the use of new student performance assessments, the integration of instructional technologies into the curriculum, a pilot preservice program, and Family Math and Family Science will be bundled together through the Teacher Leaders in the HUBs. Concurrent policy changes at the state level in teacher and administrator certification and recertification requirements, school regulations and accountability, and the student performance assessment system will enable teachers and schools to support instructional practices that model South Carolina`s new state Curriculum Frameworks in Mathematics and Science.

  9. Annual report of National Institute of Radiological Sciences, April 1984 - March 1985

    International Nuclear Information System (INIS)

    1985-07-01

    This report gives the information on the investigations conducted by the scientific staffs of the institute during this period. The total budget of the NIRS for fiscal year 1984 was about 6.052 billion yen, 21 million yen less than that for the previous year. Some new and important projects as well as the existing commitments were carried out by the prudent allocation of the budget. In addition to basic research, four long term research project were carried out, that is, research on the bilogical effect of tritium, studies on stochastic effects of irradiation and risk estimation, assessment of human exposures to environmental radiation, medical use of accelerated heavy ions. The fourth project has started from 1984 FY, which is based on the results obtained in the former project 'medical application of particle accelerator'. The gists of 11 reports related to physics, 5 reports related to chemistry, 7 reports related to biochemistry and biophysics, 9 reports related to cell biology, 11 reports related to immunology and hematology, 9 reports related to pathology, 10 reports related to genetics, 12 reports related to clinical science, and 15 reports related to environmental science are collected. (J.P.N.)

  10. Annual report of National Institute of Radiological Sciences, April, 1983 - March, 1984

    International Nuclear Information System (INIS)

    1984-10-01

    This report gives the information on the investigations conducted by the scientific staffs of the institute during this period. The total budget of the NIRS for fiscal year 1983 was about 5.835 billion yen, 15 million yen less than that for the previous year. Some new and important projects as well as the existing commitments were carried out by the prudent allocation of the budget. Four long term research projects were carried out, that is, research on the biological effect of tritium, medical application of particle accelerators, studies on the stochastic effect of irradiation and its risk estimation, and assessment of the exposure to environmental radiation of men, in addition to basic research. The second project was completed in fiscal year 1983, and the latter two projects began as five-year projects. The gists of 9 reports related to physics, 6 reports related to chemistry, 8 reports related to biochemistry and biophysics, 8 reports related to cell biology, 10 reports related to immunology and hematology, 10 reports related to physiology and pathology, 11 reports related to genetics, 10 reports related to clinical science, and 19 reports related to environmental science are collected. (Kako, I.)

  11. 78 FR 32527 - Agency Information Collection Activities: Proposed Request and Comment Request

    Science.gov (United States)

    2013-05-30

    ... Supplemental Security Income (SSI) Reduced Benefit Rate for Individuals Residing in Medical Treatment... provision making it necessary for SSA to collect information about SSI recipients who enter or leave a medical treatment facility or other public or private institution. SSA's regulation 20 CFR 416.708(k...

  12. Dagik Earth: A Digital Globe Project for Classrooms, Science Museums, and Research Institutes

    Science.gov (United States)

    Saito, A.; Tsugawa, T.

    2017-12-01

    Digital globe system is a powerful tool to make the audiences understand phenomena on the Earth and planets in intuitive way. Geo-cosmos of Miraikan, Japan uses 6-m spherical LED, and is one of the largest systems of digital globe. Science on a Sphere (SOS) by NOAA is a digital globe system that is most widely used in science museums around the world. These systems are so expensive that the usage of the digital globes is mainly limited to large-scale science museums. Dagik Earth is a digital globe project that promotes educational programs using digital globe with low cost. It aims to be used especially in classrooms. The cost for the digital globe of Dagik Earth is from several US dollars if PC and PC projector are available. It uses white spheres, such as balloons and balance balls, as the screen. The software is provided by the project with free of charge for the educational usage. The software runs on devices of Windows, Mac and iOS. There are English and Chinese language versions of the PC software besides Japanese version. The number of the registered users of Dagik Earth is about 1,400 in Japan. About 60% of them belongs to schools, 30% to universities and research institutes, and 8% to science museums. In schools, it is used in classes by teachers, and science activities by students. Several teachers have used the system for five years and more. In a students' activity, Dagik Earth contents on the typhoon, solar eclipse, and satellite launch were created and presented in a school festival. This is a good example of the usage of Dagik Earth for STEM education. In the presentation, the system and activity of Dagik Earth will be presented, and the future expansion of the project will be discussed.

  13. Students' Environmental NOS Views, Compassion, Intent, and Action: Impact of Place-Based Socioscientific Issues Instruction

    Science.gov (United States)

    Herman, Benjamin C.

    2018-01-01

    Preparing students to achieve the lofty goal of functional scientific literacy entails addressing the normative and non-normative facets of socioscientific issues (SSI) such as scientific processes, the nature of science (NOS) and diverse sociocultural perspectives. SSI instructional approaches have demonstrated some efficacy for promoting…

  14. Can Science Feed on a Crisis? Expectations, the Pine Institute, and the Decline of the French Resin Industry.

    Science.gov (United States)

    Krasnodębski, Marcin

    2017-03-01

    Argument While science and economy are undoubtedly interwoven, the nature of their relationship is often reduced to a positive correlation between economic and scientific prosperity. It seems that the modern scholarship focusing on "success stories" tends to neglect counterintuitive examples such as the impact of economic crises on research. We argue that economic difficulties, under certain circumstances, may also lead to the prosperous development of scientific institutions. This paper focuses on a particular organism, the Pine Institute in Bordeaux in France. Not only was it a key actor in the process of defining the discipline of resin chemistry, but also it remained for years at the heart of the local resin producing industry. Interestingly, there is an actual inverse correlation between the Institute's budgets and the prices and production of resinous products. The Pine Institute's existence seemed to have been driven by the crisis of the resin industry.

  15. Recent improvement in organization and in tutorial practices in the National Institute of Nuclear Sciences and Techniques

    International Nuclear Information System (INIS)

    Maziere, D.

    2002-01-01

    The National Institute of Nuclear Sciences and Techniques has recently improved its organization and its tutorial practices to increase efficiency of training. It obtained in 2001 an ISO 9001 certification aiming at a better satisfaction of customers. Moreover, external contributors and INSTN people in charge of pedagogy are strongly encouraged to vary tutorial methods and are proposed to be trained for these new teaching techniques. For next years, trends are not missing to increase efficiency: a better listening to the customers, block-release training, e-learning, increasing European commitments. Nevertheless relevant evaluation of efficiency remains the unresolved issue and this could never be done by the training institution alone. (author)

  16. JPRS Report, Science & Technology, USSR: Science & Technology Policy

    Science.gov (United States)

    1988-09-23

    Krasnoyarsk Science Center and about its institute’s developments, and in particular about reversable magneto -optic discs created in the Institute of...for beam therapy , a prize in the amount of 10,000 rubles. 12. Doctor of Technical Sciences N.A. Iofis, chief of a laboratory of a design bureau, A.S

  17. Annual report of National Institute of Radiological Sciences of the fiscal year 1990

    International Nuclear Information System (INIS)

    1992-01-01

    This annual report presents the activities of the National Institute of Radiological Sciences in Japan in the fiscal year 1990. The activities are divided into research, technical aids, training, medical services, management affairs at the Nakaminato Laboratory Branch Office, library or editing, international cooperation, and general affairs. Research activities are described under the following sections: (1) special researches covering 'biological risk evaluation in public exposure' and 'exposure assessment in the environment and the public involved in food chain', 'medical use of accelerated heavy ions', and 'survey for the demonstration of dose-response relationships in low dose irradiation'; (2) five assigned researches; (3) ordinary researches concerning physics, pharmacochemistry, biology, genetics, pathology and physiology, cell biology, internal exposure, envionmental science, clinical research, clinical research for radiation injuries, medical use of heavy particles, environmental radiation ecology, and aquatic radiation ecology; (4) risk estimation of radiation; (5) survey for radiation response phenomena in fish and in immunity associated with low dose irradiation; (6) actual surveys for Bikini victims, population doses of medical and occupational exposure, and thorotrast exposure; (7) project research; (8) integrated atomic energy-based technological research; (9) radioactivity survey; (10) research supported by Science and Technology Agency aids; (11) International research cooperation; (12) government-private joint cooperative study. Appendices include the personnel list and the bibliography of articles reported by the staff. (N.K.) 870 refs

  18. Booklet of the Research Institute of Clinical Medicine

    International Nuclear Information System (INIS)

    Todua, F.; Jgamadze, N.; Todua, N.; Beriashvili, Z.; Chelishvili, M.; Todua, I.; Chovelidze, Sh. et al.

    2012-01-01

    Research Institute of Clinical Medicine is one of the biggest university diagnostic and treatment centre in Georgia with unique modern diagnostic and treatment apparatus. The institute is acknowledged as a leader in various trends of radiology and surgery. The Research Institute of Clinical Medicine was founded in 1991. It is the leading scientific establishment in the field of medicine. The scientific-research work of the Institute is coordinated by the National Academy of Sciences of Georgia. The main scientific trend of the Institute is the Early Complex Diagnostics and Treatment. The scientific activity of the Institute is led by the Scientific Council. Institute achieved remarkable success since its foundation: It has been defended 56 theses for Candidate of Medical Sciences and 16 for Doctor of Medical Sciences; About 30 post-graduate students and more than 200 radiologists have taken training courses in radiology. Nowadays they work in different regions of Georgia, 21 inventions took out patents. It has been published 2000 scientific works and 9 monographs. (authors)

  19. New associates | Announcements | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Translational Health Science and Technology Institute, Faridabad. Praveen Kumar Indian Institute of Science, Bengaluru. S Mishra Sabyashachi Mishra Indian Institute of Technology, Kharagpur. Jagannath Mondal TIFR Centre for Interdisciplinary Sciences, Hyderabad. Samrat Mondal Wildlife Institute of India, Dehradun.

  20. Business plan of the National Institute of Radiological Sciences for fiscal 1985

    International Nuclear Information System (INIS)

    1985-01-01

    Based on the long-term plan of research, development and utilization of nuclear power of the Japan Atomic Energy Commission and mother plans of the National Institute of Radiological Sciences, this business plan of the Institute is made for FY 1985. In the Research Division, following four special researches are emphasized to be carried out as well as conceptual design studies on heavy ion accelerator for a medical use : biological effect of tritium due to the utilization of nuclear fusion reactor, comprehensive studies on stochastic effect and risk of radiation, dose assessment of environmental radiation, and medical application of heavy particle beams. Researches are also to be carried out on specified subjects and general subjects. As for the Technical Assistance Division, suitable utilization of cooperative experimental facilities and equipments, and the cyclotron for a medical use is to be promoted together with renewal of a computer. Training of personnels for radiation protection and radiation use is carried out by the Education and Training Division. Hospital Division promotes medical treatment and emergency countermeasures on radiation injury. For the Administrative Division, efforts are to be carried out especially on improvement and reinforcement of properties of the Institute and on the cooperation with international or domestic organizations. Budget for these activities is 724,061 yen thousand for special and general researches, 1,666,950 yen thousand for the technical assistance, 9,158 yen thousand for the training and education, and 290,157 yen thousand for the management of the hospital. (Takagi, S.)

  1. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    In this study we observe wave heights by an array of four wave gauges at the Hiratsuka Tower of (Independent Administrative Institution) National Research Institute for Earth Science and ... Center for Atmospheric and Oceanic Studies, Graduate School of Science, Tohoku University, Aoba, Sendai 980-8578, Japan.

  2. Speaking Up For Science

    Science.gov (United States)

    Spilhaus, Fred

    2005-06-01

    The Smithsonian Institution's National Museum of Natural History in Washington D.C. is planning to show a film, "A Privileged Planet" that promotes creationism in the form of "intelligent design." The film is based on the book by Guillermo Gonzalez and Jay Wesley Richards, both affiliated with the Discovery Institute, which advocates teaching "intelligent design" as science in U.S. public schools. By associating with the Discovery Institute, the Smithsonian Institution will associate science with creationism and damage their credibility. The film is slated for airing on 23 June, unless the Smithsonian comes to its senses.Why is this important? Because the film promotes a long term strategy of the Discovery Institute (//www.discovery.org/csc/) to replace "materialistic science" with "intelligent design." The film fosters the idea that science should include the supernatural. This is unacceptable. AGU's position is clear, creationism is not science and AGU opposes all efforts to promote creationism as science, (The full text of the AGU position statement can be found at: //www.agu.org/sci_soc/policy/positions/evolution.shtml).

  3. Improving science literacy and education through space life sciences

    Science.gov (United States)

    MacLeish, M. Y.; Moreno, N. P.; Tharp, B. Z.; Denton, J. J.; Jessup, G.; Clipper, M. C.

    2001-01-01

    The National Space Biomedical Research Institute (NSBRI) encourages open involvement by scientists and the public at large in the Institute's activities. Through its Education and Public Outreach Program, the Institute is supporting national efforts to improve Kindergarten through grade twelve (K-12) and undergraduate education and to communicate knowledge generated by space life science research to lay audiences. Three academic institution Baylor College of Medicine, Morehouse School of Medicine and Texas A&M University are designing, producing, field-testing, and disseminating a comprehensive array of programs and products to achieve this goal. The objectives of the NSBRI Education and Public Outreach program are to: promote systemic change in elementary and secondary science education; attract undergraduate students--especially those from underrepresented groups--to careers in space life sciences, engineering and technology-based fields; increase scientific literacy; and to develop public and private sector partnerships that enhance and expand NSBRI efforts to reach students and families. c 2001. Elsevier Science Ltd. All rights reserved.

  4. Body talk: students' identity construction while discussing a socioscientific issue

    Science.gov (United States)

    Ideland, Malin; Malmberg, Claes

    2012-06-01

    Vision II school science is often stated to be a democratic and inclusive form of science education. But what characterizes the subject who fits into the Vision II school science? Who is the desirable student and who is constructed as ill-fitting? This article explores discourses that structure the Vision II science classroom, and how different students construct their identities inside these discourses. In the article we consider school science as an order of discourses which restricts and enables what is possible to think and say and what subject-positions those are available and non-available. The results show that students' talk about a SSI about body and health is constituted by several discourses. We have analyzed how school science discourse, body discourse and general school discourse are structuring the discussions. But these discourses are used in different ways depending on how the students construct their identities in relation to available subject positions, which are dependent on how students at the same time are "doing" gender and social class. As an example, middle class girls show resistance against SSI-work since the practice is threatening their identity as "successful students". This article uses a sociopolitical perspective in its discussions on inclusion and exclusion in the practice of Vision II. It raises critical issues about the inherited complexity of SSI with meetings and/or collisions between discourses. Even if the empirical results from this qualitative study are situated in specific cultural contexts, they contribute with new questions to ask concerning SSI and Vision II school science.

  5. SMART social science? Examining the nature and role of social scientific expertise in institutional design

    Directory of Open Access Journals (Sweden)

    Morgan C. Tait

    2016-06-01

    Full Text Available Daniel Bromley argues against Oran Young's FIT model as a basis for environmental governance, on the grounds that humans cannot manage nature and that attempts to do so are based on a scientistic, modernist conceit. At issue is the role of natural and social scientists in adjudicating questions about what we ought to do to close governance gaps and address unsustainable behaviors. If Bromley is right, then the lessons of the American pragmatist tradition recommend against attempts to "fit" social institutions to the natural world. The first objective of this paper is to argue that Bromley's view is not in keeping with the pragmatism of C. S. Peirce and John Dewey, which actually places a high value on natural and social scientific modes of inquiry in the service of social ends. I argue that Young's proposal is in fact a development of the pragmatist idea that social institutions must be fit in the sense of fitness, i.e., resilient and able to navigate uncertainty. Social institutions must also evolve to accommodate the emerging values of the agents who operate within them. The second objective of this paper is to examine the role of social science expertise in the design of social policies. Governance institutions typically rely on the testimony of natural scientists, at least in part, to understand the natural systems they operate within. However, natural systems are also social systems, so it seems pertinent to ask whether there is a role for social systems experts to play in helping to design environmental governance institutions. I argue that social scientists can make a unique contribution as experts on social institutions, and as such, are necessary to bring about a transformation of the unsustainable institutions that are preventing us from achieving stated sustainable development goals.

  6. Science and the applications of science from Louis Pasteur to Jacques Monod.

    Science.gov (United States)

    Schwartz, Maxime

    2015-06-01

    Jacques Monod's ideas on the applications of science came within the scope of a long tradition at the Institut Pasteur. Louis Pasteur, whose scientific career was characterized by a permanent come and go between science and its applications, long opposed the idea of getting any income from his research, until the financial needs of the Institut Pasteur made him change his mind. As for Jacques Monod, he remained a fervent supporter of basic science during his whole scientific career. However, once he became director of the Institut Pasteur, he realized that the applications of research had to be developed to support the institute from a financial point of view. Thus, he reorganized the valorization of research in the institute, through an incitation of scientists to develop projects with possible applications, and by creating a company, Institut Pasteur Production, for which he had a factory built, and which was in charge of producing and commercializing the vaccines and reagents stemming from the research at the Institut Pasteur. Copyright © 2015 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  7. The 45th anniversary of the Institute of Spectroscopy of the Russian Academy of Sciences (Scientific session of the Physical Sciences Division of the Russian Academy of Sciences, 23 October 2013)

    International Nuclear Information System (INIS)

    2014-01-01

    On 23 October 2013, the out-of-town scientific session of the Physical Sciences Division of the Russian Academy of Sciences (RAS), celebrating the 45th anniversary of the Institute of Spectroscopy, RAS (ISAN in Russ. abbr.), was held at the conference hall of the Institute's building in Troitsk. The agenda of the session, announced on the website http://www.gpad.ac.ru of the Physical Sciences Division, RAS, listed the following reports: (1) Vinogradov E A (ISAN, Troitsk, Moscow) T he main achievements of ISAN from 2009 to 2013 ; (2) Balykin V I (ISAN, Troitsk, Moscow) A tomic and photonic nanooptics ; (3) Lozovik Yu E (ISAN, Troitsk, Moscow) E lectronic and collective properties of topological isolators ; (4) Yevdokimov Yu M (Engelgard Institute of Molecular Biology, RAS, Moscow), Kompanets O N (ISAN, Troitsk, Moscow) S tructural nanotechnology of DNA (liquid-crystal approach) and its applications ; (5) Chekalin S V (ISAN, Troitsk, Moscow) F emtosecond spectroscopy of promising materials . Papers written on the basis of oral reports 1, 2, 4, and 5 are published below. • Near field phonon-polariton spectroscopy as a method for studying the optical properties of nanofilms, E A Vinogradov, N N Novikova, V A Yakovlev Physics-Uspekhi, 2014, Volume 57, Number 6, Pages 604–607 • Quantum control of atoms and photons by optical nanofibers, V I Balykin Physics-Uspekhi, 2014, Volume 57, Number 6, Pages 607–615 • Structural nucleic acid nanotechnology: liquid-crystalline approach, Yu M Yevdokimov, O N Kompanets Physics-Uspekhi, 2014, Volume 57, Number 6, Pages 615–621 • Femtosecond spectroscopy of promising materials, S V Chekalin Physics-Uspekhi, 2014, Volume 57, Number 6, Pages 622–629 (conferences and symposia)

  8. CSIR-National Institute of Oceanography

    Digital Repository Service at National Institute of Oceanography (India)

    Tapaswi, M.P.

    CSIR-National Institute of Oceanography being one of its kind in the country The article describes the on-going researches and projects in contributing to the science in the field of Marine science....

  9. SSI and SKI's Review of SKB's Updated Final Safety Report for SFR 1. Review Report

    International Nuclear Information System (INIS)

    2003-10-01

    The Repository for Radioactive Operational Waste (SFR 1) is now the object of a new review by the Swedish Radiation Protection Authority (SSI) and the Swedish Nuclear Power Inspectorate (SKI). One of the stipulations for operating SFR 1 was that a new assessment of the long-term performance and environmental consequences of the repository should be conducted once every 10 years by the licensee, the Swedish Nuclear Fuel and Waste Management Co (SKB). During the time that SFR 1 has been in operation, experience has been gained of operating the facility and new knowledge of long-term performance of SFR 1 has been obtained. New regulations for nuclear facilities have been promulgated since SFR 1 was taken into operation (1988). A review committee comprising employees from SKI and SSI has conducted the review of SSR 2001. This review report has resulted in the committee's evaluation of the safety of SFR 1 and is the basis of the regulatory authorities' decision concerning any amendments to the stipulations for the operation of SFR 1. However, the review has found deficiencies in the follow up of the development of design basis norms since the facility was constructed as well as deficiencies in learning from operating experience. However, the overall evaluation is that the facility is being operated in an acceptable manner from the standpoint of safety. With respect to the long-term performance of the repository, it is a deficiency that SSR 2001 does not describe how compliance with the stipulated radiation protection requirements on optimisation and use of the best available technology (BAT) is achieved during operation. In the opinion of the review committee, issues relating to occupational radiation protection are being handled satisfactorily and the operational releases of radioactive substances are very small. Safety and Radiation Protection after Closure SKB's long-term repository performance assessment contains essential updates and improvements compared with the

  10. Land burial facility at the Forsmark plant

    International Nuclear Information System (INIS)

    Bergman, C.; Ericsson, G.; Haegg, C.

    1987-01-01

    The report presents the formal background for the handling of the application for permission to build a plant for deposition of radioactive waste on land. The SSI (National Swedish Institute of Radiation Protection), basis for assessment are reported and relevant factors are presented. The radiation doses calculated by the SSI do not exceed a few stray microsievert per annum in spite of very pessimistical assumptions. The report constitutes assessment material for the standpoint to be taken by the SSI board. (L.F.)

  11. Development of nuclear analytical methods at the Helongjiang Institute (PRC) and the Far-Eastern Branch, USSR Academy of Sciences

    International Nuclear Information System (INIS)

    GuoLiang, Wu; Duyuan, Xiao; Haoqing, Peng; Ivanenko, V.V.; Buznik, V.M.

    1992-01-01

    The common character of the problems associated with the use of mineral resources in the northeastern part of the People's Republic of China and in far-eastern Russia has resulted in collaborative development of nuclear-physical analysis methods by the Heilongjiang Academy of Sciences (HAS) and the Far-Eastern Branch Academy of Sciences (HAS) and the Far-Eastern Branch Academy of Sciences (FEBAS) of Russia. A joint Chinese-Soviet Laboratory of nuclear analysis has been established. At the HAS Institute of Physics, a portable analyzer and other products have been developed for use in mineral prospecting and metal identification. The energy resolution for Fe-K line is 61%, and the measuring range covers 0.01 to 100%

  12. Environmental monitoring at the nuclear power plants and Studsvik 1992-1993. Results from measurements of radionuclide contents of environmental samples, and from random checks by SSI

    International Nuclear Information System (INIS)

    Bengtson, P.; Larsson, C.M.; Simenstad, P.; Suomela, J.

    1995-09-01

    Marine samples from the vicinity of the plants show elevated radionuclide concentrations, caused by discharges from the plants. Very low concentrations are noted in terrestrial samples. At several locations, the effects of the Chernobyl disaster still dominates. Control samples measured by SSI have confirmed the measurements performed by the operators. 8 refs, 6 tabs, 46 figs

  13. The P50 Research Center in Perioperative Sciences: How the investment by the National Institute of General Medical Sciences in team science has reduced postburn mortality.

    Science.gov (United States)

    Finnerty, Celeste C; Capek, Karel D; Voigt, Charles; Hundeshagen, Gabriel; Cambiaso-Daniel, Janos; Porter, Craig; Sousse, Linda E; El Ayadi, Amina; Zapata-Sirvent, Ramon; Guillory, Ashley N; Suman, Oscar E; Herndon, David N

    2017-09-01

    Since the inception of the P50 Research Center in Injury and Peri-operative Sciences (RCIPS) funding mechanism, the National Institute of General Medical Sciences has supported a team approach to science. Many advances in critical care, particularly burns, have been driven by RCIPS teams. In fact, burns that were fatal in the early 1970s, prior to the inception of the P50 RCIPS program, are now routinely survived as a result of the P50-funded research. The advances in clinical care that led to the reduction in postburn death were made by optimizing resuscitation, incorporating early excision and grafting, bolstering acute care including support for inhalation injury, modulating the hypermetabolic response, augmenting the immune response, incorporating aerobic exercise, and developing antiscarring strategies. The work of the Burn RCIPS programs advanced our understanding of the pathophysiologic response to burn injury. As a result, the effects of a large burn on all organ systems have been studied, leading to the discovery of persistent dysfunction, elucidation of the underlying molecular mechanisms, and identification of potential therapeutic targets. Survival and subsequent patient satisfaction with quality of life have increased. In this review article, we describe the contributions of the Galveston P50 RCIPS that have changed postburn care and have considerably reduced postburn mortality.

  14. Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97

    Energy Technology Data Exchange (ETDEWEB)

    Hora, Stephen

    2002-09-01

    The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches.

  15. [Spanish adaptation of the Stress Manifestations Scale of the Student Stress Inventory (SSI-SM)].

    Science.gov (United States)

    Escobar Espejo, Milagros; Blanca, María J; Fernández-Baena, F Javier; Trianes Torres, María Victoria

    2011-08-01

    The aim of the present study was to translate into Spanish and to describe the psychometric properties of the Stress Manifestations Scale of the Student Stress Inventory (SSI-SM), developed by Fimian, Fastenau, Tashner and Cross to identify the main manifestations of stress in adolescents. The scale was applied to a sample of 1,002 pupils from years one and two of Secondary Education. The paper reports the factor structure, an item analysis, the internal consistency, differences by sex and academic year, external evidence of validity, and norms for scoring the scale. The results reveal a factor structure based on three first-order factors (emotional manifestations, physiological manifestations and behavioural manifestations) and one second-order factor (indicative of stress manifestations). In terms of external validity, there was a positive association with measures of perceived stress, aggressiveness, internalized/externalized symptoms, and a negative association with life satisfaction. The results show that the scale is an adequate tool for evaluating stress manifestations in adolescents.

  16. Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97

    International Nuclear Information System (INIS)

    Hora, Stephen

    2002-09-01

    The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches

  17. NASA Virtual Institutes: International Bridges for Space Exploration

    Science.gov (United States)

    Schmidt, Gregory K.

    2016-01-01

    NASA created the first virtual institute, the NASA Astrobiology Institute (NAI), in 2009 with an aim toward bringing together geographically disparate and multidisciplinary teams toward the goal of answering broad questions in the then-new discipline of astrobiology. With the success of the virtual institute model, NASA then created the NASA Lunar Science Institute (NLSI) in 2008 to address questions of science and human exploration of the Moon, and then the NASA Aeronautics Research Institute (NARI) in 2012 which addresses key questions in the development of aeronautics technologies. With the broadening of NASA's human exploration targets to include Near Earth Asteroids and the moons of Mars as well as the Moon, the NLSI morphed into the Solar System Exploration Research Virtual Institute (SSERVI) in 2012. SSERVI funds domestic research teams to address broad questions at the intersection of science and human exploration, with the underlying principle that science enables human exploration, and human exploration enables science. Nine domestic teams were funded in 2014 for a five-year period to address a variety of different topics, and nine international partners (with more to come) also work with the U.S. teams on a variety of topics of mutual interest. The result is a robust and productive research infrastructure that is not only scientifically productive but can respond to strategic topics of domestic and international interest, and which develops a new generation of researchers. This is all accomplished with the aid of virtual collaboration technologies which enable scientific research at a distance. The virtual institute model is widely applicable to a range of space science and exploration problems.

  18. The institution of science and the science of institutions the legacy of Joseph Ben-David

    CERN Document Server

    2014-01-01

    The present anthology, edited by Marcel Herbst, is partially based on a conference, held in 2009, to reflect on the legacy of Ben-David, and contains a selection of substantially revised papers, plus four contributions specifically written for this volume. The book focuses on three major lines of Ben-David’s research, namely “Center and Periphery” (Part I), “Role and Ethos” (Part II), and “Organization and Growth” (Part III). In addition, comprehensive introductory (“Prologue”) and concluding chapters (“Epilogue”, Part IV) by Marcel Herbst are provided. The volume addresses the following disciplines: higher education, history and sociology of science, philosophy of science, history of medicine, public administration, policy studies, Jewish studies, and economics. The anthology is one of two new publications on Joseph Ben-David after the special Minerva edition Vol. 25, Numbers 1–2, March 1987, and Gad Freudenthal’s collection of Ben-David’s writings [1991]. The text can be used i...

  19. University Students' Knowledge Structures and Informal Reasoning on the Use of Genetically Modified Foods: Multidimensional Analyses

    Science.gov (United States)

    Wu, Ying-Tien

    2013-10-01

    This study aims to provide insights into the role of learners' knowledge structures about a socio-scientific issue (SSI) in their informal reasoning on the issue. A total of 42 non-science major university students' knowledge structures and informal reasoning were assessed with multidimensional analyses. With both qualitative and quantitative analyses, this study revealed that those students with more extended and better-organized knowledge structures, as well as those who more frequently used higher-order information processing modes, were more oriented towards achieving a higher-level informal reasoning quality. The regression analyses further showed that the "richness" of the students' knowledge structures explained 25 % of the variation in their rebuttal construction, an important indicator of reasoning quality, indicating the significance of the role of students' sophisticated knowledge structure in SSI reasoning. Besides, this study also provides some initial evidence for the significant role of the "core" concept within one's knowledge structure in one's SSI reasoning. The findings in this study suggest that, in SSI-based instruction, science instructors should try to identify students' core concepts within their prior knowledge regarding the SSI, and then they should try to guide students to construct and structure relevant concepts or ideas regarding the SSI based on their core concepts. Thus, students could obtain extended and well-organized knowledge structures, which would then help them achieve better learning transfer in dealing with SSIs.

  20. Lack of Evolution Acceptance Inhibits Students' Negotiation of Biology-Based Socioscientific Issues

    Science.gov (United States)

    Fowler, S. R.; Zeidler, D. L.

    2016-01-01

    The purpose of this study was to explore science content used during college students' negotiation of biology-based socioscientific issues (SSI) and examine how it related to students' conceptual understanding and acceptance of biological evolution. The Socioscientific Issues Questionnaire (SSI-Q) was developed to measure depth of evolutionary…

  1. Socioscientific Issues-Based Instruction: An Investigation of Agriscience Students' Content Knowledge Based on Student Variables

    Science.gov (United States)

    Shoulders, Catherine W.; Myers, Brian E.

    2013-01-01

    Numerous researchers in science education have reported student improvement in areas of scientific literacy resulting from socioscientific issues (SSI)-based instruction. The purpose of this study was to describe student agriscience content knowledge following a six-week SSI-based instructional unit focusing on the introduction of cultured meat…

  2. Development of security engineering curricula at US universities

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, M.L.

    1998-06-01

    The Southwest Surety Institute was formed in 1996 to create unique, science-based educational programs in security engineering. The programs will integrate business, technology, and criminal justice elements to educate a new generation of security professionals. Graduates of the programs will better understand basic security system design and evaluation and contribute to strengthening of the body of knowledge in the area of security. A systematic approach incorporating people, procedures, and equipment will be taught that will emphasize basic security principles and establish the science of security engineering. The use of performance measures in the analysis of designed systems will enable effective decisions by an enterprise and provide the rationale for investment in security systems. Along with educational programs, Institute members will conduct original research and development built on existing relationships with sponsors from government and industry in areas such as counterterroism, microelectronics, banking, aviation, and sensor development. Additional information and updates on the Southwest Surety Institute are available via the Institute home page at www.emrtc.nmt.edu/ssi.

  3. Mobilisation for public engagement: Benchmarking the practices of research institutes.

    Science.gov (United States)

    Entradas, Marta; Bauer, Martin M

    2017-10-01

    Studies on scientists' practices of public engagement have pointed to variations between disciplines. If variations at the individual level are reflected at the institutional level, then research institutes in Social Sciences (and Humanities) should perform higher in public engagement and be more involved in dialogue with the public. Using a nearly complete sample of research institutes in Portugal 2014 ( n = 234, 61% response rate), we investigate how public engagement varies in intensity, type of activities and target audiences across scientific areas. Three benchmark findings emerge. First, the Social Sciences and the Humanities profile differently in public engagement highlighting the importance of distinguishing between these two scientific areas often conflated in public engagement studies. Second, the Social Sciences overall perform more public engagement activities, but the Natural Sciences mobilise more effort for public engagement. Third, while the Social Sciences play a greater role in civic public engagement, the Natural Sciences are more likely to perform educational activities. Finally, this study shows that the overall size of research institutes, available public engagement funding and public engagement staffing make a difference in institutes' public engagement.

  4. Research at the Paul Scherrer Institut

    International Nuclear Information System (INIS)

    Walter, H.K.

    1996-01-01

    The Paul Scherrer Institut (PSI) is a multidisciplinary research institute for natural sciences and technology. In national and international collaboration with universities, other research institutes and industry, PSI is active in elementary particle physics, life sciences, solid-state physics, material sciences, nuclear and non-nuclear energy research, and energy-related ecology. PSI's priorities lie in research fields which are relevant to sustainable development, serve educational needs and are beyond the possibilities of a single university department. PSI develops and operates complex research installations open of the world's most powerful cyclotron, allowing to operate high intensity secondary pion and muon beams, a neutron spallation source and various applications in medicine and materials research. A short review on research at PSI is presented, with special concentration on particle physics experiments. (author)

  5. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Effects of nonlinear soil structure interaction (SSI) were also considered by using interface elements. This parametric study evaluates the effects of soil type, structure weight, liquefiable soil layer thickness, event parameters (e.g., moment magnitude of earthquake (), peak ground acceleration PGA, PGV/PGA ratio and the ...

  6. The American Indian Summer Institute in Earth System Science (AISESS) at UC Irvine: A Two-Week Residential Summer Program for High School Students

    Science.gov (United States)

    Johnson, K. R.; Polequaptewa, N.; Leon, Y.

    2012-12-01

    Native Americans remain severely underrepresented in the geosciences, despite a clear need for qualified geoscience professionals within Tribal communities to address critical issues such as natural resource and land management, water and air pollution, and climate change. In addition to the need for geoscience professionals within Tribal communities, increased participation of Native Americans in the geosciences would enhance the overall diversity of perspectives represented within the Earth science community and lead to improved Earth science literacy within Native communities. To address this need, the Department of Earth System Science and the American Indian Resource Program at the University California have organized a two-week residential American Indian Summer Institute in Earth System Science (AISESS) for high-school students (grades 9-12) from throughout the nation. The format of the AISESS program is based on the highly-successful framework of a previous NSF Funded American Indian Summer Institute in Computer Science (AISICS) at UC Irvine and involves key senior personnel from the AISICS program. The AISESS program, however, incorporates a week of camping on the La Jolla Band of Luiseño Indians reservation in Northern San Diego County, California. Following the week of camping and field projects, the students spend a week on the campus of UC Irvine participating in Earth System Science lectures, laboratory activities, and tours. The science curriculum is closely woven together with cultural activities, native studies, and communication skills programs The program culminates with a closing ceremony during which students present poster projects on environmental issues relevant to their tribal communities. The inaugural AISESS program took place from July 15th-28th, 2012. We received over 100 applications from Native American high school students from across the nation. We accepted 40 students for the first year, of which 34 attended the program. The

  7. Present state of studies on FFAG accelerator for radiotherapy of cancer in National Institute of Radiological Sciences

    International Nuclear Information System (INIS)

    Misu, Toshiyuki

    2003-01-01

    From 2001, developmental contract studies with Ministry of Education, Culture, Sports, Science and Technology for a compact accelerator for heavy ion radiotherapy of cancer started in National Institute of Radiological Sciences (NIRS) with use of fixed field alternating gradient (FFAG) accelerator, which had been developed in High Energy Accelerator Research Organization (KEK). This paper describes the present state of those studies. Described are FFAG accelerator design for repeated acceleration for 200 Hz or more toward the carbon ion at 400 MeV/u with the range of 25 cm in water, FFAG optical systems for these purposes by linear analyses, and the present situation of the design. Technological problems yielded and future study plan are also commented. (N.I.)

  8. NATO Advanced Study Institute on Synthetic Membranes : Science, Engineering and Applications

    CERN Document Server

    Lonsdale, H; Pinho, M

    1986-01-01

    The chapters in this book are based upon lectures given at the NATO Advanced Study Institute on Synthetic Membranes (June 26-July 8, 1983, Alcabideche, Portugal), which provided an integrated presentation of syn­ thetic membrane science and technology in three broad areas. Currently available membrane formation mechanisms are reviewed, as well as the manner in which synthesis conditions can be controlled to achieve desired membrane structures. Membrane performance in a specific separa­ tionprocess involves complex phenomena, the understanding of which re­ quires a multidisciplinary approach encompassing polymer chemistry, phys­ ical chemistry, and chemical engineering. Progress toward a global understanding of membrane phenomena is described in chapters on the principles of membrane transport. The chapters on membrane processes and applications highlight both established and emerging membrane processes, and elucidate their myriad applications. It is our hope that this book will be an enduring, comprehensi...

  9. Risk factors for surgical site infection following nonshunt pediatric neurosurgery: a review of 9296 procedures from a national database and comparison with a single-center experience

    Science.gov (United States)

    Sherrod, Brandon A.; Arynchyna, Anastasia A.; Johnston, James M.; Rozzelle, Curtis J.; Blount, Jeffrey P.; Oakes, W. Jerry; Rocque, Brandon G.

    2017-01-01

    Objective Surgical site infection (SSI) following CSF shunt operations has been well studied, yet risk factors for nonshunt pediatric neurosurgery are less well understood. The purpose of this study was to determine SSI rates and risk factors following nonshunt pediatric neurosurgery using a nationwide patient cohort and an institutional dataset specifically for better understanding SSI. Methods The authors reviewed the American College of Surgeons National Surgical Quality Improvement Program Pediatric (ACS NSQIP-P) database for the years 2012–2014, including all neurosurgical procedures performed on pediatric patients except CSF shunts and hematoma evacuations. SSI included deep (intracranial abscesses, meningitis, osteomyelitis, and ventriculitis) and superficial wound infections. The authors performed univariate analyses of SSI association with procedure, demographic, comorbidity, operative, and hospital variables, with subsequent multivariate logistic regression analysis to determine independent risk factors for SSI within 30 days of the index procedure. A similar analysis was performed using a detailed institutional infection database from Children’s Hospital of Alabama (COA). Results A total of 9296 nonshunt procedures were identified in NSQIP-P with an overall 30-day SSI rate of 2.7%. The 30-day SSI rate in the COA institutional database was similar (3.3% of 1103 procedures, p = 0.325). Postoperative time to SSI in NSQIP-P and COA was 14.6 ± 6.8 days and 14.8 ± 7.3 days, respectively (mean ± SD). Myelomeningocele (4.3% in NSQIP-P, 6.3% in COA), spine (3.5%, 4.9%), and epilepsy (3.4%, 3.1%) procedure categoriess had the highest SSI rates by procedure category in both NSQIP-P and COA. Independent SSI risk factors in NSQIP-P included postoperative pneumonia (OR 4.761, 95% CI 1.269–17.857, p = 0.021), immune disease/immunosuppressant use (OR 3.671, 95% CI 1.371–9.827, p = 0.010), cerebral palsy (OR 2.835, 95% CI 1.463–5.494, p = 0.002), emergency

  10. Joint SKI and SSI review of SKB preliminary safety assessment of repository for long-lived low- and intermediate-level waste. Review report

    International Nuclear Information System (INIS)

    2001-03-01

    SKI and SSI find that SKB's first proper safety assessment of the SFL 3-5 repositories provides a valuable springboard for continued efforts in this field. Even though the safety assessment is relatively limited in scope, it has numerous merits. The specific problems associated with the chosen repository concept for SFL 3-5 are discussed in a generally transparent manner. On the other hand, the authorities consider that SKB have only partly achieved the expressed goal of studying the significance of the current repository design and the choice of site. The greatest deficiency consists in that neither internal disturbances (such as considerable cracking or degradation of concrete structures) nor external disturbances (such as the effects of climate changes and glaciation) have been addressed in a thorough manner. A coherent report justifying the design choice from a long-term safety perspective is, in large part, not found here. SKI and SSI recommend that SKB provide a comparison with other possible SFL 3-5 repository designs. Depending upon, among other factors, what geospheric and biospheric conditions are assumed, SKB have shown that the calculated dose values could be relatively high for certain cases. More realistic assessments would be needed to draw reasonable comparisons between different sites, and to evaluate the importance of different nuclides in different contexts. Our review of SKBs preliminary safety assessment indicates that a great deal of research and development work remains to be done before the level of knowledge in this field is comparable with that associated with the final repository for spent fuel. This is reflected with unanimity in the international expert committee's review, and in the consultants' reviews. SKI and SSI wish to point out in particular the fact that comparison with SFR is of limited value, since the safety associated with SFL 3- 5 must be assessed on a much longer time scale. SKI and SSI find it remarkable that SKB have

  11. Annual report for FY 2007 on the activities of radiation control in Nuclear Science Research Institute etc. April 1, 2007 - March 31, 2008

    International Nuclear Information System (INIS)

    2009-01-01

    This annual report describes the activities of Radiation Protection Sector in Department of Radiation Protection in Nuclear Science Research Institute, Safety Section in Takasaki Advanced Radiation Research Institute, Safety Section in Kansai Photon Science Institute and Operation Safety Administration Section in Aomori Research and Development Center. The report covers environmental monitoring around the facilities, radiation protection of workplace and workers, individual monitoring, maintenance of monitoring instruments, and research and development of radiation protection technologies, which were performed at the Radiation Protection Sector. There were no occupational or public exposures exceeding the prescribed dose limits. No effluent releases were recorded exceeding the prescribed limits on the amount and concentration of radioactivity for gaseous release and liquid waste. As for the research and development activities, studies were conducted continuously focusing mainly on the following themes: technological developments on operational radiation protection and establishment of calibration fields for various energy types of neutrons. (author)

  12. Disposal of radioactive waste in land burial facilities at Studsvik

    International Nuclear Information System (INIS)

    Ericsson, G.; Haegg, C.; Bergman, C.

    1987-01-01

    The report presents the formal background for the handling of the Studsvik application for permission to build a plant for deposition of radioactive waste in land burial facilities. The SSI (National Swedish Institute of Radiation Protection) basis for assessment is reported and relevant factors are presented. The radiation doses calculated by the SSI do not exceed a few microsievert per annum in spite of very pessimistic assumptions. The report constitutes assessment material for the standpoint to be taken by the board of SSI. (L.F.)

  13. Annual report of National Institute for Fusion Science. April 2003-March 2004

    International Nuclear Information System (INIS)

    2004-01-01

    This annual report summarizes the research activities at NIFS (the National Institute for Fusion Science) between April 2003 and March 2004. 300 collaborating studies have been implemented during this period. The major programs at NIFS are (i) toroidal plasma confinement experiments using the Large Helical Device (LHD) which is a heliotron type net-plasma-current free device and (ii) theoretical research and computer simulations for study of the complex state and the nonlinear dynamics such as these seen in high temperature plasmas. These major projects are accompanied by supporting but unique researches. A fusion reactor design study and its related engineering are also strongly promoted. In addition to the existing collaboration frameworks, a new framework of bilateral collaboration has started to enhance the exploitation of fusion facilities in universities. (J.P.N.)

  14. Engaging Elementary School Pre-service Teachers in Modeling a Socioscientific Issue as a Way to Help Them Appreciate the Social Aspects of Science

    OpenAIRE

    Evagorou, Maria; Puig Mauriz, Blanca

    2017-01-01

    Socioscientific issues are ill-structured problems that involve moral, ethical, and financial aspects, and lack clear-cut solutions. Teaching socioscientific issues necessarily puts a demand on teachers to draw on knowledge stemming from other domains, and to also appreciate, and present to the students the societal aspects of science. For new teachers, and those who have not tried integrating complex social issues into their instruction, SSI-based teaching may seem too great a hurdle to over...

  15. Prospects of development of modern scientific communities as social institutions

    OpenAIRE

    Radevskaya N. S.

    2017-01-01

    the article examines the science and society in their relations and interrelations, problems of self-organization of science. The author talks about the ways and forms of science as a social institution at the service of the public interest. One of the conclusions is that the level of development of science as an institution corresponds to the level of development of social relations.

  16. TTI Phase 2 Institutional Support: Institute for Policy Analysis and ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... and Research's (IPAR-Rwanda) role as a credible public policy institution in ... TTI is a multi-funder program dedicated to strengthening independent policy ... IDRC congratulates first cohort of Women in Climate Change Science Fellows.

  17. Annual report of National Institute of Radiological Sciences of the fiscal year 1991

    International Nuclear Information System (INIS)

    1993-01-01

    This annual report presents activities at the National Institute of Radiological Sciences (NIRS) in Japan during the period April 1991-March 1992. The activities are divided into research, technical aids, training, medical services, management, library or editing, and international cooperation. Research activities are arranged with twelve sections. The first section on special researches consists of continuing research projects entitled (1) 'Biological Risk Evaluation in Public Exposure', (2) 'Exposure Assessment in the Environment and the Public Through Food Chain', (3) 'Medical Use of Accelerated Heavy Ions', and (4) 'Preliminary Study for the Demonstration of Dose-Response Relationships in Low-Dose Range'. The section of assigned researches covers three titles. The section of ordinary researches covers physics (four titles), pharmacochemistry (four), biology (three), genetics (four), physiopathology (four), cytological radiation injuries (three), internal exposure (four), environmental science (four), clinical research (four), clinical research for radiation injuries (four), medical use of heavy particles (three), environmental radiation ecology (three), and aquatic radiation ecology (two). The section on technical aids gives an overview of technical services, radiation safety, animal and plant management, and cyclotron management. Appendices give the information on personnel in NIRS. (N.K.)

  18. Annual report of National Institute of Radiological Sciences of the fiscal year 1984

    International Nuclear Information System (INIS)

    1985-09-01

    The activities of National Institute of Radiological sciences in fiscal year 1984 were carried out on the basis of the total budget of 6052 million yen and 408 regular staffs. The ordinary research is the base of all research activities, and was carried out on 62 subjects, which achieved the results of internationally high level. The special research was performed by selecting four themes, that is, the investigation and research on the biological effect of tritium accompanying the development of nuclear fusion, the investigation and research on the probabilistic effect of radiation and risk evaluation, the investigation and research on the evaluation of environmental radiation exposure, and the investigation and research on the medical utilization of heavy particle beam and others. In addition, the specified research and the research using the science and technology promotion coordination expense were carried out. The total number of trainees who have finished various courses of the Education and Training Division reached 3466 in fiscal year 1984, and those contributed largely to the protection and utilization of radiation in Japan. Effort was exerted to promote the international exchange in this field. The activities in respective divisions are reported. (Kako, I.)

  19. SSI and the Environmental Code

    International Nuclear Information System (INIS)

    Loefgren, T.

    1997-12-01

    Radiation is, to some extent, included in the environmental code being prepared by the government. As a consequence both the Radiation Protection Institute and the proposed Environmental Court may set legal conditions concerning radiation protection for the proponent. Legal and other matters related to this issue are discussed in the report

  20. Deweyan Darwinism for the Twenty-First Century: Toward an Educational Method for Critical Democratic Engagement in the Era of the Institute of Education Sciences

    Science.gov (United States)

    Seltzer-Kelly, Deborah

    2008-01-01

    Our society's preoccupation with making educational policy and practice "scientific" is attested to by the stated mission of the Institute of Education Sciences: "to provide rigorous evidence on which to ground education practice and policy." Early in the twentieth century, John Dewey also advocated for a vision of education guided by science, and…

  1. Howard Hughes Medical Institute dose assessment survey

    International Nuclear Information System (INIS)

    O'Brien, S.L.; McDougall, M.M.; Barkley, W.E.

    1996-01-01

    Biomedical science researchers often express frustration that health physics practices vary widely between individual institutions. A survey examining both internal and external dose assessment practices was devised and mailed to fifty institutions supporting biomedical science research. The results indicate that health physics dose assessment practices and policies are highly variable. Factors which may contribute to the degree of variation are discussed. 2 tabs

  2. [Development of sanitary microbiology researches at the A. N. Marzeyev Institute for Hygiene and Medical Ecology, Academy of Medical Sciences of Ukraine (Kiev)].

    Science.gov (United States)

    Serdiuk, A M; Surmasheva, E V; Korchak, G I

    2011-01-01

    The paper describes the main stages of development of sanitary bacteriological studies at the leading hygiene research institute of Ukraine--the A. N Marzeyev Institute for Hygiene and Medical Ecology. These researches have made a substantial contribution to the formation and development of hygiene science in the former Soviet Union. The current and promising areas in sanitary microbiology in Ukraine are considered.

  3. Institute enriching students in Africa

    CERN Multimedia

    Burton, H

    2004-01-01

    In Cape Town, South Africa, the first annual African Summer Theory Institute is being held. This is a three-week conference for university science students throughout the whole of Africa, co-sponsored by Perimeter Institute as part of international outreach initiatives (1 page).

  4. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    College of Materials Science and Engineering, Guilin University of Electronic Technology, Guilin 541004, China; Guangxi Key Laboratory of Information Materials, Guilin University of Electronic Technology, Guilin 541004, China; Department of Materials Science and Engineering, Luoyang Institute of Science and ...

  5. English translation of three documents relating to the SFR-1

    International Nuclear Information System (INIS)

    1988-01-01

    After approval from the National Institute of Radiation Protection, (the SSI) on April 26th, 1988 the Swedish Nuclear Fuel and Waste Management Company, the SKB, put the Final Repository for Radioactive Waste, the SFR-1 (Forsmark), into operation. This report contains English translations of the Operating Permission issued by SSI and the associated radiation protection instructions. Also included is a translation of chapter 4, the viewpoints and evaluations, of the Assessment Memorandum which was the background material for the Board of the SSI when deciding on the operational permission. (orig./HP)

  6. The Australian Institute of Nuclear Science and Engineering - a model for university-national laboratory collaboration

    International Nuclear Information System (INIS)

    Gammon, R.B.

    1994-01-01

    This paper describes the aims and activities of the Australian Institute of Nuclear Science and Engineering (AINSE), from its foundation in 1958 through to 1993. The philosophy, structure and funding of the Institute are briefly reviewed, followed by an account of the development of national research facilities at the Lucas Heights Research Laboratories, with particular emphasis on nuclear techniques of analyses using neutron scattering instruments and particle accelerators. AINSE's program of Grants, fellowships and studentships are explained with many examples given of projects having significance in the context of Australia's national goals. Conference and training programs are also included. The achievements during these years demonstrate that AINSE has been an efficient and cost-effective model for collaboration between universities and a major national laboratory. In recent years, industry, government organisations and the tertiary education system have undergone major re-structuring and rationalization. A new operational structure for AINSE has evolved in response to these changes and is described

  7. [Thirty years of the electron microscope investigation in zoology and parasitology in the Zoological Institute of the Russian Academy of Sciences].

    Science.gov (United States)

    Shatrov, A B

    2003-01-01

    The history of the electron microscope investigations in zoology and parasitology in the Zoological Institute of the Russian Academy of Sciences and progress in scanning and transmission electron microscope investigations in this field of biology to the moment are briefly accounted.

  8. Evolution of Carbon Ion Radiotherapy at the National Institute of Radiological Sciences in Japan.

    Science.gov (United States)

    Mohamad, Osama; Makishima, Hirokazu; Kamada, Tadashi

    2018-03-06

    Charged particles can achieve better dose distribution and higher biological effectiveness compared to photon radiotherapy. Carbon ions are considered an optimal candidate for cancer treatment using particles. The National Institute of Radiological Sciences (NIRS) in Chiba, Japan was the first radiotherapy hospital dedicated for carbon ion treatments in the world. Since its establishment in 1994, the NIRS has pioneered this therapy with more than 69 clinical trials so far, and hundreds of ancillary projects in physics and radiobiology. In this review, we will discuss the evolution of carbon ion radiotherapy at the NIRS and some of the current and future projects in the field.

  9. The effects of networks on U.S. institution selection by foreign doctoral students in science and engineering

    Science.gov (United States)

    Tanyildiz, Zeynep Esra

    The United States has been a very attractive destination for foreign Science and Engineering (S&E) graduate students and postdoctoral scholars for a considerable period of time. Several studies have documented significant contributions of foreign students and foreign scientists in S&E. These contributions in turn foster economic development. Recent studies suggest, however, that the U.S. is losing its dominance in attracting foreign talent. Increased competition outside the U.S. contributes to the change as do changes in visa regulations. Despite the important role of foreign doctoral students in the U.S., relatively little is known about factors influencing their decision to attend an institution. One factor that is rarely explored is the effect of networks on institution selection. Through their networks, students learn about application procedures, studying at an institution, housing opportunities, general culture and people. In doing this, they draw both on the experience of the alumni as well as the support of current students and faculty at their target institution. Thus, networks can play an important role in where foreign doctoral students actually end up studying. This study aims to provide both qualitative and quantitative information about the role networks play in foreign doctoral students' institution selection. This three-part study utilizes different methodologies: (1) focus group interviews conducted with Turkish doctoral students at the Georgia Institute of Technology; (2) a web study of research laboratories in science and engineering; and (3) the estimation of Random Utility Model (RUM) of institution selection. These three components build on each other, in addition to the individual contributions that they make. Together they provide an in-depth and comprehensive analysis of the role of networks. The results from guided focus group interviews indicate that students, alumni, faculty and local community of the same nationality influence

  10. Archimedes in the 21st Century : World Conference at the Courant Institute of Mathematical Sciences

    CERN Document Server

    2017-01-01

    This book is a collection of papers presented at the “Archimedes in the 21st Century” world conference, held at the Courant Institute of Mathematical Sciences in 2013. This conference focused on the enduring and continuing influence of Archimedes in our modern world, celebrating his centuries of influence on mathematics, science, and engineering.  Archimedes planted the seeds for a myriad of seminal ideas that would grow over the ages. Each chapter surveys the growth of one or more of these seeds, and the fruit that they continue to bear to this day. The conference speakers contributing to this book are actively involved in STEM fields whose origins trace back to Archimedes, many of whom have conducted and published research that extends Archimedes’ work into the 21st century. The speakers are not historians, so while historical context is provided, this book is uniquely focused on the works themselves as opposed to their history.   The breadth and depth of Archimedes’ influence will inspire, deligh...

  11. Urbanistid ja keskkonnaeksperdid: iga muudatuse eest Reidi tee projektis oleme pidanud võitlema / Helen Sooväli-Sepping, Kristi Grišakov, Mari Jüssi ; intervjueerinud Mari Peegel ; kommenteerinud Taavi Aas

    Index Scriptorium Estoniae

    Sooväli-Sepping, Helen, 1974-

    2016-01-01

    TLÜ keskkonnakorralduse professor ja linnakorralduse õppekava juht Helen Sooväli-Sepping, TTÜ maastikuarhitektuuri õppekava juht ja linnaplaneerija-urbanist Kristi Grišakov ning Stockholmi keskkonnainstituudi Tallinna keskuse liikuvus- ja keskkonnaekspert Mari Jüssi kinnitavad, et Reidi tee projekt ei ole endiselt inimsõbralik

  12. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The Institute for Nanomaterials and Nanotechnology, MAScIR (Moroccan Foundation for Advanced Science, Innovation and Research), Rabat, Morocco; LMPHE (URAC 12), Departement of Physique, BP 1014, Faculty of Science, Mohammed V-Agdal University, Rabat, Morocco; National Centre for Energy, Sciences and ...

  13. Institute of Energy and Climate Research IEK-6. Nuclear Waste Management report 2011/2012. Material science for nuclear waste management

    International Nuclear Information System (INIS)

    Klinkenberg, M.; Neumeier, S.; Bosbach, D.

    2013-01-01

    The nuclear waste management section of the Institute of Energy and Climate Research IEK-6 in Juelich is focused on research on radiochemistry aspects/materials science relevant for the long-term safety of nuclear waste storage and disposal. Studies on innovative waste management strategies include partitioning o actinides and the development of ceramic waste forms. Structural research is covering solid state chemistry, crystallography and computational science to model actinide containing compounds. With respect to waste management concepts nondestructive essay techniques, waste treatment procedures and product quality control strategies were developed.

  14. The Lunar and Planetary Institute Summer Intern Program in Planetary Science

    Science.gov (United States)

    Kramer, G. Y.

    2017-12-01

    Since 1977, the Lunar and Planetary Institute (LPI) Summer Intern Program brings undergraduate students from across the world to Houston for 10 weeks of their summer where they work one-on-one with a scientist at either LPI or Johnson Space Center on a cutting-edge research project in the planetary sciences. The program is geared for students finishing their sophomore and junior years, although graduating seniors may also apply. It is open to international undergraduates as well as students from the United States. Applicants must have at least 50 semester hours of credit (or equivalent sophomore status) and an interest in pursuing a career in the sciences. The application process is somewhat rigorous, requiring three letters of recommendation, official college transcripts, and a letter describing their background, interests, and career goals. The deadline for applications is in early January of that year of the internship. More information about the program and how to apply can be found on the LPI website: http://www.lpi.usra.edu/lpiintern/. Each advisor reads through the applications, looking for academically excellent students and those with scientific interest and backgrounds compatible with the advisor's specific project. Interns are selected fairly from the applicant pool - there are no pre-arranged agreements or selections based on who knows whom. The projects are different every year as new advisors come into the program, and existing ones change their research interest and directions. The LPI Summer Intern Program gives students the opportunity to participate in peer-reviewed research, learn from top-notch planetary scientists, and preview various careers in science. For many interns, this program was a defining moment in their careers - when they decided whether or not to follow an academic path, which direction they would take, and how. While past interns can be found all over the world and in a wide variety of occupations, all share the common bond of

  15. Fellowship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Address: Department of Electrical Engineering, Indian Institute of Technology, Powai, Mumbai ..... Specialization: Elementary Particle Physics ..... Sciences, National Institute of Science Education & Research, Jatni, Khordha 752 050, Orissa

  16. Technical liaison with the Institute of Physical Chemistry (Russian Academy of Science)

    International Nuclear Information System (INIS)

    Delegard, C.H.

    1995-12-01

    The Institute of Physical Chemistry of the Russian Academy of Science (IPC/RAS) is engaged by the DOE to conduct studies of the fundamental and applied chemistry of the transuranium elements (TRU; primarily neptunium, plutonium, and americium; Np, Pu, Am) and technetium T c in alkaline media. This work is being supported by the DOE because the radioactive wastes stored in underground tanks at DOE sites (Hanford, Savannah River, and Oak Ridge) contain TRU and T c , are alkaline, and the chemistries of TRU and T c are not well developed in this system. Previous studies at the IPC/RAS centered on the fundamental chemistry and on coprecipitation. Work continuing in FY 1996 will focus more on the applied chemistry of the TRU and T c in alkaline media and continue effort on the coprecipitation task

  17. Developing Character and Values for Global Citizens: Analysis of pre-service science teachers' moral reasoning on socioscientific issues

    Science.gov (United States)

    Lee, Hyunju; Chang, Hyunsook; Choi, Kyunghee; Kim, Sung-Won; Zeidler, Dana L.

    2012-04-01

    Character and values are the essential driving forces that serve as general guides or points of reference for individuals to support decision-making and to act responsibly about global socioscientific issues (SSIs). Based on this assumption, we investigated to what extent pre-service science teachers (PSTs) of South Korea possess character and values as global citizens; these values include ecological worldview, socioscientific accountability, and social and moral compassion. Eighteen PSTs participated in the SSI programs focusing on developing character and values through dialogical and reflective processes. SSIs were centered on the use of nuclear power generation, climate change, and embryonic stem cell research. The results indicated that PSTs showed three key elements of character and values, but failed to apply consistent moral principles on the issues and demonstrated limited global perspectives. While they tended to approach the issues with emotion and sympathy, they nonetheless failed to perceive themselves as major moral agents who are able to actively resolve large-scale societal issues. This study also suggests that the SSI programs can facilitate socioscientific reasoning to include abilities such as recognition of the complexity of SSIs, examine issues from multiple perspectives, and exhibit skepticism about information.

  18. Impacts of a Place-Based Science Curriculum on Student Place Attachment in Hawaiian and Western Cultural Institutions at an Urban High School in Hawai'i

    Science.gov (United States)

    Kuwahara, Jennifer L. H.

    2013-01-01

    This study investigates how students' participation in a place-based science curriculum may influence their place attachment (dependence and identity). Participants attend an urban high school in Hawai'i and are members of different cultural institutions within the school. Students are either enrolled in an environmental science class within the…

  19. SSI on the Dynamic Behaviour of a Historical Masonry Building: Experimental versus Numerical Results

    Directory of Open Access Journals (Sweden)

    Francesca Ceroni

    2014-11-01

    Full Text Available A reliable procedure to identify the dynamic behaviour of existing masonry buildings is described in the paper, referring to a representative case study: a historical masonry palace located in Benevento (Italy. Since the building has been equipped with a permanent dynamic monitoring system by the Department of Civil Protection, some of the recorded data, acquired in various operating conditions, have been analysed with basic instruments of the Operational Modal Analysis in order to identify the main eigenfrequencies and vibration modes of the structure. The obtained experimental results have been compared to the numerical outcomes provided by three detailed Finite Element (FE models of the building. The influence of Soil-Structure Interaction (SSI has been also introduced in the FE model by a sub-structure approach where concentrated springs were placed at the base of the building to simulate the effect of soil and foundation on the global dynamic behaviour of the structure. The obtained results evidence that subsoil cannot a priori be disregarded in identifying the dynamic response of the building.

  20. Commemorating Toxicology at the National Institute of Environmental Health Sciences on the Occasion of Its 50th Anniversary

    Science.gov (United States)

    Bucher, John R.; Birnbaum, Linda S.

    2016-01-01

    Summary: In 1978, the National Toxicology Program (NTP) was established and headquartered at the National Institute of Environmental Health Sciences (NIEHS) in Research Triangle Park, North Carolina. On the occasion of the 50th Anniversary of the NIEHS, this article documents some of the historical and current NTP programs and scientific advances that have been made possible through this long-standing relationship. PMID:27801649