WorldWideScience

Sample records for scandium 55

  1. Solvent extraction of scandium from lateritic nickel- cobalt ores using different organic reagents

    Directory of Open Access Journals (Sweden)

    Ferizoğlu Ece

    2016-01-01

    Full Text Available Scandium is the most important and strategic metal that can be recovered as a by-product from lateritic nickel-cobalt ores. In this research, different extractants were investigated in order to extract scandium from a sulfate medium by a using a solvent extraction method. Generally, the organic extractants are classified as acidic, neutral and basic organophosphorus compounds. However, in solvent extraction of scandium, the acidic and neutral organophosphorus compounds are preferred due to their higher extraction efficiencies. Thus, the aim of the present study was to compare the scandium extraction efficiencies of some acidic and neutral organic reagents. For this reason, Ionquest 290 (Bis(2,4,4-trimethylpenthyl phosphonic acid, DEHPA (Di(2-ethylhexyl phosphoric acid, Cyanex 272 ((Bis(2,4,4-trimethylpentyl phosphinic acid which are acidic organophosphorus compounds, and Cyanex 923 (Trialkylphosphine oxide, which is a neutral organophosphorus compound, were used. The extraction capacities of these organics were studied with respect to the extractant concentration at same pH and phase ratio. As a result of the study, DEHPA was found to have higher scandium extraction efficiency with lower iron extraction at pH = 0.55 at a phase ratio of 10:1 = A:O.

  2. Scandium recovery from slags after oxidized nickel ore processing

    Science.gov (United States)

    Smyshlyaev, Denis; Botalov, Maxim; Bunkov, Grigory; Rychkov, Vladimir; Kirillov, Evgeny; Kirillov, Sergey; Semenishchev, Vladimir

    2017-09-01

    One of the possible sources of scandium production - waste (slags) from processing of oxidized nickel ores, has been considered in present research work. The hydrometallurgical method has been selected as the primary for scandium extraction. Different reagents for leaching of scandium, such as sulfuric acid, various carbonate salts and fluorides, have been tested. Sulfuric acid has been recognized as an optimal leaching reagent. Sulfuric acid concentration of 100 g L-1 allowed recovering up to 97 % of scandium.

  3. Influence of scandium concentration on power generation figure of merit of scandium aluminum nitride thin films

    Energy Technology Data Exchange (ETDEWEB)

    Akiyama, Morito; Nagase, Toshimi [Measurement Solution Research Center, National Institute of Advanced Industrials Science and Technology, Tosu, Saga 841-0052 (Japan); Umeda, Keiichi; Honda, Atsushi [Murata Manufacturing Co., Ltd., Nagaokakyo, Kyoto 617-8555 (Japan)

    2013-01-14

    The authors have investigated the influence of scandium concentration on the power generation figure of merit (FOM) of scandium aluminum nitride (Sc{sub x}Al{sub 1-x}N) films prepared by cosputtering. The power generation FOM strongly depends on the scandium concentration. The FOM of Sc{sub 0.41}Al{sub 0.59}N film was 67 GPa, indicating that the FOM is five times larger than that of AlN. The FOM of Sc{sub 0.41}Al{sub 0.59}N film is higher than those of lead zirconate titanate and Pb(Mg{sub 1/3}Nb{sub 2/3})O{sub 3}-PbTiO{sub 3} films, which is the highest reported for any piezoelectric thin films. The high FOM of Sc{sub 0.41}Al{sub 0.59}N film is due to the high d{sub 31} and the low relative permittivity.

  4. Lifetime measurements and oscillator strengths in singly ionized scandium and the solar abundance of scandium

    Science.gov (United States)

    Pehlivan Rhodin, A.; Belmonte, M. T.; Engström, L.; Lundberg, H.; Nilsson, H.; Hartman, H.; Pickering, J. C.; Clear, C.; Quinet, P.; Fivet, V.; Palmeri, P.

    2017-12-01

    The lifetimes of 17 even-parity levels (3d5s, 3d4d, 3d6s and 4p2) in the region 57 743-77 837 cm-1 of singly ionized scandium (Sc II) were measured by two-step time-resolved laser induced fluorescence spectroscopy. Oscillator strengths of 57 lines from these highly excited upper levels were derived using a hollow cathode discharge lamp and a Fourier transform spectrometer. In addition, Hartree-Fock calculations where both the main relativistic and core-polarization effects were taken into account were carried out for both low- and high-excitation levels. There is a good agreement for most of the lines between our calculated branching fractions and the measurements of Lawler & Dakin in the region 9000-45 000 cm-1 for low excitation levels and with our measurements for high excitation levels in the region 23 500-63 100 cm-1. This, in turn, allowed us to combine the calculated branching fractions with the available experimental lifetimes to determine semi-empirical oscillator strengths for a set of 380 E1 transitions in Sc II. These oscillator strengths include the weak lines that were used previously to derive the solar abundance of scandium. The solar abundance of scandium is now estimated to logε⊙ = 3.04 ± 0.13 using these semi-empirical oscillator strengths to shift the values determined by Scott et al. The new estimated abundance value is in agreement with the meteoritic value (logεmet = 3.05 ± 0.02) of Lodders, Palme & Gail.

  5. Smelting of Scandium by Microwave Irradiation.

    Science.gov (United States)

    Fujii, Satoshi; Tsubaki, Shuntaro; Inazu, Naomi; Suzuki, Eiichi; Wada, Yuji

    2017-09-27

    Scandium is being explored as an alloying element for aluminum alloys, which are gaining importance as high-performance lightweight structural alloys in the transportation industry. A few years ago, Sc was also found to be suitable for use in electrical devices. High-Sc-content ScAlN thin films have attracted significant attention because of their strong piezoelectricity. The piezoelectric response of ScAlN suggests that ScAlN thin films formed on a hard substrate would be suitable surface acoustic wave wideband filters for next-generation wireless communication systems. However, it is often difficult to use ScAlN thin films in MEMS devices-including acoustic ones-because of the extremely high price of metallic Sc, given the difficulty associated with smelting it. Here, we propose a novel process for smelting Sc metal by microwave irradiation. Sc metal was able to be obtained successfully from ScF₃ through a microwave-irradiation-based carbon reduction reaction. The reaction temperature for this reduction process was approximately 880°C, which is half of that for the conventional smelting process involving reduction with Ca. Thus, the proposed microwave irradiation process has significant potential for use in the smelting of Sc metal.

  6. Smelting of Scandium by Microwave Irradiation

    Directory of Open Access Journals (Sweden)

    Satoshi Fujii

    2017-09-01

    Full Text Available Scandium is being explored as an alloying element for aluminum alloys, which are gaining importance as high-performance lightweight structural alloys in the transportation industry. A few years ago, Sc was also found to be suitable for use in electrical devices. High-Sc-content ScAlN thin films have attracted significant attention because of their strong piezoelectricity. The piezoelectric response of ScAlN suggests that ScAlN thin films formed on a hard substrate would be suitable surface acoustic wave wideband filters for next-generation wireless communication systems. However, it is often difficult to use ScAlN thin films in MEMS devices—including acoustic ones—because of the extremely high price of metallic Sc, given the difficulty associated with smelting it. Here, we propose a novel process for smelting Sc metal by microwave irradiation. Sc metal was able to be obtained successfully from ScF3 through a microwave-irradiation-based carbon reduction reaction. The reaction temperature for this reduction process was approximately 880°C, which is half of that for the conventional smelting process involving reduction with Ca. Thus, the proposed microwave irradiation process has significant potential for use in the smelting of Sc metal.

  7. Hydrometallurgical methods of recovery of scandium from the wastes of various technologies

    Science.gov (United States)

    Molchanova, T. V.; Akimova, I. D.; Smirnov, K. M.; Krylova, O. K.; Zharova, E. V.

    2017-03-01

    The recovery of scandium from the wastes of the production of uranium, titanium, iron-vanadium, and alumina is studied. The applied acid schemes of scandium transfer to a solution followed by ion-exchange recovery and extraction concentration of scandium ensure the precipitation of crude scandium oxides containing up to 5% Sc2O3. Scandium oxides of 99.96-99.99% purity are formed after additional refining of these crude oxides according to an extraction technology using a mixture 15% multiradical phosphine oxide or Cyanex-925 + 15% tributyl phosphate in kerosene.

  8. Synthesis and Reactivity of a Scandium Terminal Hydride: H2  Activation by a Scandium Terminal Imido Complex.

    Science.gov (United States)

    Han, Xianghao; Xiang, Li; Lamsfus, Carlos A; Mao, Weiqing; Lu, Erli; Maron, Laurent; Leng, Xuebing; Chen, Yaofeng

    2017-10-20

    Dihydrogen is easily activated by a scandium terminal imido complex containing the weakly coordinated THF. The reaction proceeds through a 1,2-addition mechanism, which is distinct from the σ-bond metathesis mechanism reported to date for rare-earth metal-mediated H2 activation. This reaction yields a scandium terminal hydride, which is structurally well-characterized, being the first one to date. The reactivity of this hydride is reported with unsaturated substrates, further shedding light on the existence of the terminal hydride complex. Interestingly, the H2 activation can be reversible. DFT investigations further eludciate the mechanistic aspects of the reactivity of the scandium anilido-terminal hydride complex with PhNCS but also on the reversible H2 activation process. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Thermoelectric material comprising scandium doped zinc cadmium oxide

    DEFF Research Database (Denmark)

    2016-01-01

    There is presented a composition of scandium doped Zinc Cadmium Oxide with the general formula ZnzCdxScyO which the inventors have prepared, and for which material the inventors have made the insight that it is particularly advantageous as an n-type oxide material, such as particularly advantageous...

  10. Scandium/carbon filters for soft x rays

    NARCIS (Netherlands)

    Artioukov, IA; Kasyanov, YS; Kopylets, IA; Pershin, YP; Romanova, SA

    2003-01-01

    This Note deals with thin-film soft x-ray filters for operation at the wavelengths near carbon K edge (similar to4.5 nm). The filters were fabricated by magnetron sputtering deposition of thin layers of scandium (total thickness 0.1-0.2 mum) onto films of polypropylene (thickness 1.5 mum) and

  11. Solvent extraction of scandium from lateritic nickel- cobalt ores using different organic reagents

    OpenAIRE

    Ferizoğlu Ece; Kaya Şerif; Topkaya Yavuz A.

    2016-01-01

    Scandium is the most important and strategic metal that can be recovered as a by-product from lateritic nickel-cobalt ores. In this research, different extractants were investigated in order to extract scandium from a sulfate medium by a using a solvent extraction method. Generally, the organic extractants are classified as acidic, neutral and basic organophosphorus compounds. However, in solvent extraction of scandium, the acidic and neutral organophosphorus compounds are preferred due to th...

  12. BASIC RESEARCH ON THE SEPARATION OF SCANDIUM YTTRIUM, AND THE RARE EARTHS BY SOLVENT EXTRACTION.

    Science.gov (United States)

    RARE EARTH ELEMENTS, * SOLVENT EXTRACTION ), (*CHELATE COMPOUNDS, RARE EARTH ELEMENTS), PURIFICATION, ATOMIC SPECTROSCOPY, SCANDIUM, YTTRIUM, PRASEODYMIUM, SAMARIUM, EUROPIUM, GADOLINIUM, TERBIUM, FLUORINE COMPOUNDS, KETONES

  13. Determination of scandium concentrate composition by WD-XRF and ICP-MS methods

    Science.gov (United States)

    Sarkisova, A. S.; Shibitko, A. O.; Abramov, A. V.; Rebrin, O. I.; Bunkov, G. M.; Lisienko, D. G.

    2017-09-01

    WD-XRF spectroscopy was applied for determining composition of scandium concentrate (ScC) containing 70 % scandium fluoride. Determination of ScC composition was performed using 6 glass beads reference materials produced by fusing synthesized mixture of analyte compounds with the lithium-borate flux in the ratio of 1:10. ScC powder with the known composition was then used as a powder pellet reference material to analyze scandium concentrate from technological line by external standard method. ICP-MS method was employed to control the ScC composition. The statistical data processing and metrological parameters evaluation of the analytical technique developed were carried out.

  14. Tin etching from metallic and oxidized scandium thin films

    Science.gov (United States)

    Pachecka, M.; Lee, C. J.; Sturm, J. M.; Bijkerk, F.

    2017-08-01

    The role of oxide on Sn adhesion to Sc surfaces was studied with in-situ ellipsometry, X-ray photoelectron spectroscopy and secondary electron microscopy. Sn etching with hydrogen radicals was performed on metallic Sc, metallic Sc with a native oxide, and a fully oxidized Sc layer. The results show that Sn adsorbs rather weakly to a non-oxidized Sc surface, and is etched relatively easily by atomic hydrogen. In contrast, the presence of native oxide on Sc allows Sn to adsorb more strongly to the surface, slowing the etching. Furthermore, thinner layers of scandium oxide result in weaker Sn adsorption, indicating that the layer beneath the oxide plays a significant role in determining the adsorption strength. Unexpectedly, for Sn on Sc2O3, and, to a lesser extent, for Sn on Sc, the etch rate shows a variation over time, which is explained by surface restructuring, temperature change, and hydrogen adsorption saturation.

  15. Tin etching from metallic and oxidized scandium thin films

    Directory of Open Access Journals (Sweden)

    M. Pachecka

    2017-08-01

    Full Text Available The role of oxide on Sn adhesion to Sc surfaces was studied with in-situ ellipsometry, X-ray photoelectron spectroscopy and secondary electron microscopy. Sn etching with hydrogen radicals was performed on metallic Sc, metallic Sc with a native oxide, and a fully oxidized Sc layer. The results show that Sn adsorbs rather weakly to a non-oxidized Sc surface, and is etched relatively easily by atomic hydrogen. In contrast, the presence of native oxide on Sc allows Sn to adsorb more strongly to the surface, slowing the etching. Furthermore, thinner layers of scandium oxide result in weaker Sn adsorption, indicating that the layer beneath the oxide plays a significant role in determining the adsorption strength. Unexpectedly, for Sn on Sc2O3, and, to a lesser extent, for Sn on Sc, the etch rate shows a variation over time, which is explained by surface restructuring, temperature change, and hydrogen adsorption saturation.

  16. Extraction of scandium by liquid di-2-ethylhexylphosphoric acid in fusible diluents

    Directory of Open Access Journals (Sweden)

    Ainur Isatayeva

    2015-03-01

    Full Text Available Currently widespread distribution of extraction methods using fusible reagents can be explained by a number of advantages, such as high kinetic characteristics of the process, the ease separation of two phases, high selectivity of many extractants, relatively complete regeneration. For the extraction of scandium in technological order, neutral and cation exchange extractants can be used. Several extraction reagents melt easily at high temperatures, and such melts can be used for extraction. Efficiency of the extraction of metal by cation reagents depends on many factors. Extraction of scandium by melt mixtures of di-2-ethylhexylphosphoric acid - higher carboxylic acid - paraffin and the effect of acidity of the aqueous phase, the concentration of scandium and the aqueous extractant in the organic phase, the volume ratio of organic and aqueous phases on the extraction of metal were studied. It was found that the extraction of scandium proceeds through the cation exchange mechanism. Scandium was extracted quantitatively (> 99.0% from acid solutions. The optimal concentration of di-2-ethylhexylphosphoric acid in the extractant was 0,250 M, quantitative extraction of scandium was observed in the range of its concentrations of 10-3-10-6 M and the volume ratio of organic phases to aqueous phases of 1:5 - 1:20.

  17. Thermodynamic and kinetic study of scandium(III) complexes of DTPA and DOTA: a step toward scandium radiopharmaceuticals.

    Science.gov (United States)

    Pniok, Miroslav; Kubíček, Vojtěch; Havlíčková, Jana; Kotek, Jan; Sabatie-Gogová, Andrea; Plutnar, Jan; Huclier-Markai, Sandrine; Hermann, Petr

    2014-06-23

    Diethylenetriamine-N,N,N',N'',N''-pentaacetic acid (DTPA) and 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA) scandium(III) complexes were investigated in the solution and solid state. Three (45)Sc NMR spectroscopic references suitable for aqueous solutions were suggested: 0.1 M Sc(ClO4)3 in 1 M aq. HClO4 (δSc =0.0 ppm), 0.1 M ScCl3 in 1 M aq. HCl (δSc =1.75 ppm) and 0.01 M [Sc(ox)4](5-) (ox(2-) = oxalato) in 1 M aq. K2C2O4 (δSc =8.31 ppm). In solution, [Sc(dtpa)](2-) complex (δSc = 83 ppm, Δν = 770 Hz) has a rather symmetric ligand field unlike highly unsymmetrical donor atom arrangement in [Sc(dota)](-) anion (δSc = 100 ppm, Δν = 4300 Hz). The solid-state structure of K8[Sc2(ox)7]⋅13 H2O contains two [Sc(ox)3](3-) units bridged by twice "side-on" coordinated oxalate anion with Sc(3+) ion in a dodecahedral O8 arrangement. Structures of [Sc(dtpa)](2-) and [Sc(dota)](-) in [(Hguanidine)]2[Sc(dtpa)]⋅3 H2O and K[Sc(dota)][H6 dota]Cl2⋅4 H2O, respectively, are analogous to those of trivalent lanthanide complexes with the same ligands. The [Sc(dota)](-) unit exhibits twisted square-antiprismatic arrangement without an axial ligand (TSA' isomer) and [Sc(dota)](-) and (H6 dota)(2+) units are bridged by a K(+) cation. A surprisingly high value of the last DOTA dissociation constant (pKa =12.9) was determined by potentiometry and confirmed by using NMR spectroscopy. Stability constants of scandium(III) complexes (log KScL 27.43 and 30.79 for DTPA and DOTA, respectively) were determined from potentiometric and (45)Sc NMR spectroscopic data. Both complexes are fully formed even below pH 2. Complexation of DOTA with the Sc(3+) ion is much faster than with trivalent lanthanides. Proton-assisted decomplexation of the [Sc(dota)](-) complex (τ1/2 =45 h; 1 M aq. HCl, 25 °C) is much slower than that for [Ln(dota)](-) complexes. Therefore, DOTA and its derivatives seem to be very suitable ligands for scandium

  18. Effects of iron on intermetallic compound formation in scandium modified Al–Si–Mg Alloys

    Energy Technology Data Exchange (ETDEWEB)

    Patakham, Ussadawut [National Metal and Materials Technology Center, National Science and Technology Development Agency, 114 Thailand Science Park, Klong Nueng, Klong Luang, Pathumthani 12120 (Thailand); Limmaneevichitr, Chaowalit, E-mail: chaowalit.lim@mail.kmutt.ac.th [Production Engineering Department, Faculty of Engineering, King Mongkut’s University of Technology Thonburi, 126 Pracha-Utid Rd., Bangmod, Tungkhru, Bangkok 10140 (Thailand)

    2014-12-15

    Highlights: • Iron reduces the modification effects of scandium in Al–Si–Mg alloys. • Morphologies of Sc-rich intermetallic phases vary with Fe and Sc contents and the cooling rates. • Sc neutralizes effects of Fe by changing Fe-rich intermetallic phases from platelets to more cubic. - Abstract: In general, iron has a strong tendency to dissolve in molten aluminum. Iron has very low solid solubility in aluminum–silicon casting alloys, so it will form intermetallic compounds that cause detrimental effects on mechanical properties. In this work, the effects of iron on intermetallic compound formations in scandium modified Al–Si–Mg alloys were studied. There were two levels of iron addition (0.2 and 0.4 wt.%) and two levels of scandium addition (0.2 and 0.4 wt.%). We found that the effects of scandium modification decreased with increasing iron addition. The morphologies of the complex intermetallic compounds were characterized by scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS) and electron backscatter diffraction (EBSD) techniques. It was found that scandium changes the morphology of Fe-rich intermetallic compounds from β-phase (plate-like) to α-phase, which reduces the harmful effects of β-phase.

  19. Correlation between stoichiometry and properties of scandium oxide films prepared by reactive magnetron sputtering

    Science.gov (United States)

    Belosludtsev, Alexandr; Juškevičius, Kęstutis; Ceizaris, Lukas; Samuilovas, Romanas; Stanionytė, Sandra; Jasulaitienė, Vitalija; Kičas, Simonas

    2018-01-01

    Scandium oxide films were deposited on fused silica substrates by reactive pulsed DC magnetron sputtering. The use of feed-back optical emission monitoring enabled high-rate reactive deposition of films with tunable stoichiometry and properties. The under-stoichiometric, stoichiometric and over-stoichiometric scandium oxide films were prepared. The compressive stress in films was between 235 and 530 MPa. We showed that phase structure, density, surface roughness and optical properties of the scandium oxide are affected by the film stoichiometry and deposition conditions. Transparent scandium oxide films were slightly hydrophobic (94 ± 3°), homogeneous with a crystallite size of 20 ± 5 nm. The lowest extinction coefficient 0.7 × 10-3, the highest refractive index 2.08 (both quantities at the wavelength of 355 nm) and the highest density 4.1 ± 0.1 g cm-3 exhibited film prepared with the stoichiometric composition. Stoichiometric scandium oxide can be used in various optical applications as high refractive index and wide bandgap material. Transitions to under- or over-stoichiometry lead to a decrease of film density, refractive index and increase of the extinction coefficient.

  20. Mossbauer investigation of scandium oxide-hematite nanoparticles

    Science.gov (United States)

    Allwes, Mark; Sorescu, Monica

    Scandium oxide-doped hematite, xSc2O3*(1-x)alpha-Fe2O3 with molar concentration x =0.1, 0.3, and 0.5 was prepared by using ball milling, taking samples at times 0, 2, 4, 8, and 12 hours. The resulting Mossbauer spectra of the nanoparticles systems were parameterized using NORMOS-90. For each concentration, the spectra at 0 hours only consisted of 1 sextet, as the substitution of Sc2O3into Fe2O3 did not appear until after 2 hours of ball milling time (BMT). Concentration x =0.1 at BMT 2hours consisted of 2 sextets while x =0.3 and 0.5 were fit with 1 sextet and 1 quadrupole-split doublet. Concentration x =0.1 at BMT 4 and 8 hours consisted of 3 sextets, and at BMT 12 hours consisted of 4 sextets. For concentrations x =0.3 and 0.5 at BMT 4, 8, and 12 hours the spectra were fit with 3 sextets and 1 quadrupole-split doublet. With increasing initial concentration, the appearance of the quadrupole-split doublet became more pronounced, indicating the substitution of Fe into Sc2O3 occurred. But for x =0.1, the BMT did influence the number of sextets needed, causing an increase in substitution of Sc2O3 into Fe2O3.

  1. Association between toenail scandium levels and risk of acute myocardial infarction in European men: The EURAMIC and Heavy Metals Study

    NARCIS (Netherlands)

    Gómez-Aracena, J.; Martin-Moreno, J.M.; Riemersma, R.A.; Bode, P.; Gutiérrez-Bedmar, M.; Gorgojo, L.; Kark, J.D.; Garcia-Rodríguez, A.; Gomez-Gracia, E.; Kardinaal, A.F.M.; Aro, A.; Veer, P. van 't; Wedel, H.; Kok, F.J.; Fernández-Crehuet, J.

    2002-01-01

    The association between scandium status and risk of acute myocardial infarction (MI) was examined in a multicentre case control study in 10 centres from Europe and Israel. Scandium in toenails was assessed in 684 cases and 724 controls less than 70 years of age. Mean concentrations of toenail

  2. CLUB 55

    Directory of Open Access Journals (Sweden)

    Ramón Rojano

    2000-01-01

    Full Text Available Este artículo presenta una reconceptualización del concepto de envejecimento. Se plantea la necesidad de revisar las etapas del desarrollo psicológico descritas por Erikson. Los recientes cambios demográficos y la prolongación de la expectativa de vida justifican el replanteamiento conceptual. Actualmente la tercera edad no es la última edad. Características que se le atribuían a este período de la vida ahora corresponden a la cuarta edad. El Departamento de Servicios Humanos de Hartford ha creado el Club 55, un proyecto basado en este nuevo paradigma.

  3. In-source laser spectroscopy developments at TRILIS-towards spectroscopy on actinium and scandium

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, Sebastian, E-mail: raeder@triumf.ca; Dombsky, Marik; Heggen, Henning; Lassen, Jens; Quenzel, Thomas [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Sjoedin, Marica [GANIL (France); Teigelhoefer, Andrea [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Wendt, Klaus [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik (Germany)

    2013-04-15

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm{sup - 1} which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  4. Process and Mechanical Properties: Applicability of a Scandium modified Al-alloy for Laser Additive Manufacturing

    Science.gov (United States)

    Schmidtke, K.; Palm, F.; Hawkins, A.; Emmelmann, C.

    The applicability of an aluminium alloy containing scandium for laser additive manufacturing (LAM) is considered. Modified aluminium alloys with a scandium content beyond the eutectic point offer great potential to become a high prioritized aerospace material. Depending on other alloying elements like magnesium or zirconium, strongly required weight reduction, corrosion resistance and improved strength properties of metallic light weight alloys can be achieved. The development, production and testing of parts built up by a laser powder bed process will be presented with regard to the qualification of the new material concept "ScalmalloyRP®" for laser additive manufacturing.

  5. Hidroroute 55

    Science.gov (United States)

    Mas, M.; Eixarch, E.; Ortonobes, C.

    2012-04-01

    "HIDROROUTE 55" Saving water is a recurrent topic for students in Spain because the Mediterranean zone suffers periodically severe droughts. Any student knows it and is able to repeat some basic advices like "take showers instead of baths, or "close the tap when brushing your teeth..." But maybe this is a quite superficial awareness about shortage and saving water. Where does the home flowing water come from? How can we be sure that this water is clean and safe to drink? And, tomorrow or next week, will be there water in our tap? Perhaps working in these questions is a good way to understand how difficult is to get water to our homes. In order to deepen in the question we are preparing a teaching unit titled "Hydro route 55: from the Earth to la Maurina trough the water" on 1rst ESO level students (12 years old) of the secondary public school "Institut les Aymerigues" in Terrassa (Barcelona). Students' tasks will be to search information about the way water gets to their homes, including water cycle, treatment and saving water... This unit belongs to an integrated project with all areas involved (history, mathematics, technology, languages and music) that aims to approach students to different aspects of their zone in Terrassa (La Maurina) and it will be implemented at the end of the second term, just some weeks before the Vienna's meeting. School and teaching team: Institut les Aymerigues is a new school that this year has only 1rst ESO students (12 years old). Teaching staff is engaged in developing an integrated and based on competences curriculum. In this context we integrate English and Science content in a unified teaching schedule of six hours per week for the students. One English teacher and two Science teachers are involved in it. In addition we have three student teachers from "Master of Secondary Teachers Training" that are in charge of preparing the Hydroroute 55 activities with the titular teachers. We illustrate students' tasks such as the

  6. Synthesis and structural characterization of scandium SALEN complexes.

    Science.gov (United States)

    Meermann, Christian; Sirsch, Peter; Törnroos, Karl W; Anwander, Reiner

    2006-02-28

    A series of heteroleptic scandium SALEN complexes, [(SALEN)Sc(mu-Cl)]2 and (SALEN)Sc[N(SiHMe2)2] is obtained via amine elimination reactions using [Sc(N(i)Pr2)2(mu-Cl)(THF)]2 and Sc[N(SiHMe2)2]3(THF) as metal precursors, respectively. H(2)SALEN ligand precursors comprising H2Salen [(1,2-ethandiyl)bis(nitrilomethylidyne)bis(2,4-di-tert-butyl)phenol], H2Salpren [(2,2-dimethylpropanediyl)bis(nitrilomethylidyne)bis(2,4-di-tert-butyl)phenol], H2Salcyc [(1R,2R)-(-)-1,2-cyclohexanediyl)bis(nitrilomethylidyne)bis(2,4-di-tert-butyl)phenol] and H2Salphen [((1S,2S)-(-)-1,2-diphenylethandiyl)bis(nitrilomethylidyne)bis(2,4-di-tert-butyl)phenol] are selected according to solubility and ligand backbone variation ("=N-(R)-N=" bite angle) criteria. Consideration is given to the feasibility of [Cl --> NR2] and [N(SiHMe2)2--> OSiR3] secondary ligand exchange reactions. X-ray crystal structure analyses of donor-free (Salpren)Sc(N(i)Pr2), (R,R)-(Salcyc)Sc[N(SiHMe2)2], (Salen)Sc(OSi(t)BuPh2) and (Salphen)Sc(OSiH(t)Bu2) reveal (i) a very short Sc-N bond distance of 2.000(3) A, (ii) weak beta(Si-H)(amido)-Sc agostic interactions and (iii) an exclusive intramolecularly tetradentate and intrinsically bent coordination mode of the SALEN ligands with angle(Ph,Ph) dihedral angles and Sc-[N(2)O(2)] distances in the 124.27(9)-127.7(3) degrees and 0.638(1)-0.688(1) A range, respectively.

  7. Scandium SALEN complexes bearing chloro, aryloxo, and hydroxo ligands.

    Science.gov (United States)

    Meermann, Christian; Törnroos, Karl W; Anwander, Reiner

    2009-03-16

    Heteroleptic amide complexes (SALEN)Sc[N(SiHMe(2))(2)] (SALEN = Salen(tBu,tBu), Salcyc(tBu,tBu), or Salpren(tBu,tBu) if not stated differently) were examined as synthesis precursors according to silylamine elimination reactions. Treatment of (SALEN)Sc[N(SiHMe(2))(2)] with H(2)O or phenols (HOAr(R,R); R = tBu, iPr) afforded complexes [(SALEN)Sc(mu-OH)](2) and (SALEN)Sc(OAr(R,R)), while chloro exchange products were formed from the respective reactions with NH(4)Cl or AlMe(2)Cl. Such complexes [(SALEN)Sc(mu-Cl)](2) and (SALEN)ScCl(thf) were also obtained by utilizing alternative synthesis protocols, allowing for controlled donor absence and presence. Heteroleptic amide precursors [Sc(NiPr(2))(2)(mu-Cl)(thf)](2) and [Sc[N(SiHMe(2))(2)](2)(mu-Cl)(thf)](2) readily undergo amine elimination reactions with H(2)SALEN derivatives to form the corresponding chloride complexes. Spectroscopic and X-ray structural data of the heteroleptic scandium complexes revealed an exclusive intramolecular tetradentate coordination mode of the SALEN ligands independent of the SALEN ligand bite angle and the nature of the "second" ligand (chloro, amido, aryloxo, hydroxo). The coordination of the SALEN ligands is rationalized on the basis of (a) the displacement d of the metal center from the [N(2)O(2)] least-squares plane, (b) the dihedral angle alpha between the phenyl rings of the salicylidene moieties, and (c) the angle beta = Ct-Ln-Ct (Ct = centroid of the phenyl rings) in the case of strongly twisted ligands.

  8. Vertical distribution of scandium in the north central Pacific

    Science.gov (United States)

    Amakawa, Hiroshi; Nomura, Miho; Sasaki, Kazunori; Oura, Yasuji; Ebihara, Mitsuru

    2007-06-01

    The concentrations of scandium (Sc) in seawater, which have remained unreported since the early 1970s, were determined together with those of yttrium (Y) and lanthanides (Ln) with samples from the north central Pacific Ocean (St. BO-3). The Sc concentration shows a so-called nutrient-like profile: it increases gradually from the surface (about 2 pmol/kg) to the ocean floor (about 20 pmol/kg). That pattern closely resembles those of Y and Ln (correlation coefficient (r) > 0.92). Some light-to-middle Ln (Pr-Tb) exhibit a closer correlation with Sc than do Y, La, or heavy Ln (Ho-Lu). In contrast, Y/Sc and Ln/Sc ratios (elemental abundance ratios) indicate that Sc is depleted compared to either Y or Ln in seawater more than in loess, which represents chemical compositions of crustal material. These observations offer a conflicting view of chemical reactivity related Y, Ln, and Sc: r values show that the chemical reactivity of Sc resembles those of Y and Ln, but differences of Y/Sc and Ln/Sc ratios in seawater and in loess suggest that the chemical reactivity of Sc differs from those of Y and Ln. More Sc data for seawater are necessary to clarify the chemical reactivity of Sc in the ocean. We also propose that comparative studies of vertical profiles of Sc and such elements as Fe, Ti, Zr, and Hf showing so-called nutrient-like profiles at the same oceanic stations would be helpful and effective for clarifying the behavior of Sc in the ocean.

  9. In situ observation of the reaction of scandium and carbon by neutron diffraction

    Energy Technology Data Exchange (ETDEWEB)

    Juarez-Arellano, Erick A., E-mail: eajuarez@unpa.edu.m [Institut fuer Geowissenschaften, Universitaet Frankfurt, Altenhoeferallee 1, 60438 Frankfurt a.M. (Germany); Universidad del Papaloapan, Circuito Central 200, Parque Industrial, Tuxtepec 68301 (Mexico); Winkler, Bjorn [Institut fuer Geowissenschaften, Universitaet Frankfurt, Altenhoeferallee 1, 60438 Frankfurt a.M. (Germany); Vogel, Sven C. [Los Alamos National Laboratory, Lujan Center. Mail Stop H805, Los Alamos, NM 87545 (United States); Senyshyn, Anatoliy [Forschungsneutronenquelle Heinz Maier-Leibnitz (FRM II), Technische Universitaet Muenchen, Lichtenbergstr. 1, D-85747 Garching (Germany); Materialwissenschaft, TU Darmstadt, Petersensstr. 23, D-64287 Darmstadt (Germany); Kammler, Daniel R. [Sandia National Laboratories, Albuquerque, NM 87185 (United States); Avalos-Borja, Miguel [CNyN, UNAM, A. Postal 2681, Ensenada, B.C. (Mexico)

    2011-01-05

    Research highlights: {yields} Exist two ScC cubic phases with B1-structure type differing in site occupancy of C. {yields} A new orthorhombic scandium carbide phase is formed at 1473(50) K. {yields} The recrystallization of alpha-Sc occurs between 1000 and 1223 K. - Abstract: The formation of scandium carbides by reaction of the elements has been investigated by in situ neutron diffraction up to 1823 K. On heating, the recrystallization of {alpha}-Sc occurs between 1000 and 1223 K. The formation of Sc{sub 2}C and ScC (NaCl-B1 type structure) phases has been detected at 1323 and 1373 K, respectively. The formation of a new orthorhombic scandium carbide phase was observed at 1473(50) K. Once the scandium carbides are formed they are stable upon heating or cooling. No other phases were detected in the present study, in which the system was always carbon saturated. The thermal expansion coefficients of all phases have been determined, they are constant throughout the temperature interval studied.

  10. The effects of aluminum or scandium on the toughness, density and ...

    African Journals Online (AJOL)

    The effects of the substitution of aluminum or scandium on the density, toughness as well as the stability of the phases formed by such an addition on platinum, iridium, rhodium and palladium metals were evaluated with the density functional quantum mechanical calculation methods. All the metals had four atoms per ...

  11. Effects of erbium‑and chromium‑doped yttrium scandium gallium ...

    African Journals Online (AJOL)

    2014-08-21

    Aug 21, 2014 ... surfaces because of its high power, and the ablation was deeper for these samples. High‑magnification SEM ... Key words: Erbium chromium‑doped yttrium scandium gallium garnet, diode laser, restorative dental materials, scanning electron ... garnet (Nd: YAG) and carbon dioxide (CO2) lasers on indirect ...

  12. Chemical and biological evaluation of scandium(III)-polyaminopolycarboxylate complexes as potential PET agents and radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Huclier-Markai, S.; Sabatie, A.; Ribet, S. [Univ. de Nantes (France). Lab. Subatech; Kubicek, V.; Hermann, P. [Charles Univ., Prague (Czech Republic). Dept. of Inorganic Chemistry; Paris, M. [Univ. de Nantes (France). Inst. des Materiaux; Vidaud, C. [CEA/DSV/iBEB/SBTN, Bagnols sur Ceze (France). Lab. d' Etude des Proteines Cibles; Cutler, C.S. [Univ. of Missouri, Columbia, MO (United States). Reserach Reactor Center

    2011-07-01

    Scandium isotopes ({sup 44}Sc, {sup 47}Sc) are more available and their properties are convenient for either PET imaging or radiotherapy. To use them in nuclear medicine, ligands forming complexes with a high stability are necessary. Available experimental data on stability constants for complexes of ligands such as EDTA, DTPA, DOTA, NOTA and TETA with various metal ions have been published. But scandium is the exception since scarce data is available in the literature. Values of stability constants of Sc(III) with the ligands were determined by free-ion selective radiotracer extraction, complemented by {sup 45}Sc NMR and potentiometry data. The thermodynamic stability of the Sc-complexes increases in the order TETA < NOTA < EDTA < DTPA < DOTA. The in vitro stability of the Sc(III) complexes was studied in the presence of hydroxyapatite and rat serum to estimate their in vivo stability. The most stable complex was shown to be Sc-DOTA.

  13. Precipitation behaviour and recrystallisation resistance in aluminum alloys with additions of hafnium, scandium and zirconium

    OpenAIRE

    Hallem, Håkon

    2005-01-01

    The overall objective of this work has been to develop aluminium alloys, which after hot and cold deformation are able to withstand high temperatures without recrystallising. This has been done by investigating aluminium alloys with various additions of hafnium, scandium and zirconium, with a main focus on Hf and to which extent it may partly substitute or replace Zr and/or Sc as a dispersoid forming elements in these alloys. What is the effect of hafnium, alone and in combination with Zr...

  14. Pilot-scale recovery of rare earths and scandium from phosphogypsum and uranium leachates

    Directory of Open Access Journals (Sweden)

    Mashkovtsev Maxim

    2016-01-01

    Full Text Available Ural Federal University (UrFU and VTT have performed joint research on development of industrial technologies for the extraction of REM and Scandium compounds from phosphogypsum and Uranium ISL leachate solutions. Leaching-absorption experiments at UrFU have been supported with multicomponent solution modelling by VTT. The simulations have been performed with VTT’s ChemSheet/Balas program and can be used for speciation calculations in the lixiviant solution. The experimental work combines solvent extraction with advanced ion exchange methodology in a pilot facility capable of treating 5 m3 solution per hour. Currently, the plant produces cerium carbonate, lanthanum oxide, neodymium oxide and concentrate of heavy rare earth metals. A batch of 45 t solids has been processed with the gain of 100 kg’s of REM concentrate. A mini-pilot plant with productivity above 50 liters per hour has been applied to recover scandium oxide and REE concentrates from the uranium ISL solution. As the preliminary product contains radioactivity (mainly strontium, an additional decontamination and cleaning of both concentrates by extraction has rendered a necessity. Finally a purified 99% concentrate of scandium oxide as well as 99% rare earth concentrate are received.

  15. Optimization of scandium oxide growth by high pressure sputtering on silicon

    Energy Technology Data Exchange (ETDEWEB)

    Feijoo, P.C., E-mail: pedronska@fis.ucm.es; Pampillon, M.A.; San Andres, E.; Lucia, M.L.

    2012-12-30

    This work demonstrates the viability of scandium oxide deposition on silicon by means of high pressure sputtering. Deposition pressure and radio frequency power are varied for optimization of the properties of the thin films and the ScO{sub x}/Si interface. The physical characterization was performed by ellipsometry, Fourier transform infrared spectroscopy, x-ray diffraction and transmission electron microscopy. Aluminum gate electrodes were evaporated for metal-insulator-semiconductor (MIS) fabrication. From the electrical characterization of the MIS devices, the density of interfacial defects is found to decrease with deposition pressure, showing a reduced plasma damage of the substrate surface for higher pressures. This is also supported by lower flatband voltage shifts in the capacitance versus voltage hysteresis curves. Sputtering at high pressures (above 100 Pa) reduces the interfacial SiO{sub x} formation, according to the infrared spectra. The growth rates decrease with deposition pressure, so a very accurate control of the layer thicknesses could be provided. - Highlights: Black-Right-Pointing-Pointer Scandium oxide is considered as a high permittivity dielectric. Black-Right-Pointing-Pointer Scandium oxide was deposited on Si by high pressure sputtering. Black-Right-Pointing-Pointer Characterization was performed for deposition condition optimization. Black-Right-Pointing-Pointer High deposition pressures showed higher film and interface quality.

  16. Recovery of Scandium from Leachate of Sulfation-Roasted Bayer Red Mud by Liquid-Liquid Extraction

    Science.gov (United States)

    Liu, Zhaobo; Li, Hongxu; Jing, Qiankun; Zhang, Mingming

    2017-11-01

    The leachate obtained from sulfation-roasted Bayer red mud is suitable for extraction of scandium by liquid-liquid solvent extraction because it contains trace amounts of Fe3+ and Si4+. In this study, a completely new metallurgical process for selective recovery of scandium from Bayer red mud was proposed. The extraction performances of Sc3+, Fe3+, Al3+, Si4+, Ca2+, and Na+ from synthetic leachate of sulfation-roasted red mud were first investigated using organophosphorus extractants (di-2-ethylhexyl phosphoric acid P204 and 2-ethylhexyl phosphoric acid mono-2-ethylhexyl ester P507) and carboxylic acid extractant (Versatic acid 10). It shows that P204 has an excellent extraction ability and that it can be applied to the scandium recovery. P507 and Versatic acid 10 are much poorer in performance for selective extraction of scandium. In the leachate of sulfation-roasted red mud, approximately 97% scandium can be recovered using a P204/sulfonated kerosene (1% v/v) extraction system under the condition of an organic-to-aqueous phase ratio of 10:1 and with an extraction temperature of 15°C.

  17. Scandium-doped zinc cadmium oxide as a new stable n-type oxide thermoelectric material

    DEFF Research Database (Denmark)

    Han, Li; Christensen, Dennis Valbjørn; Bhowmik, Arghya

    2016-01-01

    Scandium-doped zinc cadmium oxide (Sc-doped ZnCdO) is proposed as a new n-type oxide thermoelectric material. The material is sintered in air to maintain the oxygen stoichiometry and avoid instability issues. The successful alloying of CdO with ZnO at a molar ratio of 1 : 9 significantly reduced...... is a good candidate for improving the overall conversion efficiencies in oxide thermoelectric modules. Meanwhile, Sc-doped ZnCdO is robust in air at high temperatures, whereas other n-type materials, such as Al-doped ZnO, will experience rapid degradation of their electrical conductivity and ZT....

  18. Scandium and yttrium phosphasalen complexes as initiators for ring-opening polymerization of cyclic esters.

    Science.gov (United States)

    Bakewell, Clare; White, Andrew J P; Long, Nicholas J; Williams, Charlotte K

    2015-03-02

    The synthesis and characterization of novel scandium and yttrium phosphasalen complexes is reported, where phosphasalen refers to two different bis(iminophosphorane) derivatives of the more ubiquitous salen ligands. The activity of the complexes as initiators for the ring-opening polymerization of cyclic esters is presented. The scandium complexes are inactive for lactide polymerization but slow and controlled initiators for ε-caprolactone polymerization. The lack of activity toward lactide exhibited by these compounds is probed, and a rare example of single-monomer insertion product, unable to undergo further reactions with lactide, is identified. In contrast, the analogous yttrium phosphasalen complex is a very active initiator for the ring-opening polymerization of rac-lactide (kobs = 1.5 × 10(-3) s(-1) at 1:500 [yttrium initiator]:[rac-lactide], 1 M overall concentration of lactide in THF at 298 K). In addition to being a very fast initiator, the yttrium complex also maintains excellent levels of polymerization control and a high degree of isoselectivity, with the probability of isotactic enchainment being Pi = 0.78 at 298 K.

  19. Thermodynamic parameters of scandium trifluoride and triiodide in the condensed state

    Science.gov (United States)

    Aristova, N. M.; Belov, G. V.

    2015-06-01

    The thermodynamic properties of new classes of compounds, particularly scandium trihalides ScF3, ScCl3, ScBr3, and ScI3, are added to the IVTANTHERMO software package. A critical analysis and processing of the entire array of primary data available in the literature is performed. An equation approximating the temperature dependence of heat capacity in the temperature range 298.15- T m (K) is derived for each crystalline scandium trihalide. The resulting equations C {/p po}( T) for the solid state and the data for the liquid phase are used to calculate the thermodynamic functions of entropy, the reduced Gibbs free energies, and the enthalpy increments. Both the experimental data available in literature and the missing estimated thermodynamic data are used in calculations. The error of the recommended values is estimated in all cases. In the first part of this work, we describe the thermodynamic properties of ScF3 and ScI3 used as the reference data for calculating the thermodynamic functions of ScCl3 and ScBr3, for which experimental data are either very scarce or missing altogether. The resulting data are added to the database of the IVTANTHERMO software package.

  20. Recovery of Scandium(III) from Aqueous Solutions by Solvent Extraction with the Functionalized Ionic Liquid Betainium Bis(trifluoromethylsulfonyl)imide

    OpenAIRE

    Onghena, Bieke; Binnemans, Koen

    2015-01-01

    The ionic liquid betainium is(trifluoromethylsulfonyl)imide [Hbet][Tf2N] was used for the extraction of scandium from aqueous solutions. The influence of several extraction parameters on the extraction efficiency was investigated, including the initial metal concentration, phase ratio, and pH. The extraction kinetics was examined, and a comparison was made between conventional liquid−liquid extraction and homogeneous liquid−liquid extraction (HLLE). The stoichiometry of the extracted scandium...

  1. Modification mechanism of eutectic silicon in Al–6Si–0.3Mg alloy with scandium

    Energy Technology Data Exchange (ETDEWEB)

    Patakham, Ussadawut [Manufacturing and Systems Engineering Program, Department of Production Engineering, Faculty of Engineering, King Mongkut’s University of Technology Thonburi, 126 Pracha-Utid Rd., Bangmod, Tungkhru, Bangkok 10140 (Thailand); Kajornchaiyakul, Julathep [National Metal and Material Technology Center, National Science and Technology Development Agency, 114 Thailand Science Park, Klong Nueng, Klong Luang, Pathumthani 12120 (Thailand); Limmaneevichitr, Chaowalit, E-mail: chaowalit.lim@kmutt.ac.th [Manufacturing and Systems Engineering Program, Department of Production Engineering, Faculty of Engineering, King Mongkut’s University of Technology Thonburi, 126 Pracha-Utid Rd., Bangmod, Tungkhru, Bangkok 10140 (Thailand)

    2013-10-25

    Highlights: •Morphologies and growth of Sc and Sr-modified eutectic silicon resemble those of dendrites. •Crystal orientation of eutectic aluminum depends on growth characteristics of eutectic silicon. •We report strong evidence of the occurrence of an impurity-induced twinning mechanism. -- Abstract: The modification mechanism of eutectic silicon in Al–6Si–0.3Mg alloy with scandium was studied. The crystallographic orientation relationships between primary dendrites and the eutectic phase of unmodified and modified Al–6Si–0.3 Mg alloys were determined using electron backscatter diffraction (EBSD). The orientation of aluminum modified with scandium in the eutectic phase was different from that of the neighboring primary dendrites. This result implies that eutectic aluminum grows epitaxially from the surrounding primary aluminum dendrites in the unmodified alloy and that eutectic aluminum grows competitively from the surrounding primary aluminum dendrites in the modified alloy. The pole figure maps of eutectic Si in the [1 0 0], [1 1 0] and [1 1 1] axes of the unmodified and Sc-modified alloys were different, suggesting that the eutectic Al and Si crystals in modified alloy growth are more isotropic and cover a larger set of directions. The lattice fringes of Si of the alloys with and without Sc modification were different in the TEM results. The lattice fringes of Si in modified alloy were found to be multiple twins. However, this was not observed in the unmodified alloy. The growth characteristic of eutectic Si crystal in modified alloy suggests the occurrence of multiple twinning reactions and the formation of a high density of twins. This modification mechanism by Sc is explained by the results of scanning electron microscopy (SEM), electron backscatter diffraction (EBSD) and transmission electron microscopy (TEM) analysis, which provide strong evidence of the occurrence of the impurity-induced twinning (IIT) mechanism.

  2. Grain refinement mechanism in an Al-Si-Mg alloy with scandium

    Energy Technology Data Exchange (ETDEWEB)

    Patakham, Ussadawut [Department of Production Engineering, Faculty of Engineering, King Mongkut' s University of Technology Thonburi, 126 Pracha-Utid Rd., Bangmod, Tungkhru, Bangkok 10140 (Thailand); Kajornchaiyakul, Julathep [National Metal and Material Technology Center, National Science and Technology Development Agency, 114 Thailand Science Park, Klong Nueng, Klong Luang, Pathumthani 12120 (Thailand); Limmaneevichitr, Chaowalit, E-mail: chaowalit.lim@kmutt.ac.th [Department of Production Engineering, Faculty of Engineering, King Mongkut' s University of Technology Thonburi, 126 Pracha-Utid Rd., Bangmod, Tungkhru, Bangkok 10140 (Thailand)

    2012-11-25

    Highlights: Black-Right-Pointing-Pointer Scandium can be used to refine aluminum grains in an Al-Si-Mg aluminum alloy. Black-Right-Pointing-Pointer The effectiveness of Sc is lower than that of conventional Al-Ti grain refiners. Black-Right-Pointing-Pointer Al{sub 3}Sc particles can act as heterogeneous nuclei of aluminum phases. Black-Right-Pointing-Pointer Higher alloying elements cause more intermetallic compound phases. Black-Right-Pointing-Pointer Those phases cannot effectively act as heterogeneous nuclei compared with Al{sub 3}Sc particles. - Abstract: Grain refinement of the primary aluminum ({alpha}-Al) phase in a hypoeutectic Al-Si alloy using scandium (Sc) was studied to identify the grain refinement mechanism. Optical microscopy (OM), Scanning electron microscopy (SEM) with energy dispersive spectroscopy (EDS) and electron backscatter diffraction (EBSD) techniques were extensively used in this study. We found that Sc refined grains of primary aluminum. However, the grain refinement efficiency of Sc was considerably lower than that of titanium (Ti) in the Al-Si-Mg foundry alloy. It was evident that the precipitated Sc-containing phases acted as heterogeneous nucleation sites for the primary aluminum phase. The Sc-containing heterogeneous sites are irregular in shape with sizes between 3 and 5 {mu}m. At least three groups of nuclei based on their chemical composition were found, i.e., (i) Al and Sc, (ii) Al, Si, Mg, and Sc, and (iii) Al, Si, Mg, Sc, and Fe. Crystal orientation mapping showed primary aluminum dendrites with one orientation in each grain near Al{sub 3}Sc particles. The grain refinement mechanism of Sc for aluminum relies on heterogeneous nucleation of Al{sub 3}Sc particles, with less responsibly for grain growth restriction. Many intermetallic phases with Al, Si, Fe, Mg and Sc as their major components were found, and these phases could not effectively act as heterogeneous nuclei.

  3. Neutron and Charged-Particle Induced Cross Sections for Radiochemistry for Isotopes of Scandium, Titanium, Vanadium, Chromium, Manganese, and Iron

    Energy Technology Data Exchange (ETDEWEB)

    Kelley, K; Hoffman, R D; Dietrich, F S; Bauer, R; Mustafa, M

    2004-11-30

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Local systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron and proton induced nuclear reaction cross sections in the mass region of scandium, titanium, vanadium, chromium, manganese, and iron (21 {le} Z {le} 26, 20 {le} N {le} 32).

  4. A composite cathode based on scandium doped titanate with enhanced electrocatalytic activity towards direct carbon dioxide electrolysis.

    Science.gov (United States)

    Yang, Liming; Xie, Kui; Wu, Lan; Qin, Qingqing; Zhang, Jun; Zhang, Yong; Xie, Ting; Wu, Yucheng

    2014-10-21

    A composite cathode based on redox-stable La0.2Sr0.8TiO(3+δ) (LSTO) can perform direct carbon dioxide electrolysis; however, the insufficient electro-catalytic activity limits the electrode performances and current efficiencies. In this work, catalytically active scandium is doped into LSTO to enhance the electro-catalytic activity for CO2 electrolysis. The structures, electronic conductivities and ionic conductivities of La0.2Sr0.8Ti(1-x)Sc(x)O (LSTS(x)O) (x = 0, 0.05, 0.1, 0.15 and 0.2) are systematically studied and further correlated with electrode performances. The ionic conductivities of single-phase LSTS(x)O (x = 0, 0.05, 0.1 and 0.15) remarkably improve versus the scandium doping contents though the electrical conductivities gradually change in an adverse trend. Electrochemical measurements demonstrate promising electrode polarisation of LSTS(x)O electrodes and increasing scandium doping contents accordingly improve electrode performances. The Faradic efficiencies of carbon dioxide electrolysis are enhanced by 20% with LSTS0.15O in contrast to bare LSTO electrodes in a solid oxide electrolyser at 800 °C.

  5. Adsorption of hydrogen in Scandium/Titanium decorated nitrogen doped carbon nanotube

    Energy Technology Data Exchange (ETDEWEB)

    Mananghaya, Michael, E-mail: mikemananghaya@gmail.com [De La Salle University, 2401 Taft Ave, 0922, Manila (Philippines); DLSU STC Laguna Boulevard, LTI Spine Road Barangays Biñan and Malamig, Biñan City, Laguna (Philippines); DOST-ASTHRDP, PCIEERD, Gen. Santos Ave., Bicutan, Taguig City 1631 (Philippines); Belo, Lawrence Phoa; Beltran, Arnel [De La Salle University, 2401 Taft Ave, 0922, Manila (Philippines); DLSU STC Laguna Boulevard, LTI Spine Road Barangays Biñan and Malamig, Biñan City, Laguna (Philippines)

    2016-09-01

    Nitrogen doped Carbon Nanotube with divacancy (4ND-CN{sub x}NT) that is decorated with Scandium and Titanium as potential hydrogen storage medium using the pseudo potential density functional method was investigated. Highly localized states near the Fermi level, which are derived from the nitrogen defects, contribute to strong Sc and Ti bindings, which prevent metal aggregation and improve the material stability. A detailed Comparison of the Hydrogen adsorption capability with promising system-weight efficiency of Sc over Ti was elucidated when functionalized with 4ND-CN{sub x}NT. Finally, the (Sc/4ND){sub 10}-CN{sub x}CNT composite material has a thermodynamically favorable adsorption and consecutive adsorption energy for ideal reversible adsorption and desorption of hydrogen at room temperature such that it can hold at least 5.8 wt% hydrogen molecules at the LDA and GGA level. - Highlights: • Carbon Nanotube with divacancy (4ND-CN{sub x}NT) decorated with Sc and Ti. • Nitrogen defects, contribute to strong Sc and Ti bindings. • H{sub 2} and (Sc/4ND){sub 10}-CN{sub x}CNT has a favorable adsorption. • 5.8 wt% adsorption at the LDA and GGA level.

  6. Urinary monitoring of exposure to yttrium, scandium, and europium in male Wistar rats.

    Science.gov (United States)

    Kitamura, Yasuhiro; Usuda, Kan; Shimizu, Hiroyasu; Fujimoto, Keiichi; Kono, Rei; Fujita, Aiko; Kono, Koichi

    2012-12-01

    On the assumption that rare earth elements (REEs) are nontoxic, they are being utilized as replacements of toxic heavy metals in novel technological applications. However, REEs are not entirely innocuous, and their impact on health is still uncertain. In the past decade, our laboratory has studied the urinary excretion of REEs in male Wistar rats given chlorides of europium, scandium, and yttrium solutions by one-shot intraperitoneal injection or oral dose. The present paper describes three experiments for the suitability and appropriateness of a method to use urine for biological monitoring of exposure to these REEs. The concentrations of REEs were determined in cumulative urine samples taken at 0-24 h by inductively coupled plasma atomic emission spectroscopy, showing that the urinary excretion of REEs is <2 %. Rare earth elements form colloidal conjugates in the bloodstream, which make high REEs accumulation in the reticuloendothelial system and glomeruli and low urinary excretion. The high sensitivity of inductively coupled plasma-argon emission spectrometry analytical methods, with detection limits of <2 μg/L, makes urine a comprehensive assessment tool that reflects REE exposure. The analytical method and animal experimental model described in this study will be of great importance and encourage further discussion for future studies.

  7. 55th Annual

    Indian Academy of Sciences (India)

    1990-01-01

    Jan 1, 1990 ... At the invitation of the Madhya Pradesh. Council of Science and Technology, the. Barkatullah University and the Regional. Research laboratory, Bhopal, the 55th Annual. Meeting of the Academy was held at the. Tagore Bhawan, Bhopal from 10 to 13. November 1989. One of the best organized Annual.

  8. aged over 55 years

    Directory of Open Access Journals (Sweden)

    Anna Knyszyńska

    2016-06-01

    Full Text Available Background . Aging is a physiological process during which a number of adverse and irreversible organ involution changes, leading to a reduction in functional capacity of the body, both in physical and mental terms. The risk of chronic disease and depression increases with age. Objectives . Analysis of body composition and depression in people over 55 years of age with metabolic syndrome. Material and methods . The study group is 157 persons aged 55–69 years (112 women and 45 men. The authors analyzed body composition by electrical bioimpedance analyzer (Jawon IOI 353. In addition to the assessment of depression a questionnaire involving 30-point Geriatric Depression Scale was used. Results . In the study group women scored significantly lower than men on the average values of lean body mass, and an average of 7% higher than the value determining the percentage of body fat. The vast majority (70.7%; n = 111 patients showed no signs of depression. It has been shown that women with major depression had significantly higher mean values of body fat compared to women characterized by the absence or a mild depression. Conclusions . Diagnosis of depression in the elderly may be difficult due to the presence of the “masked depression”. There is a trend indicating the relationship between the prevalence of depressive symptoms and weight and body composition of people over 55 years of age, but in order to verify it the authors need to continue the study on increased number of research groups, perhaps taking into account different environmental factors.

  9. Selective recovery of vanadium and scandium by ion exchange with D201 and solvent extraction using P507 from hydrochloric acid leaching solution of red mud.

    Science.gov (United States)

    Zhu, Xiaobo; Li, Wang; Tang, Sen; Zeng, Majian; Bai, Pengyuan; Chen, Lunjian

    2017-05-01

    D201 resin and P507 extractant diluted with sulfonated kerosene were used to respectively separate vanadium and scandium, and impurity ions from hydrochloric acid leaching solution of red mud. More than 99% of vanadium was selectively adsorbed from the hydrochloric acid leaching solution under the conditions of pH value of 1.8, volume ratio of leaching solution to resin of 10, and flow rate of 3.33 mL/min. Maximum extraction and separation of scandium was observed from the acid leaching solution at an aqueous pH value of 0.2. More than 99% of scandium can be selectively extracted using 15% P507, 5% TBP at the aqueous solution/organic phase (A/O) ratio of 10:1 for 6 min. The loaded organic phase was washed with 0.3 mol/L sulfuric acid, wherein most impurities were removed. After the process of desorption or stripping, precipitation, and roasting, high-purity V2O5 and Sc2O3 were obtained. Finally, a conceptual flow sheet was established to separate and recover vanadium and scandium from red mud hydrochloric acid leaching solution. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Random-field Potts model for the polar domains of lead magnesium niobate and lead scandium tantalate

    Energy Technology Data Exchange (ETDEWEB)

    Qian, H.; Bursill, L.A

    1997-06-01

    A random filed Potts model is used to establish the spatial relationship between the nanoscale distribution of charges chemical defects and nanoscale polar domains for the perovskite-based relaxor materials lead magnesium niobate (PMN) and lead scandium tantalate (PST). The random fields are not set stochastically but are determined initially by the distribution of B-site cations (Mg, Nb) or (Sc, Ta) generated by Monte Carlo NNNI-model simulations for the chemical defects. An appropriate random field Potts model is derived and algorithms developed for a 2D lattice. It is shown that the local fields are strongly correlated with the chemical domain walls and that polar domains as a function of decreasing temperature is simulated for the two cases of PMN and PST. The dynamics of the polar clusters is also discussed. 33 refs., 9 figs.

  11. Development of methods for the selective separation of scandium, zirconium and tin for radiopharmaceutical applications; Entwicklung von Methoden zur selektiven Trennung von Scandium, Zirkonium und Zinn fuer radiopharmazeutische Anwendungen

    Energy Technology Data Exchange (ETDEWEB)

    Dirks-Fandrei, Carina

    2014-07-01

    The subject of the present work is the development of fast and highly selective methods for the separation and purification of scandium, zirconium and tin radionuclides from potential target materials for use in nuclear medicine. A number of selected resins (TrisKem International) were first characterized with respect to their extraction behaviour towards a large number of cations. Characterization studies were performed in batch experiments by determination of weight distribution ratios D{sub w} and further the influence of interferences on the uptake of these elements was evaluated. Weight distribution ratios were determined in different acids and acid concentrations with main focus on scandium, tin or zirconium. The interference of macro amounts of Calcium and Ti on the Sc extraction was evaluated as well as the interference of macro amounts of Y on the Zr extraction. Best suited uptake conditions were found for Scandium on DGA were determined to be 2.5 M HNO{sub 3} for Ti-Targets and 0.1 M HNO{sub 3} for Calcium-Targets. Otherwise it is also possible to extract Sc with TRU Resin. High uptakes were obtained at 2.5 M HNO{sub 3} for simulated Ti- and Calcium-targets. Separation methods were developed using elution studies; employed conditions were chosen according to parameters evaluated in the batch-experiment. The developed methods allowed separating Sc very rapidly in high purity very rapidly from Ti- or Calcium-targets. For Zr a separation method based on UTEVA Resin has been developed. Following results of batch experiments simulated Y-target solution were loaded onto a UTEVA resin column from 6 M HNO{sub 3}; the elution of Zr could be performed in 0.01 M oxalic acid. Decontamination factors in the order of 10{sup 4}-10{sup 5} could be obtained applying the developed method; the method thus allowed separating Zr in a high purity. Initial testing of a method for the separation of Sn from Cd targets based on the use of TBP Resin showed that the TBP resin seems

  12. The impact of an erbium, chromium:yttrium-scandium-gallium-garnet laser with radial-firing tips on endodontic treatment.

    Science.gov (United States)

    Schoop, U; Barylyak, A; Goharkhay, K; Beer, F; Wernisch, J; Georgopoulos, A; Sperr, W; Moritz, A

    2009-01-01

    Radial-firing tips should allow a more homogeneous laser irradiation of root canal walls. The aim of the study was to assess the effects of erbium, chromium:yttrium-scandium-gallium-garnet (Er,Cr:YSGG) laser irradiation in conjunction with those newly designed tips. The investigation comprised bacteriology, morphological evaluations and temperature measurements. Root canals were inoculated with two test strains and laser irradiated with power settings of 0.6 W and 0.9 W and a repetition rate of 20 Hz. Subsequently, the samples were subjected to microbiological evaluation. The morphological changes of the canal walls were assessed by scanning electron microscopy. To reveal possible thermal side effects, we carried out temperature measurements. The bacteriological evaluation revealed a decisive disinfectant effect. Scanning electron microscopy showed the homogeneous removal of smear layer from the root canal walls. The temperature rise at the root surface during the irradiation was moderate, yielding 1.3 degrees C for the 0.6 W setting and 1.6 degrees C for the 0.9 W setting. The investigations indicated that the Er,Cr:YSGG laser, in conjunction with radial-firing tips, is a suitable tool for the elimination of bacteria in root canals and for the removal of smear layer.

  13. Effect of scandium addition on the microstructure, mechanical and wear properties of the spray formed hypereutectic aluminum–silicon alloys

    Energy Technology Data Exchange (ETDEWEB)

    Raghukiran, Nadimpalli; Kumar, Ravi, E-mail: nvrk@iitm.ac.in

    2015-08-12

    Hypereutectic Al–x%Si–0.8Sc alloys (x=13, 16, 19 and 22 wt%) were produced by spray forming. The microstructures of all the alloys exhibited very fine silicon phase with average size of about 5–10 µm irrespective of the silicon content of the alloy. Transmission electron microscopy revealed the presence of a nano-scale scandium rich phase, identified as AlSi{sub 2}Sc{sub 2} (V-phase) uniformly distributed in the alloy. The presence of V-phase resulted in higher matrix hardness (1.34 GPa) in contrast to 1.04 GPa observed in the case of binary Al–Si alloys by nanoindentation. Isothermal heat treatment at 375 °C revealed insignificant coarsening of silicon phase in both binary and ternary alloys. The Al–x%Si–0.8Sc alloys exhibited higher flow stress and tensile strength in contrast to their binary alloy counterparts which was attributed to the bi-modal size distribution of the strengthening phases in the form of nano-scale V-phase and sub-micron to 10 µm size silicon particles. The pin-on-disk wear tests exhibited appreciable improvement in the wear performance of the relatively low-silicon content ternary alloys over their binary counterparts while the high-silicon content binary and ternary alloys exhibited no much difference in the wear performance.

  14. Scandium and Titanium Containing Single-Walled Carbon Nanotubes for Hydrogen Storage: a Thermodynamic and First Principle Calculation.

    Science.gov (United States)

    Mananghaya, Michael; Yu, Dennis; Santos, Gil Nonato; Rodulfo, Emmanuel

    2016-06-15

    The generalized gradient approximation (GGA) to density functional theory (DFT) calculations indicate that the highly localized states derived from the defects of nitrogen doped carbon nanotube with divacancy (4ND-CNxNT) contribute to strong Sc and Ti bindings, which prevent metal aggregation. Comparison of the H2 adsorption capability of Sc over Ti-decorated 4ND-CNxNT shows that Ti cannot be used for reversible H2 storage due to its inherent high adsorption energy. The Sc/4ND-CNxNT possesses favorable adsorption and consecutive adsorption energy at the local-density approximation (LDA) and GGA level. Molecular dynamics (MD) study confirmed that the interaction between molecular hydrogen and 4ND-CNxNT decorated with scandium is indeed favorable. Simulations indicate that the total amount of adsorption is directly related to the operating temperature and pressure. The number of absorbed hydrogen molecules almost logarithmically increases as the pressure increases at a given temperature. The total excess adsorption of hydrogen on the (Sc/4ND)10-CNxNT arrays at 300 K is within the range set by the department of energy (DOE) with a value of at least 5.85 wt%.

  15. TA-55 change control manual

    Energy Technology Data Exchange (ETDEWEB)

    Blum, T.W.; Selvage, R.D.; Courtney, K.H.

    1997-11-01

    This manual is the guide for initiating change at the Plutonium Facility, which handles the processing of plutonium as well as research on plutonium metallurgy. It describes the change and work control processes employed at TA-55 to ensure that all proposed changes are properly identified, reviewed, approved, implemented, tested, and documented so that operations are maintained within the approved safety envelope. All Laboratory groups, their contractors, and subcontractors doing work at TA-55 follow requirements set forth herein. This manual applies to all new and modified processes and experiments inside the TA-55 Plutonium Facility; general plant project (GPP) and line item funded construction projects at TA-55; temporary and permanent changes that directly or indirectly affect structures, systems, or components (SSCs) as described in the safety analysis, including Facility Control System (FCS) software; and major modifications to procedures. This manual does not apply to maintenance performed on process equipment or facility SSCs or the replacement of SSCs or equipment with documented approved equivalents.

  16. 55th Annual Fuze Conference

    Science.gov (United States)

    2011-05-26

    supporting piezoresistive elements  Full Wheatstone - bridge  Functional principle:  Inertial forces cause deflection of plate  Straining of...Approval Process Gabe Soto, Chairman, Fuze and Initiation System Technical Review Panel Air Force Safety Approval Process Matt Bridge OPEN SESSIONS...Matt Bridge  11:50 Harry Diamond Fuzing Excellence Award Ceremony  12:00 Lunch May 25, 2011 - General Session (AM) 55th Annual Fuze

  17. Effects of scandium addition on iron-bearing phases and tensile properties of Al–7Si–0.6Mg alloys

    Energy Technology Data Exchange (ETDEWEB)

    Tzeng, Yu-Chih [Department of Mechanical Engineering, National Central University, Jhongli, Taiwan (China); Wu, Chih-Ting [Department of Vehicle Engineering, Army Academy R.O.C., Jhongli, Taiwan (China); Bor, Hui-Yun; Horng, Jain-Long; Tsai, Mu-Lin [Department of Mechanical Engineering, National Central University, Jhongli, Taiwan (China); Institute of Materials Science and Engineering, National Central University, Jhongli, Taiwan (China); Lee, Sheng-Long, E-mail: shenglon@cc.ncu.edu.tw [Department of Mechanical Engineering, National Central University, Jhongli, Taiwan (China); Institute of Materials Science and Engineering, National Central University, Jhongli, Taiwan (China)

    2014-01-21

    Iron is the most deleterious impurity in aluminum alloys and can easily combine with aluminum to form an acicular β-Al{sub 5}FeSi phase that reduces ductility during the solidification of the molten metal. Adding scandium (Sc) to Al–7Si–0.6Mg alloys can transform the acicular β-Al{sub 5}FeSi phase into a comparatively harmless nodular Sc–Fe phase (Al{sub 12}Si{sub 6}Fe{sub 2}(Mg,Sc){sub 5}). This Sc–Fe phase has a lower hardness and elastic modulus than the β-Al{sub 5}FeSi phase; it is thus less likely to initiate cracks in the Al matrix. Moreover, the nodular Sc–Fe phase can improve the fluidity of Al during solidification, reducing interdendritic shrinkage. Tensile testing measurements showed that the elongation of Al–7Si–0.6Mg alloys with 0.04 and 0.12 wt% Sc can be respectively increased by 115% and 110% compared to Al–7Si–0.6Mg without Sc. The corresponding quality indices are increased by 17% and 19%, respectively, suggesting that the tensile properties of Al–7Si–0.6Mg alloys can be enhanced by adding scandium.

  18. Separation of (44)Ti from proton irradiated scandium by using solid-phase extraction chromatography and design of (44)Ti/(44)Sc generator system.

    Science.gov (United States)

    Radchenko, V; Meyer, C A L; Engle, J W; Naranjo, C M; Unc, G A; Mastren, T; Brugh, M; Birnbaum, E R; John, K D; Nortier, F M; Fassbender, M E

    2016-12-16

    Scandium-44g (half-life 3.97h [1]) shows promise for positron emission tomography (PET) imaging of longer biological processes than that of the current gold standard, (18)F, due to its favorable decay parameters. One source of (44g)Sc is the long-lived parent nuclide (44)Ti (half-life 60.0 a). A (44)Ti/(44g)Sc generator would have the ability to provide radionuclidically pure (44g)Sc on a daily basis. The production of (44)Ti via the (45)Sc(p,2n) reaction requires high proton beam currents and long irradiation times. Recovery and purification of no-carrier added (nca) (44)Ti from scandium metal targets involves complex separation chemistry. In this study, separation systems based on solid phase extraction chromatography were investigated, including branched diglycolamide (BDGA) resin and hydroxamate based ZR resin. Results indicate that ZR resin in HCl media represents an effective (44)Ti/(44g)Sc separation system. Copyright © 2016 Elsevier B.V. All rights reserved.

  19. TA-55 and Sigma Overview

    Energy Technology Data Exchange (ETDEWEB)

    Spearing, Dane Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Safeguards Science and Technology Group (NEN-1)

    2016-11-29

    These are slides from a facility overview presentation for visiting agencies to Los Alamos National Laboratory (LANL). The TA-55 Plutonium Facility (PF-4) is discussed in detail. PF-4 is a unique resource for US plutonium programs. The basic design is flexible and has adapted to changing national needs. It is a robust facility with strong safety and security implementation. It supports a variety of national programs. It will continue for many years into the future. Sigma is then discussed in detail, which handles everything from hydrogen to uranium. It has been in long term service to the Nation (nearly 60 years). It has a flexible authorization basis to handle almost the entire periodic table. It has a wide breadth of prototyping and characterization capabilities. It has integrated program and line management.

  20. Gd-Sc-based mixed-metal nitride cluster fullerenes: mutual influence of the cage and cluster size and the role of scandium in the electronic structure.

    Science.gov (United States)

    Svitova, Anna L; Popov, Alexey A; Dunsch, Lothar

    2013-03-18

    The influence of the cage as well as of the cluster size has been studied in Gd-Sc nitride cluster fullerenes, which have been synthesized and isolated for these studies. A series of carbon cages ranging from C78 to C88 have been synthesized, isolated, and characterized in detail using absorption and vibrational spectroscopy as well as electrochemistry and density functional theory calculations. Gd-Sc mixed-metal cluster fullerenes in carbon cages different from C80 were described for the first time. A review of their structures, properties, and stability is given. The synthesis was performed with melamine as an effective solid source of nitrogen, providing high fullerene yield and suppressing empty fullerene formation. Substitution of gadolinium by scandium imposes a noticeable influence on the electronic structure of nitride cluster fullerenes as revealed by electrochemical, spectroscopic, and computational methods.

  1. Copper scandium zirconium phosphate

    DEFF Research Database (Denmark)

    Bond, Andrew David; Warner, Terence Edwin

    2013-01-01

    components. The [Sc(III)Zr(IV)(PO(4))(3)](2-) framework is composed of corner-sharing Sc/ZrO(6) octahedra and PO(4) tetrahedra. The Sc and Zr atoms are disordered on one atomic site on a crystallographic threefold axis. The P atom of the phosphate group lies on a crystallographic twofold axis. Nonframework...

  2. Alzheimer's Deaths Jump 55 Percent: CDC

    Science.gov (United States)

    ... page: https://medlineplus.gov/news/fullstory_165941.html Alzheimer's Deaths Jump 55 Percent: CDC More patients also ... News) -- As more baby boomers age, deaths from Alzheimer's disease have jumped 55 percent, and in a ...

  3. 7 CFR 3565.55 - Participation loans.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Participation loans. 3565.55 Section 3565.55 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, DEPARTMENT OF AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Guarantee Requirements § 3565.55 Participation loans...

  4. 7 CFR 1700.55 - Telecommunications Program.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Telecommunications Program. 1700.55 Section 1700.55... AGRICULTURE GENERAL INFORMATION Loan and Grant Approval Authorities § 1700.55 Telecommunications Program. (a..., Telecommunications Program, has the authority to approve the following loans, loan guarantees, and lien...

  5. 27 CFR 71.55 - Content.

    Science.gov (United States)

    2013-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2013-04-01 2013-04-01 false Content. 71.55 Section 71.55 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE... Citations § 71.55 Content. (a) Citation for the suspension, revocation or annulment of a permit shall be...

  6. 27 CFR 200.55 - Content.

    Science.gov (United States)

    1999-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 1999-04-01 1999-04-01 false Content. 200.55 Section 200.55 ALCOHOL, TOBACCO AND OTHER EXCISE TAXES-Continued RULES OF PRACTICE IN PERMIT PROCEEDINGS Hearing Procedure Citations § 200.55 Content. (a) Citation for the suspension, revocation or annulment of...

  7. 27 CFR § 71.55 - Content.

    Science.gov (United States)

    2017-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2017-04-01 2017-04-01 false Content. § 71.55 Section § 71.55 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT... Procedure Citations § 71.55 Content. (a) Citation for the suspension, revocation or annulment of a permit...

  8. 10 CFR 55.46 - Simulation facilities.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Simulation facilities. 55.46 Section 55.46 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) OPERATORS' LICENSES Written Examinations and Operating Tests § 55.46... simulator utilizes models relating to nuclear and thermal-hydraulic characteristics that replicate the most...

  9. 21 CFR 821.55 - Confidentiality.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Confidentiality. 821.55 Section 821.55 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES MEDICAL DEVICE TRACKING REQUIREMENTS Records and Inspections § 821.55 Confidentiality. (a) Any patient...

  10. 34 CFR 668.55 - Updating information.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Updating information. 668.55 Section 668.55 Education... Information § 668.55 Updating information. (a)(1) Unless the provisions of paragraph (a)(2) or (a)(3) of this... applicant to verify the information contained in his or her application for assistance in an award year if...

  11. 28 CFR 55.19 - Written materials.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Written materials. 55.19 Section 55.19... RIGHTS ACT REGARDING LANGUAGE MINORITY GROUPS Minority Language Materials and Assistance § 55.19 Written materials. (a) Types of materials. It is the obligation of the jurisdiction to decide what materials must be...

  12. 40 CFR 96.55 - Banking.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 96.55 Section 96.55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NOX BUDGET... Tracking System § 96.55 Banking. (a) NOX allowances may be banked for future use or transfer in a...

  13. 10 CFR 55.23 - Certification.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Certification. 55.23 Section 55.23 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) OPERATORS' LICENSES Medical Requirements § 55.23 Certification. To certify... complete and sign NRC Form 396, “Certification of Medical Examination by Facility Licensee,” which can be...

  14. 39 CFR 3020.55 - Review.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Review. 3020.55 Section 3020.55 Postal Service... the Product Lists Described Within the Mail Classification Schedule § 3020.55 Review. The Commission shall review the request, the Postal Service reply, and any public comment to determine whether the...

  15. 42 CFR 71.55 - Dead bodies.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Dead bodies. 71.55 Section 71.55 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES QUARANTINE, INSPECTION, LICENSING FOREIGN QUARANTINE Importations § 71.55 Dead bodies. The remains of a person who died of a communicable disease...

  16. 28 CFR 5.5 - Registration fees.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Registration fees. 5.5 Section 5.5 Judicial Administration DEPARTMENT OF JUSTICE ADMINISTRATION AND ENFORCEMENT OF FOREIGN AGENTS REGISTRATION ACT OF 1938, AS AMENDED § 5.5 Registration fees. (a) A registrant shall pay a registration fee with...

  17. 49 CFR 192.55 - Steel pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Steel pipe. 192.55 Section 192.55 Transportation... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Materials § 192.55 Steel pipe. (a) New steel pipe is... in accordance with paragraph (c) or (d) of this section. (b) Used steel pipe is qualified for use...

  18. 7 CFR 701.55 - Nursery.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Nursery. 701.55 Section 701.55 Agriculture Regulations... ADMINISTERED UNDER THIS PART § 701.55 Nursery. (a) Subject to the other eligibility provisions of this part... under this section for the cost of removing nursery debris such as nursery structures, shade houses, and...

  19. 10 CFR 30.55 - Tritium reports.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Tritium reports. 30.55 Section 30.55 Energy NUCLEAR..., Inspections, Tests, and Reports § 30.55 Tritium reports. (a)-(b) (c) Except as specified in paragraph (d) of this section, each licensee who is authorized to possess tritium shall report promptly to the...

  20. 14 CFR 437.55 - Hazard analysis.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Hazard analysis. 437.55 Section 437.55... TRANSPORTATION LICENSING EXPERIMENTAL PERMITS Safety Requirements § 437.55 Hazard analysis. (a) A permittee must... safety of property resulting from each permitted flight. This hazard analysis must— (1) Identify and...

  1. 7 CFR 1724.55 - Dam safety.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Dam safety. 1724.55 Section 1724.55 Agriculture... § 1724.55 Dam safety. (a) The provisions of this section apply only to RUS financed electric system... for Dam Safety,”(Guidelines), as applicable. A dam, as more fully defined in the Guidelines, is...

  2. 40 CFR 205.55 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirements. 205.55 Section 205.55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.55 Requirements. ...

  3. 10 CFR 1003.55 - OHA evaluation.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false OHA evaluation. 1003.55 Section 1003.55 Energy DEPARTMENT... Rescission § 1003.55 OHA evaluation. (a)(1) The OHA may initiate an investigation of any statement in an application and utilize in its evaluation any relevant facts obtained by such investigation. The OHA may...

  4. 46 CFR 503.55 - Derivative classification.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 9 2010-10-01 2010-10-01 false Derivative classification. 503.55 Section 503.55... Security Program § 503.55 Derivative classification. (a) In accordance with Part 2 of Executive Order 12958... derivative classification. (1) Derivative classification includes the classification of information based on...

  5. 40 CFR 204.55 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirements. 204.55 Section 204.55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS NOISE EMISSION STANDARDS FOR CONSTRUCTION EQUIPMENT Portable Air Compressors § 204.55 Requirements. ...

  6. 32 CFR 154.55 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Requirements. 154.55 Section 154.55 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE SECURITY DEPARTMENT OF DEFENSE PERSONNEL SECURITY PROGRAM REGULATION Unfavorable Administrative Actions § 154.55 Requirements. (a) General. For...

  7. 40 CFR 204.55-2 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirements. 204.55-2 Section 204.55... NOISE EMISSION STANDARDS FOR CONSTRUCTION EQUIPMENT Portable Air Compressors § 204.55-2 Requirements. (a... requirements for purposes of testing by the Administrator and Selective Enforcement Auditing consist of: (1...

  8. 21 CFR 173.55 - Polyvinylpyrrolidone.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Polyvinylpyrrolidone. 173.55 Section 173.55 Food... Polymer Substances and Polymer Adjuvants for Food Treatment § 173.55 Polyvinylpyrrolidone. The food additive polyvinylpyrroli-done may be safely used in accordance with the following prescribed conditions...

  9. 33 CFR 159.55 - Identification.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Identification. 159.55 Section 159.55 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.55 Identification. (a) Each...

  10. Synthesis and characterization of reduced scandium halide containing one- and two-dimensional metal bonded arrays. [Sc--ScCl3; Cs3Sc2Cl9; CsScCl3

    Energy Technology Data Exchange (ETDEWEB)

    Poeppelmeier, K.R.

    1978-08-01

    The stabilization effect of metal-metal bond formation on reduced scandium compounds was studied. The binary compounds Sc/sub 7/Cl/sub 12/, Sc/sub 5/Cl/sub 8/, Sc/sub 7/Cl/sub 10/ and ScCl were prepared by high temperature techniques and were characterized by single crystal x-ray diffraction. The respective metal arrays in these compounds can be viewed as fragments of scandium metal ranging from discrete six atom metal cluster species (Sc(Sc/sub 6/Cl/sub 12/)), through intermediate single and double infinite chain configurations ((ScCl/sub 2/)(Sc/sub 4/Cl/sub 6/)) and ((ScCl/sub 2/)(Sc/sub 6/Cl/sub 8/)) to double metal close-packed sheets (ScCl). The halogen atoms effectively isolate the clusters, chains and sheets by bonding face, edge or exo positions on the metal arrays. The common occurrence of isolated scandium (III) ions emphasizes that a minimum number of bonding electrons is required to stabilize what are formally anionic metal arrays. The distribution of the reduction electrons in these anisotropic materials was studied by magnetic susceptibility, EPR and uv-X photoelectron spectroscopy. The ternary compounds studied were Cs/sub 3/Sc/sub 2/Cl/sub 9/ and CsScCl/sub 3/. The anion-bridged metal chain of the hexagonal perovskite structure was found to stabilize scandium (II). CsScCl/sub 3/ was found to be grossly nonstoichiometric on the transition metal site and the effects of the mixed valence character were studied between the single valence extremes Cs/sub 3/Sc/sub 2 + x/Cl/sub 9/; 0< x < 1.0.

  11. Scandium functionalized carbon aerogel: Synthesis of nanoparticles and structure of a new ScOCl and properties of NaAlH{sub 4} as a function of pore size

    Energy Technology Data Exchange (ETDEWEB)

    Javadian, Payam; Nielsen, Thomas K. [Center for Energy Materials, Interdisciplinary Nanoscience Center (iNANO), and Department of Chemistry, Aarhus University, DK-8000 Aarhus (Denmark); Ravnsbæk, Dorthe B. [Department of Material Science and Engineering, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge 02142, MA (United States); Jepsen, Lars H. [Center for Energy Materials, Interdisciplinary Nanoscience Center (iNANO), and Department of Chemistry, Aarhus University, DK-8000 Aarhus (Denmark); Polanski, Marek [Faculty of Advanced Technology and Chemistry, Military University of Technology, 2 Kaliskiego Str., 00-908 Warsaw (Poland); Plocinski, Tomasz [Faculty of Material Science and Engineering, Warsaw University of Technology, 144 Woloska Str., 02-507 Warsaw (Poland); Kunce, Izabela [Faculty of Advanced Technology and Chemistry, Military University of Technology, 2 Kaliskiego Str., 00-908 Warsaw (Poland); Besenbacher, Flemming [Interdisciplinary Nanoscience Center (iNANO) and Department of Physics and Astronomy, Aarhus University, DK-8000 Aarhus C (Denmark); Bystrzycki, Jerzy [Faculty of Advanced Technology and Chemistry, Military University of Technology, 2 Kaliskiego Str., 00-908 Warsaw (Poland); Jensen, Torben R., E-mail: trj@chem.au.dk [Center for Energy Materials, Interdisciplinary Nanoscience Center (iNANO), and Department of Chemistry, Aarhus University, DK-8000 Aarhus (Denmark)

    2015-11-15

    A new method for scandium-functionalization of carbon aerogels forming nanoparticles of a new scandiumoxochloride, ScOCl is presented. Sodium aluminiumhydride, NaAlH{sub 4}, is successfully melt infiltrated into the nano porous scaffolds with pore sizes of D{sub max}=7, 10, 13, 21, 26 and 39 nm, containing scandium based nano particles (<2.9 wt%) confirmed by elemental analysis and scanning electron microscopy. A systematic study of hydrogen storage properties of the nano composite materials is presented. An aqueous solution of ScCl{sub 3} was initially infiltrated and formed nanoconfined [Sc(OH)(H{sub 2}O){sub 5}]{sub 2}Cl{sub 4}(H{sub 2}O){sub 2}, which transforms to nanoparticles of a new scandium oxochloride, ScOCl at 192 °C and to Sc{sub 2}O{sub 3} at 420 °C. ScOCl crystallizes in an orthorhombic unit cell a=3.4409(8), b=3.9613(6) and c=8.178(2) Å, space group Pmmn, and is built from layers of [ScO{sub 4}Cl{sub 2}] octahedra forming neutral ScOCl layers. Temperature programmed desorption mass spectroscopy shows slightly improved kinetics for release of hydrogen with decreasing pore size. Continuous cycling of hydrogen release and uptake measured by the Sieverts' method reveal a larger preserved hydrogen storage capacity for scandium-functionalized aerogel with the larger pores (39 nm). - Highlights: • New synthesis approach for nanoporous Sc-functionalization carbon aerogel (Sc-CA). • The new scandium oxochloride, ScOCl, structure is obtained. • NaAlH{sub 4} nanoconfined in Sc-CA with pores ranging between 7 nm

  12. 7 CFR 52.55 - Political activity.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Political activity. 52.55 Section 52.55 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946...

  13. 40 CFR 716.55 - Confidentiality claims.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Confidentiality claims. 716.55 Section... ACT HEALTH AND SAFETY DATA REPORTING General Provisions § 716.55 Confidentiality claims. (a)(1... clearly identify the material subject to the claim. (3) Any respondent may assert a confidentiality claim...

  14. The over-55s and sexual orientation

    NARCIS (Netherlands)

    Jantine van Lisdonk; Lisette Kuyper

    2015-01-01

    Original title: 55-plussers en seksuele oriëntatie This report is about lesbian, gay and bisexual (LGB) people aged 55 and over in the Netherlands. Compared with earlier research, we find a striking number of correspondences between LGB and heterosexual people in this age group in terms

  15. 10 CFR 76.55 - Timely renewal.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Timely renewal. 76.55 Section 76.55 Energy NUCLEAR... renewal. In any case in which the Corporation has timely filed a sufficient application for a certificate of compliance, the existing certificate of compliance or approved compliance plan does not expire...

  16. 7 CFR 946.55 - Safeguards.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Safeguards. 946.55 Section 946.55 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... transportation of potatoes for grading and storing to points outside the production area. (b) Safeguards provided...

  17. 40 CFR 97.55 - Banking.

    Science.gov (United States)

    2010-07-01

    ... Banking. NOX allowances may be banked for future use or transfer in a compliance account, an overdraft... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.55 Section 97.55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX...

  18. 36 CFR 5.5 - Commercial photography.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Commercial photography. 5.5... COMMERCIAL AND PRIVATE OPERATIONS § 5.5 Commercial photography. (a) Motion pictures, television. Before any... Federal Regulations. (b) Still photography. The taking of photographs of any vehicle, or other articles of...

  19. 10 CFR 55.45 - Operating tests.

    Science.gov (United States)

    2010-01-01

    ... facility's auxiliary and emergency systems, including operation of those controls associated with plant... 10 Energy 2 2010-01-01 2010-01-01 false Operating tests. 55.45 Section 55.45 Energy NUCLEAR... to accomplish a representative sample from among the following 13 items. (1) Perform pre-startup...

  20. 49 CFR 229.55 - Piston travel.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Piston travel. 229.55 Section 229.55... Piston travel. (a) Brake cylinder piston travel shall be sufficient to provide brake shoe clearance when... piston travel may not exceed 11/2 inches less than the total possible piston travel. The total possible...

  1. 7 CFR 985.55 - Identification.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Identification. 985.55 Section 985.55 Agriculture... Identification. (a) Each producer shall, under supervision of the Committee, identify each class of oil within 15... approval of the Secretary. Identification of oil shall be accomplished before its delivery either to a...

  2. 27 CFR 6.55 - Display service.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Display service. 6.55... OF THE TREASURY LIQUORS âTIED-HOUSEâ Unlawful Inducements Paying for Advertising, Display Or Distribution Service § 6.55 Display service. Industry member reimbursements to retailers for setting up product...

  3. 15 CFR 5.5 - Vending machines.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Vending machines. 5.5 Section 5.5... machines. (a) The income from any vending machines which are located within reasonable proximity to and are... shall be assigned to the operator of such stand. (b) If a vending machine vends articles of a type...

  4. 29 CFR 1956.55 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false 1956.55 Section 1956.55 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) STATE PLANS FOR THE DEVELOPMENT AND ENFORCEMENT OF STATE STANDARDS APPLICABLE TO STATE AND LOCAL GOVERNMENT EMPLOYEES...

  5. The use of the erbium, chromium:yttrium-scandium-gallium-garnet laser in endodontic treatment: the results of an in vitro study.

    Science.gov (United States)

    Schoop, Ulrich; Goharkhay, Kawe; Klimscha, Johannes; Zagler, Manuela; Wernisch, Johann; Georgopoulos, Apostolos; Sperr, Wolfgang; Moritz, Andreas

    2007-07-01

    The use of the erbium, chromium:yttrium-scandium-gallium-garnet (Er,Cr:YSGG) laser has become accepted in the field of cavity preparation. The development of miniaturized and flexible fiber tips has allowed this device to be used in endodontics. The authors conducted an in vitro study to assess the effects of Er,Cr:YSGG laser irradiation on root canals. The authors inoculated root canals with two bacteria, laser irradiated them at two power settings and subjected them to a quantitative microbiological evaluation. They used scanning electron microscopy (SEM) to assess morphological changes in endodontically processed and laser-irradiated root canal walls. They measured temperature increases on the root surface to determine possible thermal side effects. The bacteriological evaluation revealed a disinfecting effect in the root dentin samples that was dependent on the output power but not specific for the bacterial species investigated. SEM showed the removal of the smear layer from the root canal walls and the exposure of dentinal tubules. The temperature rise during irradiation was moderate when standardized power settings were used. The Er,Cr:YSGG laser can be used to eliminate bacteria in root canals. It also effectively removes smear layer and debris from the canal wall. Practitioners can use the Er,Cr:YSGG laser to prepare root canals for endodontic therapy.

  6. Aluminum-Scandium Alloys: Material Characterization, Friction Stir Welding, and Compatibility With Hydrogen Peroxide (MSFC Center Director's Discretionary Fund Final Report, Proj. No. 04-14)

    Science.gov (United States)

    Lee, J. A.; Chen, P. S.

    2004-01-01

    This Technical Memorandum describes the development of several high-strength aluminum (Al) alloys that are compatible with hydrogen peroxide (H2O2) propellant for NASA Hypersonic-X (Hyper-X) vehicles fuel tanks and structures. The yield strengths for some of these Al-magnesium-based alloys are more than 3 times stronger than the conventional 5254-H112 Al alloy, while maintaining excellent H2O2 compatibility similar to class 1 5254 alloy. The alloy development strategy is to add scandium, zirconium, and other transitional metals with unique electrochemical properties, which will not act as catalysts, to decompose the highly concentrated 90 percent H2O2. Test coupons are machined from sheet metals for H2O2 long-term exposure testing and mechanical properties testing. In addition, the ability to weld the new alloys using friction stir welding has also been explored. The new high-strength alloys could represent an enabling material technology for Hyper-X vehicles, where flight weight reduction is a critical requirement.

  7. High-fluence and high-density treatment of perioral rhytides using a new, fractionated 2,790-nm ablative erbium-doped Yttrium Scandium Gallium Garnet Laser.

    Science.gov (United States)

    Ciocon, David H; Hussain, Mussarat; Goldberg, David J

    2011-06-01

    In this study, we evaluated the safety and efficacy of a novel 2,790-nm erbium-doped yttrium scandium gallium garnet (Er:YSGG) laser system for the treatment of facial photodamage and perioral wrinkles using a single-treatment, high-fluence, high-density protocol. Eleven female participants with Fitzpatrick skin types II to III and facial wrinkles underwent a single full-face fractional ablative treatment with a 2,790-nm Er:YSGG laser. Follow-up visits were completed at 1, 2, and 6 weeks 3 and 6 months. Quartile improvement scale (0-4) and Fitzpatrick wrinkle scores (1-9) were used for the assessments. Based on blinded photographic assessments, the mean difference in Fitzpatrick wrinkle scores for full face wrinkles was 1.5 ± 1.2 (a reduction from 6.6 to 5.1; paired t-test, p = .003). There was also a statistically significant mean reduction of 1.7 ± 1.3 in perioral wrinkle scores (from 6.7 to 5.0; p = .002). No serious adverse events were reported. A novel, fractionated, ablative 2,790-nm Er:YSGG laser can safely and effectively treat photodamage and perioral wrinkles in a single treatment using a high-fluence, high-density protocol. Cutera provided the equipment used in this study and funding to Dr. Goldberg. © 2011 by the American Society for Dermatologic Surgery, Inc.

  8. Impact of layer and substrate properties on the surface acoustic wave velocity in scandium doped aluminum nitride based SAW devices on sapphire

    Energy Technology Data Exchange (ETDEWEB)

    Gillinger, M., E-mail: manuel.gillinger@tuwien.ac.at; Knobloch, T.; Schneider, M.; Schmid, U. [Institute of Sensor and Actuator Systems, TU Wien, 1040 Vienna (Austria); Shaposhnikov, K.; Kaltenbacher, M. [Institute of Mechanics and Mechatronics, TU Wien, 1040 Vienna (Austria)

    2016-06-06

    This paper investigates the performance of surface acoustic wave (SAW) devices consisting of reactively sputter deposited scandium doped aluminum nitride (Sc{sub x}Al{sub 1-x}N) thin films as piezoelectric layers on sapphire substrates for wireless sensor or for RF-MEMS applications. To investigate the influence of piezoelectric film thickness on the device properties, samples with thickness ranging from 500 nm up to 3000 nm are fabricated. S{sub 21} measurements and simulations demonstrate that the phase velocity is predominantly influenced by the mass density of the electrode material rather than by the thickness of the piezoelectric film. Additionally, the wave propagation direction is varied by rotating the interdigital transducer structures with respect to the crystal orientation of the substrate. The phase velocity is about 2.5% higher for a-direction compared to m-direction of the sapphire substrate, which is in excellent agreement with the difference in the anisotropic Young's modulus of the substrate corresponding to these directions.

  9. Jõgevamaa ettevõtete TOP 55

    Index Scriptorium Estoniae

    2004-01-01

    Jõgevamaa ettevõtete TOP 55 aastal 2003. Käibe TOP 40. Kasumi TOP 40. Käibe kasvu TOP 20. Kasumi kasvu TOP 20. Rentaabluse TOP 20. Omakapitali tootlikkuse TOP 20. Jõgevamaa firmade üld- ja finantsandmed

  10. Kuidas tähistame 55ndat

    Index Scriptorium Estoniae

    2004-01-01

    Tallinna Tehnikaülikooli rahvatantsuansambli Kuljus 55. juubeli tähistamisest kontserdiseeriaga Narva kultuurikeskuses Geneva 22. apr., Pärnu Endla teatrimajas 23. apr. ja Tallinna Linnahallis 24. aprillil

  11. 27 CFR 18.55 - Label.

    Science.gov (United States)

    2010-04-01

    ... TREASURY LIQUORS PRODUCTION OF VOLATILE FRUIT-FLAVOR CONCENTRATE Operations § 18.55 Label. Each container...; (d) the number of wine gallons; and (e) the percent of alcohol by volume. (Approved by the Office of...

  12. Structure and temperature effects on Nd3+ spectra in polycrystalline mixed scandium aluminum garnets Y3ScxAl5-xO12

    Science.gov (United States)

    Lupei, A.; Lupei, V.; Hau, S.; Gheorghe, C.; Voicu, F.

    2015-09-01

    New spectroscopic data obtained from high resolution low temperature absorption and emission spectra of Nd3+ in mixed scandium aluminum garnets Y3ScxAl5-xO12 - (x = 0-2) translucent ceramics revealed transition dependent composition effects: modification of the shapes (Lorentz at x = 0 and 2, quasi-Gauss at x = 1, x-dependent asymmetric for other x values, with obvious multicenter structure for low x), widths and shifts of the lines. Nd3+ electronic structure dependence on structural changes with composition is analyzed in terms of nephelauxetic effect and maximum splitting of manifolds: Sc3+ co-doping reduces the nephelauxetic effect, and the increase of 4F3/2 splitting from 85 cm-1 (x = 0) to 98 cm-1 (x = 2) denotes the lowering of local symmetry. The multicenter structure and inhomogeneous broadening of Nd3+ lines is attributed to crystal field distributions determined by the random occupancy of the octahedral sites by Sc3+ and Al3+. For low x (0.2) the resolved two satellites S1, S2 that accompany Nd:YAG lines are correlated to anisotropic crystal field perturbations produced by the n.n. Sc3+ by analogy to those determined by Y3+-antisites (excess of Y3+ ions that enter in octahedral sites of the melt-grown YAG crystals). The temperature evolution of the Nd3+ spectral characteristics (line intensity, shift, broadening) in the 10-300 K range is analyzed in terms of thermal population of the Stark levels, of the effect on electron-phonon interaction and on lattice expansion. The relevance of the spectroscopic properties on the laser emission characteristics in these systems is discussed.

  13. Dissolved scandium, yttrium, and lanthanum in the surface waters of the North Atlantic: Potential use as an indicator of scavenging intensity

    Science.gov (United States)

    Till, C. P.; Shelley, R. U.; Landing, W. M.; Bruland, K. W.

    2017-08-01

    Recent work has begun to elucidate the biogeochemical cycling of scandium (Sc) in the open ocean, but so far no surface distribution data have been reported of dissolved Sc, and no basin-scale surface distributions have been reported of yttrium (Y) or lanthanum (La). This work presents basin-wide surface Sc, Y, and La data in a section across the North Atlantic subtropical gyre (2011 GEOTRACES GA03) and investigates the potential utility of these distributions. This work uses dissolved and aerosol concentration data for La and Sc to estimate their surface ocean residence times in both the center of the oligotrophic gyre and near the African coastline. This work additionally shows that the surface distribution of Sc in the North Atlantic correlates with the shape of the gyre as inferred by isotherm depth, with lower Sc concentrations at the gyre boundaries. This pattern suggests that Sc could be drawn down by the elevated particle flux at the gyre boundaries. In this case, Sc removal could be used as an indicator of scavenging intensity. In order to account for variable input of Sc to the surface ocean, we propose normalizing the Sc distribution to that of Y or La, which are much less particle reactive and are input via dust to the surface North Atlantic in constant ratios with Sc. Such normalization improves the correlation with isotherm depth. We propose that the variations in dissolved Y/Sc and La/Sc ratios may be due to preferential Sc scavenging and could therefore indicate scavenging intensity.

  14. On new ternary equiatomic scandium transition metal aluminum compounds ScTAl with T = Cr, Ru, Ag, Re, Pt, and Au

    Energy Technology Data Exchange (ETDEWEB)

    Radzieowski, Mathis; Janka, Oliver [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Benndorf, Christopher [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Muenster Univ. (Germany). Inst. fuer Physikalische Chemie; Haverkamp, Sandra [Muenster Univ. (Germany). Inst. fuer Physikalische Chemie; Eckert, Hellmut [Muenster Univ. (Germany). Inst. fuer Physikalische Chemie; University of Sao Paulo, Sao Carlos, SP (Brazil). Inst. of Physics

    2016-08-01

    The new equiatomic scandium transition metal aluminides ScTAl for T = Cr, Ru, Ag, Re, Pt, and Au were obtained by arc-melting of the elements followed by subsequent annealing for crystal growth. The samples were studied by powder and single crystal X-ray diffraction. The structures of three compounds were refined from single crystal X-ray diffractometer data: ScCrAl, MgZn{sub 2} type, P6{sub 3}/mmc, a = 525.77(3), c = 858.68(5) pm, R{sub 1} = 0.0188, wR{sub 2} = 0.0485, 204 F{sup 2} values, 13 variables, ScPtAl, TiNiSi type, Pnma, a = 642.83(4), b = 428.96(2), c = 754.54(5) pm, R{sub 1} = 0.0326, wR{sub 2} = 0.0458, 448 F{sup 2} values, 20 variables and ScAuAl, HfRhSn type, P anti 62c, a = 722.88(4), c = 724.15(4) pm, R{sub 1} = 0.0316, wR{sub 2} = 0.0653, 512 F{sup 2} values, 18 variables. Phase pure samples of all compounds were furthermore investigated by magnetic susceptibility measurements, and Pauli-paramagnetism but no superconductivity was observed down to 2.1 K for all of them. The local structural features and disordering phenomena have been characterized by {sup 27}Al and {sup 45}Sc magic angle spinning (MAS) and static NMR spectroscopic investigations.

  15. Treatment of infraorbital dark circles in atopic dermatitis with a 2790-nm erbium: yttrium scandium gallium garnet laser: a pilot study.

    Science.gov (United States)

    Park, Kui Young; Oh, In Young; Moon, Nam Ju; Seo, Seong Jun

    2013-04-01

    Although many Asian atopic patients have orbital darkening symptom and the demand to treat this condition is increasing, little has been reported in the literature on the treatment of infraorbital dark circles in atopic dermatitis. To evaluate the clinical efficacy and safety of 2790-nm erbium:yttrium scandium gallium garnet (Er:YSGG) laser therapy for reducing infraorbital dark circles in atopic dermatitis patients. Ten Korean patients over 21 year with mild atopic dermatitis and infraorbital dark circles were enrolled in this study. Patients who need active atopic dermatitis treatments are excluded because of the possibility of aggravation after laser treatment. They were treated for dark circles using a 2790-nm Er:YSGG laser. The treatment parameters were 1.8-2.2 J/cm² fluence, 6-mm spot size, and 0.3-ms pulse width with 10% overlap over the infraorbital areas once with a 4-week interval between treatments. Efficacy was assessed with a quartile grading score ranging from 0 to 5 by a blinded investigator, and the patients also documented their degree of satisfaction with the same grading score. All possible side effects were evaluated. The clinical assessment showed 74.5% (2.7) and 72.5% (2.5) improvements, and the patient satisfaction scale scores improved an average of 74% (2.4) and 71.5% (2.3) at 2 months and 4 months after treatment, respectively. There were no severe side effects or aggravation of atopic dermatitis. Our study suggests that 2790-nm Er:YSGG laser therapy can be effectively and safely used in the treatment of infraorbital dark circles in atopic dermatitis patients.

  16. The influence of cation ordering, oxygen vacancy distribution and proton siting on observed properties in ceramic electrolytes: the case of scandium substituted barium titanate.

    Science.gov (United States)

    Torino, Nico; Henry, Paul F; Knee, Christopher S; Bjørheim, Tor Svendsen; Rahman, Seikh M H; Suard, Emma; Giacobbe, Carlotta; Eriksson, Sten G

    2017-07-04

    The origin of the 2-order of magnitude difference in the proton conductivity of the hydrated forms of hexagonal and cubic oxygen deficient BaScxTi1-xO3-δ (x = 0.2 and x = 0.7) was probed using a combination of neutron diffraction and density functional theory techniques to support published X-ray diffraction, conductivity, thermogravimetric and differential scanning calorimetry studies. Cation ordering is found in the 6H structure type (space group P63/mmc) adopted by BaSc0.2Ti0.8O3-δ with scandium preferentially substituting in the vertex sharing octahedra (2a crystallographic site) and avoiding the face-sharing octahedra (4f site). This is coupled with oxygen vacancy ordering in the central plane of the face-sharing octahedra (O1 site). In BaSc0.7Ti0.3O3-δ a simple cubic perovskite (space group Pm3[combining macron]m) best represents the average structure from Rietveld analysis with no evidence of either cation ordering or oxygen vacancy ordering. Significant diffuse scattering is observed, indicative of local order. Hydration in both cases leads to complete filling of the available oxygen vacancies and permits definition of the proton sites. We suggest that the more localised nature of the proton sites in the 6H structure is responsible for the significantly lower proton conduction observed in the literature. Within the 6H structure type final model, proton diffusion requires a 3-step process via higher energy proton sites that are unoccupied at room temperature and is also likely to be anisotropic whereas the highly disordered cubic perovskite proton position allows 3-dimensional diffusion by well-described modes. Finally, we propose how this knowledge can be used to further materials design for ceramic electrolytes for proton conducting fuel cells.

  17. 17 CFR 200.55 - Statutory obligations.

    Science.gov (United States)

    2010-04-01

    ... AND ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200.55 Statutory obligations. In administering the law, members of this Commission should vigorously enforce compliance with the law by all... the law and be consistent with the statutory purposes expressed by the Congress. In the exercise of...

  18. 7 CFR 51.55 - Premises.

    Science.gov (United States)

    2010-01-01

    ... of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946... Requirements for Plants Operating Under Continuous Inspection on A Contract Basis § 51.55 Premises. The...

  19. 46 CFR 310.55 - Scholastic requirements.

    Science.gov (United States)

    2010-10-01

    ... MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION TRAINING MERCHANT MARINE TRAINING Admission and Training of Midshipmen at the United States Merchant Marine Academy § 310.55 Scholastic requirements. (a... Chemistry. (ii) 8 other units, preferably chosen from the following fields: (A) Additional mathematics and...

  20. 7 CFR 301.55-1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Inspection Service of the United States Department of Agriculture. Cactus plants. Any of various fleshy... Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE DOMESTIC QUARANTINE NOTICES South American Cactus Moth § 301.55-1 Definitions...

  1. Locks & keys service moves to building 55

    CERN Multimedia

    2012-01-01

    Please note that as of July 12 Locks & keys service will be at building 55 second floor. The opening hours are as follows: 08:30 am to 12:30 pm - 1:30 pm to 5:30 pm. The procedures and rules relating to applications for key and cylinder have not changed. GI-IS Group

  2. 9 CFR 55.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... CONTROL AND ERADICATION OF LIVESTOCK OR POULTRY DISEASES CONTROL OF CHRONIC WASTING DISEASE § 55.1..., caribou, reindeer, and related species. Chronic wasting disease, CWD. A transmissible spongiform encephalopathy of cervids. CWD exposed animal. An animal that is part of a CWD positive herd, or that was part of...

  3. 18 CFR 701.55 - Associate Members.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Associate Members. 701... ORGANIZATION Headquarters Organization § 701.55 Associate Members. (a) The Chairman, with concurrence of the... the work of the Council to become Associate Members. Associate Members, on the same terms and...

  4. 10 CFR 55.13 - General exemptions.

    Science.gov (United States)

    2010-01-01

    ... REGULATORY COMMISSION (CONTINUED) OPERATORS' LICENSES Exemptions § 55.13 General exemptions. The regulations... presence of a licensed operator or senior operator, manipulates the controls of— (1) A research or training reactor as part of the individual's training as a student, or (2) A facility as a part of the individual's...

  5. 45 CFR 5.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Policy § 5.5 Definitions. As used in this part, Agency means any executive department, military... include paper copy, microform, audio-visual materials, and magnetic tapes, cards, and discs. Educational... means any handwritten, typed, or printed documents (such as memoranda, books, brochures, studies...

  6. 27 CFR 7.55 - Comparative advertising.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Comparative advertising. 7..., DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF MALT BEVERAGES Advertising of Malt Beverages § 7.55 Comparative advertising. (a) General. Comparative advertising shall not be disparaging of a...

  7. THE YOUNG OPEN CLUSTER BERKELEY 55

    Energy Technology Data Exchange (ETDEWEB)

    Negueruela, Ignacio; Marco, Amparo, E-mail: ignacio.negueruela@ua.es, E-mail: amparo.marco@ua.es [Departamento de Fisica, Ingenieria de Sistemas y Teoria de la Senal, Universidad de Alicante, Apdo. 99, E-03080 Alicante (Spain)

    2012-02-15

    We present UBV photometry of the highly reddened and poorly studied open cluster Berkeley 55, revealing an important population of B-type stars and several evolved stars of high luminosity. Intermediate-resolution far-red spectra of several candidate members confirm the presence of one F-type supergiant and six late supergiants or bright giants. The brightest blue stars are mid-B giants. Spectroscopic and photometric analyses indicate an age 50 {+-} 10 Myr. The cluster is located at a distance d Almost-Equal-To 4 kpc, consistent with other tracers of the Perseus Arm in this direction. Berkeley 55 is thus a moderately young open cluster with a sizable population of candidate red (super)giant members, which can provide valuable information about the evolution of intermediate-mass stars.

  8. Effects of erbium-and chromium-doped yttrium scandium gallium garnet and diode lasers on the surfaces of restorative dental materials: a scanning electron microscope study.

    Science.gov (United States)

    Hatipoglu, M; Barutcigil, C

    2015-01-01

    The aim of this study is to evaluate the potential effects of laser irradiation, which is commonly performed in periodontal surgery, on the surfaces of restorative materials. Five different restorative dental materials were used in this study, as follows: (1) Resin composite, (2) poly acid-modified resin composite (compomer), (3) conventional glass ionomer cement (GIC), (4) resin-modified glass ionomer cement (RMGIC), and (5) amalgam. Four cylindrical samples (8 mm diameter, 2 mm height) were prepared for each restorative material. In addition, four freshly extracted, sound human incisors teeth were selected. Two different laser systems commonly used in periodontal surgery were examined in this study: A 810 nm diode laser at a setting of 1 W with continuous-phase laser irradiation for 10 s, and an erbium-and chromium-doped yttrium scandium gallium garnet (Er, Cr: YSGG) laser at settings of 2.5 W, 3.25 W, and 4 W with 25 Hz laser irradiation for 10 s. Scanning electron microscopy (SEM) analysis was performed to evaluate the morphology and surface deformation of the restorative materials and tooth surfaces. According to the SEM images, the Er, Cr: YSGG laser causes irradiation markings that appear as demineralized surfaces on tooth samples. The Er, Cr: YSGG laser also caused deep defects on composite, compomer, and RMGIC surfaces because of its high power, and the ablation was deeper for these samples. High-magnification SEM images of GIC samples showed the melting and combustion effects of the Er, Cr: YSGG laser, which increased as the laser power was increased. In amalgam samples, neither laser left significant harmful effects at the lowest power setting. The diode laser did cause irradiation markings, but they were insignificant compared with those left by the Er, Cr: YSGG laser on the surfaces of the different materials and teeth. Within the limitations of this study, it can be concluded that Er, Cr: YSGG laser irradiation could cause distortions of the surfaces

  9. Standardization of (55)Fe by tracing method.

    Science.gov (United States)

    Koskinas, M F; Pires, C A; Yamazaki, I M; Silva, E A; Dias, M S

    2008-01-01

    This work describes the procedure followed by the Laboratório de Metrologia Nuclear (LMN) for the standardization of (55)Fe by the tracing method. This technique was applied using two radionuclides, which decay by the electron capture process followed by a prompt gamma-ray, namely (51)Cr and (54)Mn, as tracers. The calibration was performed in a 4pibeta-gamma coincidence system. The efficiency was obtained by selecting a gamma-ray window set at the 320keV total absorption peak for (51)Cr and at 834keV for (54)Mn.

  10. Dreamweaver CS55 The Missing Manual

    CERN Document Server

    McFarland, David

    2011-01-01

    Dreamweaver is the tool most widely used for designing and managing professional-looking websites, but it's a complex program. That's where Dreamweaver CS5.5: The Missing Manual comes in. With its jargon-free explanations, 13 hands-on tutorials, and savvy advice from Dreamweaver expert Dave McFarland, you'll master this versatile program with ease. Get A to Z guidance. Go from building your first web page to creating interactive, database-driven sites.Build skills as you learn. Apply your knowledge through tutorials and downloadable practice files.Create a state-of-the-art website. Use powerf

  11. Influence of c-axis orientation and scandium concentration on infrared active modes of magnetron sputtered Sc{sub x}Al{sub 1−x}N thin films

    Energy Technology Data Exchange (ETDEWEB)

    Mayrhofer, P. M.; Bittner, A.; Schmid, U. [Institute of Sensor and Actuator Systems, Vienna University of Technology, Floragasse 7, 1040 Vienna (Austria); Eisenmenger-Sittner, C. [Institute of Solid State Physics, Vienna University of Technology, Wiedner Hauptstrasse 8, 1040 Vienna (Austria); Euchner, H. [Institute of Materials Science and Technology, Vienna University of Technology, Karlsplatz 13, 1040 Vienna (Austria)

    2013-12-16

    Doping of wurtzite aluminium nitride (AlN) with scandium (Sc) significantly enhances the piezoelectric properties of AlN. Sc{sub x}Al{sub 1−x}N thin films with different Sc concentrations (x = 0 to 0.15) were deposited by DC reactive magnetron sputtering. Infrared (IR) absorbance spectroscopy was applied to investigate the Sc concentration dependent shift of the IR active modes E{sub 1}(TO) and A{sub 1}(TO). These results are compared to ab initio simulations, being in excellent agreement with the experimental findings. In addition, IR spectroscopy is established as an economical and fast method to distinguish between thin films with a high degree of c-axis orientation and those exhibiting mixed orientations.

  12. UXC55 Non-Magnetic Robot

    CERN Document Server

    Najjar, Tony

    2017-01-01

    As part of the collaboration between CMS and the Lebanese American University, we are looking into building a non-magnetic inspection rover capable of roaming around UXC55 and specifically under the detector. The robot should be specifically tailored and engineered to cope with the strong magnetic field in the cavern (300 G on average with peaks up to 1500 G) as well as other constraints such as flammability and geometry. Moreover, we are also taking part in the development of the instrumentation and wireless communication of the rover. The biggest challenge in setting up a non-magnetic rover lies in the actuation mechanism, in other words, getting it to move; motors are rotary actuators that rely on the concept of a rotor “trying to catch up” to a rotating magnetic field. We quickly realize the complication with using this popular technology; the strong field created by the CMS magnet greatly interferes with the motor, rendering it utterly stalled. Our approach, on the other hand, consists of using compl...

  13. [Reflections in our 55th anniversary].

    Science.gov (United States)

    Ryder, Elena

    2015-03-01

    Investigación Clínica has been published uninterruptedly for 55 years and for this reason, the University of Zulia has recognized the work of its editorial team with the imposition of the Order "Jesus Enrique Lossada". Despite some financial and structural problems we are optimistic because our journal has been included in new international indices and it is connected to the scientific world through the contributions from all continents; by the selfless collaboration of hundreds of domestic and foreign referees who respond with great professionalism; and through the visits to our website, from virtually around the world. Reviewing the SCImago statistical analysis, we found that among the Venezuelan medical journals, Investigación Clínica is first in cites per document (2 years) and second in the H index, and compares favorably with prestigious Latin-American journals. It is noteworthy that both in Venezuela and beyond our borders, the submission of topic reviews has increased in detriment of original papers or contributions. It seems that the lack of financial support to research institutes and universities, has led to a decline in experimental projects, at least in the medical field that occupies this journal, so researchers resort to reviews in their respective fields, as a compensation to maintain their productivity. This has caused that the Editorial Board has limited the reception of reviews to keep intact the percentage of published original contributions. Finally, we would like to think that there are no obstacles that can not be overcome to maintain our excellence in publishing Investigación Clínica.

  14. Main: 1.00E+55 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1.00E+55 トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1;...AYASQEVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E55.jpg ...

  15. 46 CFR 112.55-15 - Capacity of storage batteries.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Capacity of storage batteries. 112.55-15 Section 112.55... LIGHTING AND POWER SYSTEMS Storage Battery Installation § 112.55-15 Capacity of storage batteries. (a) A storage battery for an emergency lighting and power system must have the capacity— (1) To close all...

  16. 46 CFR 72.20-55 - Insect screens.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Insect screens. 72.20-55 Section 72.20-55 Shipping COAST... Accommodations for Officers and Crew § 72.20-55 Insect screens. Provisions must be made to protect the crew quarters against the admission of insects. ...

  17. 46 CFR 92.20-55 - Insect screens.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Insect screens. 92.20-55 Section 92.20-55 Shipping COAST... ARRANGEMENT Accommodations for Officers and Crew § 92.20-55 Insect screens. Provisions must be made to protect the crew quarters against the admission of insects. ...

  18. 46 CFR 190.20-55 - Insect screens.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Insect screens. 190.20-55 Section 190.20-55 Shipping... ARRANGEMENT Accomodations for Officers, Crew, and Scientific Personnel § 190.20-55 Insect screens. Provisions must be made to protect the crew quarters against the admission of insects. ...

  19. 38 CFR 61.55 - Technical assistance reports.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Technical assistance reports. 61.55 Section 61.55 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) VA HOMELESS PROVIDERS GRANT AND PER DIEM PROGRAM § 61.55 Technical assistance reports. Each...

  20. 29 CFR 1960.55 - Training of supervisors.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) BASIC PROGRAM ELEMENTS FOR FEDERAL EMPLOYEE OCCUPATIONAL SAFETY AND HEALTH PROGRAMS AND RELATED MATTERS Training § 1960.55 Training of supervisors. (a) Each agency shall provide occupational safety and... 29 Labor 9 2010-07-01 2010-07-01 false Training of supervisors. 1960.55 Section 1960.55 Labor...

  1. 46 CFR 112.55-5 - Emergency lighting loads.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Emergency lighting loads. 112.55-5 Section 112.55-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING EMERGENCY LIGHTING AND POWER SYSTEMS Storage Battery Installation § 112.55-5 Emergency lighting loads. When supplying...

  2. 9 CFR 55.6 - Mortgage against animals.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mortgage against animals. 55.6 Section 55.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... DISEASE Chronic Wasting Disease Indemnification Program § 55.6 Mortgage against animals. When cervids have...

  3. 46 CFR 72.05-55 - Furniture and furnishings.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Furniture and furnishings. 72.05-55 Section 72.05-55... ARRANGEMENT Structural Fire Protection § 72.05-55 Furniture and furnishings. (a) For the purpose of this... case furniture such as desks, wardrobes, dressing tables, bureaus, dressers, etc., shall be constructed...

  4. 28 CFR 55.16 - Standards and proof of compliance.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Standards and proof of compliance. 55.16 Section 55.16 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) IMPLEMENTATION OF THE PROVISIONS... Assistance § 55.16 Standards and proof of compliance. Compliance with the requirements of section 4(f)(4) and...

  5. 7 CFR 301.55-9 - Costs and charges.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Costs and charges. 301.55-9 Section 301.55-9 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE DOMESTIC QUARANTINE NOTICES South American Cactus Moth § 301.55-9 Costs...

  6. 7 CFR 761.55 - Closing a supervised bank account.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Closing a supervised bank account. 761.55 Section 761.55 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS GENERAL PROGRAM ADMINISTRATION Supervised Bank Accounts § 761.55...

  7. 10 CFR 430.55 - Evaluation of application.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Evaluation of application. 430.55 Section 430.55 Energy... Exemptions § 430.55 Evaluation of application. The Secretary shall grant an application for exemption... General, that a failure to allow an exemption would likely result in a lessening of competition. ...

  8. 34 CFR 106.55 - Job classification and structure.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Job classification and structure. 106.55 Section 106.55 Education Regulations of the Offices of the Department of Education OFFICE FOR CIVIL RIGHTS, DEPARTMENT OF... Prohibited § 106.55 Job classification and structure. A recipient shall not: (a) Classify a job as being for...

  9. 40 CFR 205.55-2 - Compliance with standards.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Compliance with standards. 205.55-2 Section 205.55-2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.55-2 Compliance...

  10. 40 CFR 205.55-3 - Configuration identification.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Configuration identification. 205.55-3 Section 205.55-3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.55-3 Configuration...

  11. 40 CFR 205.55-5 - Labeling-exterior. [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Labeling-exterior. 205.55-5 Section 205.55-5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.55-5 Labeling...

  12. 40 CFR 205.55-4 - Labeling-compliance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Labeling-compliance. 205.55-4 Section 205.55-4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.55-4 Labeling...

  13. 40 CFR 205.55-1 - General requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false General requirements. 205.55-1 Section 205.55-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.55-1 General...

  14. 46 CFR 201.55 - Postponement of hearing.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Postponement of hearing. 201.55 Section 201.55 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Time (Rule 5) § 201.55 Postponement of hearing. Applications for postponement of any hearing date...

  15. 29 CFR 1915.55 - Gas welding and cutting.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Gas welding and cutting. 1915.55 Section 1915.55 Labor... (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Welding, Cutting and Heating § 1915.55 Gas welding and cutting. The provisions of this section shall apply to ship repairing...

  16. 49 CFR 38.55 - Priority seating signs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Priority seating signs. 38.55 Section 38.55 Transportation Office of the Secretary of Transportation AMERICANS WITH DISABILITIES ACT (ADA) ACCESSIBILITY SPECIFICATIONS FOR TRANSPORTATION VEHICLES Rapid Rail Vehicles and Systems § 38.55 Priority seating signs. (a...

  17. 4 CFR 5.5 - Travel, transportation, and subsistence.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Travel, transportation, and subsistence. 5.5 Section 5.5 Accounts GOVERNMENT ACCOUNTABILITY OFFICE PERSONNEL SYSTEM COMPENSATION § 5.5 Travel, transportation, and subsistence. The provisions of chapter 57 of title 5, U.S. Code and the implementing regulations for the...

  18. Two scandium-biuret complexes: [Sc(C2H5N3O2)(H2O)5]Cl3 x H2O and [Sc(C2H5N3O2)4](NO3)3.

    Science.gov (United States)

    Harrison, William T A

    2008-05-01

    The scandium(III) cations in the structures of pentaaqua(biuret-kappa(2)O,O')scandium(III) trichloride monohydrate, [Sc(C(2)H(5)N(3)O(2))(H(2)O)(5)]Cl(3) x H(2)O, (I), and tetrakis(biuret-kappa(2)O,O')scandium(III) trinitrate, [Sc(C(2)H(5)N(3)O(2))(4)](NO(3))(3), (II), are found to adopt very different coordinations with the same biuret ligand. The roles of hydrogen bonding and the counter-ion in the establishment of the structures are described. In (I), the Sc(3+) cation adopts a fairly regular pentagonal bipyramidal coordination geometry arising from one O,O'-bidentate biuret molecule and five water molecules. A dense network of N-H...Cl, O-H...O and O-H...Cl hydrogen bonds help to establish the packing, resulting in dimeric associations of two cations and two water molecules. In (II), the Sc(3+) cation (site symmetry 2) adopts a slightly squashed square-antiprismatic geometry arising from four O,O'-bidentate biuret molecules. A network of N-H...O hydrogen bonds help to establish the packing, which features [010] chains of cations. One of the nitrate ions is disordered about an inversion centre. Both structures form three-dimensional hydrogen-bond networks.

  19. 46 CFR 196.15-55 - Requirements for fuel oil.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Requirements for fuel oil. 196.15-55 Section 196.15-55... Test, Drills, and Inspections § 196.15-55 Requirements for fuel oil. (a) It shall be the duty of the chief engineer to cause an entry in the log to be made of each supply of fuel oil received on board...

  20. 46 CFR 97.15-55 - Requirements for fuel oil.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Requirements for fuel oil. 97.15-55 Section 97.15-55... OPERATIONS Tests, Drills, and Inspections § 97.15-55 Requirements for fuel oil. (a) It shall be the duty of the chief engineer to cause an entry in the log to be made of each supply of fuel oil received on...

  1. Verification and Validation of RADTRAN 5.5.

    Energy Technology Data Exchange (ETDEWEB)

    Osborn, Douglas.; Weiner, Ruth F.; Mills, George Scott; Hamp, Steve C.

    2005-02-01

    This document contains a description of the verification and validation process used for the RADTRAN 5.5 code. The verification and validation process ensured the proper calculational models and mathematical and numerical methods were used in the RADTRAN 5.5 code for the determination of risk and consequence assessments. The differences between RADTRAN 5 and RADTRAN 5.5 are the addition of tables, an expanded isotope library, and the additional User-Defined meteorological option for accident dispersion. 3

  2. 7 CFR 1216.55 - Investment of funds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Investment of funds. 1216.55 Section 1216.55 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... Investment of funds. The Board may invest, pending disbursement, funds it receives under this subpart, only...

  3. 28 CFR 55.12 - Language used for written material.

    Science.gov (United States)

    2010-07-01

    ... written form. Some languages, for example, Japanese, have more than one written form. A jurisdiction... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Language used for written material. 55.12... OF THE VOTING RIGHTS ACT REGARDING LANGUAGE MINORITY GROUPS Determining the Exact Language § 55.12...

  4. 22 CFR 41.55 - Aliens with extraordinary ability.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Aliens with extraordinary ability. 41.55... IMMIGRATION AND NATIONALITY ACT, AS AMENDED Business and Media Visas § 41.55 Aliens with extraordinary ability. (a) Requirements for O classification. An alien shall be classifiable under the provisions of INA 101...

  5. 10 CFR 55.31 - How to apply.

    Science.gov (United States)

    2010-01-01

    ... or power level. Control manipulations performed on the plant-referenced simulator may be chosen from... 10 Energy 2 2010-01-01 2010-01-01 false How to apply. 55.31 Section 55.31 Energy NUCLEAR... writing the Office of Information Services, U.S. Nuclear Regulatory Commission, Washington, DC 20555-0001...

  6. 7 CFR 915.55 - Avocados not subject to regulations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Avocados not subject to regulations. 915.55 Section 915.55 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE AVOCADOS...

  7. 7 CFR 1219.55 - Exemption from assessment.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Exemption from assessment. 1219.55 Section 1219.55 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE HASS AVOCADO PROMOTION, RESEARCH...

  8. 33 CFR 55.9 - Child development centers.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Child development centers. 55.9... DEVELOPMENT SERVICES General § 55.9 Child development centers. (a) The Commandant may make child development services available at child development centers located at Coast Guard installations. (b) Regular and...

  9. 40 CFR 60.55c - Waste management plan.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Waste management plan. 60.55c Section... Waste Incinerators for Which Construction is Commenced After June 20, 1996 § 60.55c Waste management plan. The owner or operator of an affected facility shall prepare a waste management plan. The waste...

  10. 46 CFR 112.55-10 - Storage battery charging.

    Science.gov (United States)

    2010-10-01

    ... gas turbine driven generator set, must have apparatus to automatically maintain the battery fully... 46 Shipping 4 2010-10-01 2010-10-01 false Storage battery charging. 112.55-10 Section 112.55-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING EMERGENCY LIGHTING...

  11. 21 CFR 1304.55 - Reports by online pharmacies.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Reports by online pharmacies. 1304.55 Section 1304.55 Food and Drugs DRUG ENFORCEMENT ADMINISTRATION, DEPARTMENT OF JUSTICE RECORDS AND REPORTS OF... Food and Drug Administration, and indicate the total number of dosage units dispensed for each such...

  12. 10 CFR 39.55 - Tritium neutron generator target sources.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Tritium neutron generator target sources. 39.55 Section 39... Equipment § 39.55 Tritium neutron generator target sources. (a) Use of a tritium neutron generator target...) Use of a tritium neutron generator target source, containing quantities exceeding 1,110 GBg or in a...

  13. 12 CFR 229.55 - Expedited recredit for banks.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Expedited recredit for banks. 229.55 Section 229.55 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE... Expedited recredit for banks. (a) Circumstances giving rise to a claim. A bank that has an indemnity claim...

  14. 40 CFR 60.55a - Standard for nitrogen oxides.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standard for nitrogen oxides. 60.55a... § 60.55a Standard for nitrogen oxides. On and after the date on which the initial compliance test is... gases that contain nitrogen oxides in excess of 180 parts per million by volume, corrected to 7 percent...

  15. 31 CFR 360.55 - Individuals authorized to certify.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Individuals authorized to certify. 360.55 Section 360.55 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued... imprint of either the corporate seal of the institution or of the issuing or paying agent's stamp. The...

  16. 31 CFR 315.55 - Individuals authorized to certify.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Individuals authorized to certify. 315.55 Section 315.55 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued... authenticated by a legible imprint either of a corporate stamp of the institution or of the issuing or paying...

  17. 31 CFR 353.55 - Individuals authorized to certify.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Individuals authorized to certify. 353.55 Section 353.55 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued... imprint of either the corporate seal of the institution or of the issuing or paying agent's stamp. The...

  18. 7 CFR 301.55-2 - Regulated articles.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Regulated articles. 301.55-2 Section 301.55-2... Regulated articles. The following are regulated articles: (a) The South American cactus moth, in any living..., Nopalea, and Opuntia. (c) Any other product, article, or means of conveyance not listed in paragraphs (a...

  19. 36 CFR 7.55 - Lake Roosevelt National Recreation Area.

    Science.gov (United States)

    2010-07-01

    ... Recreation Area. 7.55 Section 7.55 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF... Recreation Area. (a) Hunting. Hunting is allowed at times and locations designated as open for hunting. (b... Recreation Area except in the following areas: (i) Crescent Bay Lake. (ii) Kettle River above the Hedlund...

  20. 45 CFR 605.55-605.60 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false 605.55-605.60 Section 605.55-605.60 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL SCIENCE FOUNDATION NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Health, Welfare, and...

  1. Long slit spectroscopy of diffuse ionized gas in NGC 55

    OpenAIRE

    Otte, B.; Dettmar, R. -J.

    1999-01-01

    Spectroscopic measurements of emission line ratios and velocities are presented for ionized gas across the central plane of NGC 55, a late-type galaxy in the Sculptor group. The low metallicity in NGC 55 leads to relatively low line ratios of [S II]/H$\\alpha$ and [N II]/H$\\alpha$ for H II regions as well as the diffuse ionized gas. These are the first spectroscopical measurements of line ratios in ionized gas exterior to the stellar disc of NGC 55. Analysis of the line ratios and the relative...

  2. 7 CFR 58.55 - Facilities for keeping quality samples.

    Science.gov (United States)

    2010-01-01

    ... 58.55 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT...

  3. Tchaikovsky, P.: Orchestral Suite no. 3 op. 55 / Terry Williams

    Index Scriptorium Estoniae

    Williams, Terry

    1996-01-01

    Uuest heliplaadist "Tchaikovsky, P.: Orchestral Suite no. 3 op. 55. Francesca di Rimini op. 32. Detroit Symphony Orchestra, Neeme Järvi". Chandos CHAN 9 419, distribution Media 7 (CD: 160F). TT: 1h 09'20"

  4. 41 CFR 105-55.009 - Aggressive agency collection activity.

    Science.gov (United States)

    2010-07-01

    ... undertaken promptly, including letters, telephone calls, electronic mail (e-mail), and Internet inquiries... specific classes of debts; (7) Is in bankruptcy (see § 105-55.010(h)); (8) Involves a deceased debtor; (9...

  5. 1.55 Micron High Peak Power Fiber Amplifier Project

    Data.gov (United States)

    National Aeronautics and Space Administration — In this proposal, we propose to demonstrate and build a 1.55 micron single frequency high energy and high peak power fiber amplifier by developing an innovative...

  6. [Generation 55+: leadership and motivation of generations in hospitals].

    Science.gov (United States)

    Schmidt, C E; Möller, J; Schmidt, K; Gerbershagen, M U; Wappler, F; Limmroth, V; Padosch, S A; Bauer, M

    2012-07-01

    Demographic changes in Germany are leading towards a decrease of the population from the current 82 million to 74 million in the year 2050. As a consequence the shortage of qualified staff will be aggravated and intensifying recruiting efforts will increase competition among employers. An alternative is to utilize the potential of jobholders older than 55 years, the so-called generation 55 +. However, little is known about the hospital workforce generation 55 +. An internet search was conducted using google.de, yahoo.de and altavista.de for "generation 55 + and medicine" and "demographics, personnel and hospital" In Medline/pubmed a search was conducted for the key words "aging workforce" (949 sources) and in combination with AND "doctors" (134 sources), "demographic changes", "staff" (794 sources) as well as for "generation 55 + AND doctors" (312 sources). Finally, sources from reputable public institutions and academic medical societies were analyzed. The data were sorted by main categories and relevance for hospitals. Statistical analysis was done mainly using descriptive measures. From initially more than 530,000 sources, a total of 289 studies and reports on the topic were plotted. There was no evidence for a negative correlation between age and work ability or fitness. Jobholders senior to 55 years can be divided into the "economic miracle generation" and into the so-called baby-boomers. Both groups have differences in values, communication needs and leadership requirements. They jointly prefer direct communication and seek appreciation for their experience on the job. Generation 55 + is not asking for an upscaled position in hospitals. They expect respect and appreciation for their sound experience of work and life. Generation 55 + wants to be integrated and sought after. Keeping these employees fit, motivated and qualified is a sound approach to fight the foreseeable shortage of qualified staff in hospitals.

  7. 36 CFR 910.55 - Build-to line.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Build-to line. 910.55 Section... DEVELOPMENT AREA Glossary of Terms § 910.55 Build-to line. Build-to line means a line with which the exterior wall of a building in a development is required to coincide. Minor deviations from the build-to line...

  8. Issues for reuse of gloveboxes at LANL TA-55

    Energy Technology Data Exchange (ETDEWEB)

    Cadwallader, L.C.; Pinson, P.A.; Miller, C.F.

    1998-08-01

    This report is a summary of issues that face plutonium glovebox designers and users at the Los Alamos National Laboratory (LANL) Technical Area 55 (TA-55). Characterizing the issues is a step in the task of enhancing the next generation glovebox design to minimize waste streams while providing the other design functions. This report gives an initial assessment of eight important design and operation issues that can benefit from waste minimization.

  9. Increasing the reference populations for the 55 AISNP panel

    DEFF Research Database (Denmark)

    Pakstis, Andrew J; Kang, Longli; Liu, Lijun

    2017-01-01

    Ancestry inference for an individual can only be as good as the reference populations with allele frequency data on the SNPs being used. If the most relevant ancestral population(s) does not have data available for the SNPs studied, then analyses based on DNA evidence may indicate a quite distantly...... related population, albeit one among the more closely related of the existing reference populations. We have added reference population allele frequencies for 14 additional population samples (with >1100 individuals studied) to the 125 population samples previously published for the Kidd Lab 55 AISNP...... panel. Allele frequencies are now publicly available for all 55 SNPs in ALFRED and FROG-kb for a total of 139 population samples. This Kidd Lab panel of 55 ancestry informative SNPs has been incorporated in commercial kits by both ThermoFisher Scientific and Illumina for massively parallel sequencing...

  10. Flash CS5.5 The Missing Manual

    CERN Document Server

    Grover, Chris

    2011-01-01

    You can build everything from simple animations to full-fledged iOS and Android apps with Flash CS5.5, but learning this complex program can be difficult-unless you have this fully updated, bestselling guide. Learn how to create gorgeous Flash effects even if you have no programming experience. With Flash CS5.5: The Missing Manual, you'll move from the basics to power-user tools with ease. Learn animation basics. Discover how to turn simple ideas into stunning animations.Master Flash's tools. Learn the animation and effects tools with clear explanations and hands-on examples.Use 3D effects. R

  11. 19 CFR 145.55 - Trademarks, trade names, and copyrights.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Trademarks, trade names, and copyrights. 145.55... Trademarks, trade names, and copyrights. Merchandise bearing a trademark or trade name entitled to protection against imports, merchandise bearing a mark or name that copies or simulates such a trademark or trade...

  12. 19 CFR 210.55 - Content of service copies.

    Science.gov (United States)

    2010-04-01

    ... Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Temporary Relief § 210.55 Content of service copies. (a) Any... information about each element of the violation alleged in the complaint and the motion to enable each...

  13. 28 CFR 550.55 - Eligibility for early release.

    Science.gov (United States)

    2010-07-01

    ... Section 550.55 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE INSTITUTIONAL MANAGEMENT... offenses committed upon minors; (5) Inmates who have a current felony conviction for: (i) An offense that... committed upon minors; (6) Inmates who have been convicted of an attempt, conspiracy, or other offense which...

  14. An automated 55 GHz cryogenic Josephson sampling oscilloscope

    DEFF Research Database (Denmark)

    Bodin, P.; Jacobsen, M. L.; Kyhle, Anders

    1993-01-01

    A computer-automated superconductive 55 GHz sampling oscilloscope based on 4 kA/cm2, Nb/Nb2O5/Pb edge Josephson junctions is presented. The Josephson sampler chip was flip-chip bonded to a carrier chip with a coplanar transmission line by use of a novel flip-chip bonding machine. A 5.6 ps step pu...

  15. 6 CFR 5.5 - Timing of responses to requests.

    Science.gov (United States)

    2010-01-01

    ... INFORMATION Freedom of Information Act § 5.5 Timing of responses to requests. (a) In general. Components... based on the amount of work and/or time needed to process the request, including through limits based on...) of the limits of its faster track(s). (2) A component using multitrack processing may provide...

  16. 46 CFR 56.50-55 - Bilge pumps.

    Science.gov (United States)

    2010-10-01

    ... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING PIPING SYSTEMS AND APPURTENANCES Design Requirements Pertaining to Specific Systems § 56.50-55 Bilge pumps. (a) Self-propelled vessels. (1... unberthed passengers in special trades. 4 When the criterion numeral exceeds 30, an additional independent...

  17. 7 CFR 301.55-3 - Quarantined areas.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE DOMESTIC QUARANTINE NOTICES South American Cactus Moth § 301.55-3... which the South American cactus moth has been found by an inspector, in which the Administrator has...

  18. 7 CFR 301.55-6 - Compliance agreements and cancellation.

    Science.gov (United States)

    2010-01-01

    ... Section 301.55-6 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE DOMESTIC QUARANTINE NOTICES South American Cactus... from local Plant Protection and Quarantine offices, which are listed in telephone directories. (b) Any...

  19. 36 CFR 1192.55 - Priority seating signs.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Priority seating signs. 1192... Rapid Rail Vehicles and Systems § 1192.55 Priority seating signs. (a) Each vehicle shall contain sign(s... passengers should make such seats available to those who wish to use them. (b) Characters on signs required...

  20. Synthesis and Crystal Structures of New 5,5'-Azotetrazolates

    Directory of Open Access Journals (Sweden)

    Gerhard Laus

    2012-03-01

    Full Text Available Five new 5,5'-azotetrazolate salts (amminsilver, trimethylsulfonium, tetramethyl-phosphonium, trimethylsulfoxonium, 2-(hydroxyethyltrimethylammonium were prepared and characterized. The crystal structures were determined by X-ray diffraction. Interactions between the ions are identified and discussed. The sensitivities of the highly energetic silver salt were measured by BAM (Bundesanstalt für Materialforschung und-prüfung methods.

  1. Decay energy of 55 Fe from its inner Bremsstrahlung spectrum

    Indian Academy of Sciences (India)

    2015-11-27

    Nov 27, 2015 ... Several measurements of decay energy using the inner Bremsstrahlung spectrum (IB) due to radiative electron capture in 55Fe has been made. But the results are not uniform. Hence another attempt has been made at the same. Experimental data was obtained with a 4.445 cm. dia × 5.08 cm thick NaI (Tl) ...

  2. 18 CFR 367.55 - Land and land rights.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Land and land rights... Property Instructions § 367.55 Land and land rights. (a) The accounts for land and land rights must include the cost of land owned in fee by the service company and rights. Interests, and privileges held by the...

  3. 49 CFR 393.55 - Antilock brake systems.

    Science.gov (United States)

    2010-10-01

    ... March 1, 1998 (except commercial motor vehicles engaged in driveaway-towaway operations), shall be... vehicle, and shall have the means for connection of the electrical circuit to the towed vehicle. The ABS... NECESSARY FOR SAFE OPERATION Brakes § 393.55 Antilock brake systems. Link to an amendment published at 75 FR...

  4. Comparison of the bony remodelling of two synthetic biomaterials: aragonite 55% and aragonite 55% with active substance

    Energy Technology Data Exchange (ETDEWEB)

    Oudadesse, H [Universite de Rennes1, UMR-CNRS 6226, campus de beaulieu, 263 av. General Leclerc, 35042 Rennes (France); Derrien, A C [Universite de Rennes1, UMR-CNRS 6226, campus de beaulieu, 263 av. General Leclerc, 35042 Rennes (France); Martin, S [Universite de Rennes1, UMR-CNRS 6226, UFR Odontologie, 2 ave. du Pr. Leon Bernard, 35043 Rennes (France); Lucas-Girot, A [Universite de Rennes1, UMR-CNRS 6226, campus de beaulieu, 263 av. General Leclerc, 35042 Rennes (France); Cathelineau, G [Universite de Rennes1, UMR-CNRS 6226, UFR Odontologie, 2 ave. du Pr. Leon Bernard, 35043 Rennes (France)

    2007-03-01

    In this work, the in vivo behaviour of pure aragonite and vectabone, which is an association of aragonite and an active substance such as gentamicin, was studied to highlight the kinetic resorption of these two biomaterials with 55% of porosity destined for the filling or replacement of bony defects. The synthesis conditions and parameters we used permit us to obtain a biomaterial without a sintering stage. These conditions allow introducing of active substances at the first stage of the elaboration. In this work, the gentamycin antibiotic was associated with calcium carbonate (aragonite 55% with gentamycin) to deliver this active substance on the surgical site for local treatment. The tricalcium phosphate biomaterial was used as the control because of its high biocompatibility. The bony remodelling of these three biomaterials was studied by in vivo experiments. This study was ensured with neutron activation analysis (NAA). The resorption kinetic was elaborated and comparisons of the remodelling biomaterials CaCO{sub 3} 55% and CaCO{sub 3} 55% with gentamicin (vectabone) and tricalcium phosphate were carried out. The obtained results show that, 6 months after implantation, the mineral composition of vectabone and tricalcium phosphate becomes close to that of young bone. Twelve months after implantation, it becomes similar to that of mature bone.

  5. Design, synthesis and biological evaluation of GPR55 agonists.

    Science.gov (United States)

    Fakhouri, Lara; Cook, Christopher D; Al-Huniti, Mohammed H; Console-Bram, Linda M; Hurst, Dow P; Spano, Michael B S; Nasrallah, Daniel J; Caron, Marc G; Barak, Larry S; Reggio, Patricia H; Abood, Mary E; Croatt, Mitchell P

    2017-08-15

    GPR55, a G protein-coupled receptor, is an attractive target to alleviate inflammatory and neuropathic pain and treat osteoporosis and cancer. Identifying a potent and selective ligand will aid to further establish the specific physiological roles and pharmacology of the receptor. Towards this goal, a targeted library of 22 compounds was synthesized in a modular fashion to obtain structure-activity relationship information. The general route consisted of coupling a variety of p-aminophenyl sulfonamides to isothiocyanates to form acylthioureas. For the synthesis of a known naphthyl ethyl alcohol motif, route modification led to a shorter and more efficient process. The 22 analogues were analyzed for their ability to serve as agonists at GPR55 and valuable information for both ends of the molecule was ascertained. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. ROSSITER-MCLAUGHLIN OBSERVATIONS OF 55 Cnc e

    Energy Technology Data Exchange (ETDEWEB)

    López-Morales, Mercedes; Rodler, Florian; Dumusque, Xavier; Buchhave, Lars A.; Latham, David W. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 01238 (United States); Triaud, Amaury H. M. J. [Department of Physics, and Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Harutyunyan, Avet [Fundación Galileo Galilei-INAF, Rambla José Ana Fernandez Pérez, E-738712 Breña Baja, Tenerife (Spain); Hoyer, Sergio; Alonso, Roi [Instituto de Astrofísica de Canarias, E-38205 La Laguna, Tenerife (Spain); Gillon, Michaël [Institut d' Astrophysique et Géophysique, Université de Liège, Allée du 6 Août 17, B-4000 Liège (Belgium); Kaib, Nathan A. [Center for Interdisciplinary Exploration and Research in Astrophysics (CIERA) and Department of Physics and Astronomy, Northwestern University, 2131 Tech Drive, Evanston, IL 60208 (United States); Lovis, Christophe; Pepe, Francesco; Queloz, Didier; Ségransan, Damien; Udry, Stéphane [Observatoire Astronomique de l' Université de Genève, Chemin des Maillettes 51, Sauverny, CH-1290 (Switzerland); Raymond, Sean N. [Université de Bordeaux, LAB, UMR 5804, BP F-33270 Floirac (France); Waldmann, Ingo P., E-mail: mlopez-morales@cfa.harvard.edu [Department of Physics and Astronomy, University College London, Gower Street, WC1E6BT (United Kingdom)

    2014-09-10

    We present Rossiter-McLaughlin observations of the transiting super-Earth 55 Cnc e collected during six transit events between 2012 January and 2013 November with HARPS and HARPS-N. We detect no radial velocity signal above 35 cm s{sup –1} (3σ) and confine the stellar v sin i {sub *} to 0.2 ± 0.5 km s{sup –1}. The star appears to be a very slow rotator, producing a very low amplitude Rossiter-McLaughlin effect. Given such a low amplitude, the Rossiter-McLaughlin effect of 55 Cnc e is undetected in our data, and any spin-orbit angle of the system remains possible. We also performed Doppler tomography and reach a similar conclusion. Our results offer a glimpse of the capacity of future instrumentation to study low amplitude Rossiter-McLaughlin effects produced by super-Earths.

  7. Phase Curve Analysis of Super-Earth 55 Cancri e

    Science.gov (United States)

    Angelo, Isabel; Hu, Renyu

    2018-01-01

    One of the primary questions when characterizing Earth-sized and super-Earth-sized exoplanets is whether they have a substantial atmosphere like Earth and Venus, or a bare-rock surface that may come with a tenuous atmosphere like Mercury. Phase curves of the planets in thermal emission provide clues to this question, because a substantial atmosphere would transport heat more efficiently than a bare-rock surface. Analyzing phase curve photometric data around secondary eclipse has previously been used to study energy transport in the atmospheres of hot Jupiters. Here we use phase curve, Spitzer time-series photometry to study the thermal emission properties of the super-Earth exoplanet 55 Cancri e. We utilize a previously developed semi-analytical framework to fit a physical model to infrared photometric data of host star 55 Cancri from the Spitzer telescope IRAC 2 band at 4.5 μm. The model uses various parameters of planetary properties including Bond albedo, heat redistribution efficiency (i.e., the ratio between the radiative timescale and advective timescale of the photosphere), and atmospheric greenhouse factor. The phase curve of 55 Cancri e is dominated by thermal emission with an eastward-shifted hot spot located on the planet surface. We determine the heat redistribution efficiency to be ≈1.47, which implies that the advective timescale is on the same order as the radiative timescale. This requirement from the phase curve cannot be met by the bare-rock planet scenario, because heat transport by currents of molten lava would be too slow. The phase curve thus favors the scenario with a substantial atmosphere. Our constraints on the heat redistribution efficiency translate to a photosphere pressure of ~1.4 bar. The Spitzer IRAC 2 band is thus a window into the deep atmosphere of the planet 55 Cancri e.

  8. Rossiter-McLaughlin observations of 55 Cnc e

    DEFF Research Database (Denmark)

    Lopez-Morales, Mercedes; Triaud, Amaury H. M. J.; Rodler, Florian

    2014-01-01

    We present Rossiter-McLaughlin observations of the transiting super-Earth 55 Cnc e collected during six transit events between 2012 January and 2013 November with HARPS and HARPS-N. We detect no radial velocity signal above 35 cm s–1 (3σ) and confine the stellar v sin i to 0.2 ± 0.5 km s–1. The s...

  9. The Disk and Extraplanar Regions of NGC 55

    Science.gov (United States)

    Davidge, T. J.

    2005-03-01

    The stellar content of the nearby SB(s)m galaxy NGC 55 is investigated using images obtained with the Gemini South and Canada-France-Hawaii telescopes. The (K, H-K) and (K, J-K) color-magnitude diagrams (CMDs) of stars near the plane of the disk reveal signatures of large-scale star formation during recent and intermediate epochs in the form of red supergiants (RSGs) with MK=-11.5, and an asymptotic giant branch (AGB) that peaks near MK=-10. Comparisons with stellar evolution models suggest that the brightest RSGs have an age near 8 Myr. A well-defined plume, which stellar evolution models suggest contains stars with masses near the RSG-AGB transition, is detected in CMDs constructed both from infrared and visible wavelength observations. It is concluded that star formation in the thin disk of NGC 55 has occurred at a significant rate for at least the past 0.1-0.2 Gyr, and this is consistent with other indicators. The near-infrared spectral energy distribution of the integrated light near the center of the galaxy is consistent with that in other Magellanic irregular galaxies, indicating that the star-forming history of NGC 55, when averaged over timescales of 0.1-1 Gyr, has likely not been peculiar when compared with other late-type systems. Evidence is also presented that the disk contains a large population of old [log(tyr)~10] stars, and it is argued that a stable disk has been in place in NGC 55 for a significant fraction of the age of the universe. At projected distances in excess of 2 kpc off of the disk plane, the brightest AGB stars have ages 10+3-2 Gyr. Thus, despite indications that dust and gas are present in the envelope surrounding the NGC 55 disk, the AGB content suggests that recently formed stars do not occur in large numbers in the extraplanar region. The (r'-i') colors of the RGB in the extraplanar region are consistent with [Fe/H] between -2.2 and -0.7, with the majority of stars having [Fe/H]>-1.2, and the mean metallicity inferred from the RGB

  10. Lightcurves and phase relations of asteroid 55 Pandora

    Science.gov (United States)

    Shevchenko, V. G.; Krugly, Yu. N.; Lupishko, D. F.; Harris, A. W.; Chernova, G. P.

    1993-01-01

    Photoelectric observations of the asteroid 55 Pandora were carried out in Feb. - Mar. 1989 (6 nights) in range of phase angles Delta alpha = (2.5 - 1.4) deg, and in Sep. - Nov. 1991 (15 nights) Delta alpha = (0.5 - 16.3) deg. Average amplitudes of lightcurves in these oppositions are 0.22 m and 0.10 m, respectively. The value of linear phase coefficients and the absence of spike-effect of alpha less than 2 deg indicate that Pandora is a typical M-asteroid and the high albedo measured by IRAS-satellite is not real.

  11. 55th International Conference of Machine Design Departments 2014

    CERN Document Server

    Berka, Ondrej; Petr, Karel; Lopot, František; Dub, Martin

    2016-01-01

    This book is based on the 55th International Conference of Machine Design Departments 2014 (ICMD 2014) which was hosted by the Czech Technical University in September 2014. It features scientific articles which solve progressive themes from the field of machine design. The book addresses a broad range of themes including tribology, hydraulics, materials science, product innovation and experimental methods. It presents the latest interdisciplinary high-tech work. People with an interest in the latest research results in the field of machine design and manufacturing engineering will value this book with contributions of leading academic scientists and experts from all around the world.

  12. Study of yrast structures in {sup 55,57}Cr

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Anuradha, E-mail: annu1gupta1@gmail; Kumar, Amit, E-mail: akbcw2@gmail.com [Research Scholar, University of Jammu, Jammu-180006 (India); Singh, Suram, E-mail: suramsingh@gmail.com [Assistant Professor, Department of Physics, G.D.C. Kathua, 184101 (India); Bharti, Arun, E-mail: arunbharti-2003@yahoo.co.in [Professor, University of Jammu, Jammu-180006 (India)

    2016-05-06

    The characteristic nuclear structure properties of yrast bands of {sup 55,57}Cr have been investigated by using two body effective interactions incorporated in phenomenological axial framework. In order to check the validity of the chosen framework as well as chosen valence space, the calculated results are compared with the available experimental data and a good agreement has been found from the comparison. The back-bending in moment of inertia has also been studied and attributed to the alignment of odd g{sub 9/2} neutron along the rotation axis.

  13. STS-55 Earth observation of Lake Natron, Tanzania, East Africa

    Science.gov (United States)

    1993-01-01

    STS-55 Earth observation taken aboard Columbia, Orbiter Vehicle (OV) 102, shows Lake Natron. Taken with color infrared (CIR) film, the typical red-colored water appears greenish. The drying soda salts in the lakebed are seen in greater detail in this CIR view. From the signatures seen in this photograph, the lake appears to be highly saline and to contain aquatic biota with little or no chlorophyll. The biomass over the rift valley escarpment is clearly defined by the reddish color in this CIR photo. Refer to STS055-93-037 for a comparative view photographed in regular color.

  14. Teaching Environmental Soil Science to Students older than 55

    Science.gov (United States)

    Cerdà, Artemi; Civera, Cristina; Giménez-Morera, Antonio; Burguet, María

    2014-05-01

    The life expectancy growth is a general trend for the world population, which translates into an increase of people older than 55 years in Western societies. This entails to the rise of health problems as well as large investments in healthcare. In general, we are spectators Y tambe voldria saber si ens pots fer una asse of how a large group of citizens have a new life after retirement. The XXI century societies are facing the problem of the need of a healthy population, even after retirement. There is a need in developing new strategies to allow those citizens to improve their knowledge of the environmental changes. The research in Soil Science and related disciplines is the strategy we are using on the Geograns program to inform the students (older than 55) about the changes the Earth and the Soil System are suffering. And this should be done in a healthy and active teaching environment. The NAUGRAN program is being developed by the University of Valencia for more than 10 years and shows the advances on education for senior students. Within this program, Geograns is bringing the environmentalist ideas to the students. This is a difficult task as those students were born in a society were nature was created to be exploited and not to be conserved (e.g. Green Revolution, agricultural transformations of the 60's in Spain). This is the reason why the University of Valencia developed at the end of the 90's a program to teach students older than 55. This paper shows the advances on new strategies developed during 2013 with a group of these senior students. The main strategy was to take the students to visit the nature and to explain the functioning of the Earth and Soil System. Those visits were organized with the collaboration of scientist, environmentalist, farmers and technicians; and the guiding thread was trekking. This mix showed our students different views and sides of the same phenomena (e.g. tillage operations, soil erosion problems, water quantity and

  15. The 55 K specific heat anomaly in palladium hydride

    Science.gov (United States)

    Jacobi, N.; Vaughan, R. W.

    1976-01-01

    A specific heat anomaly in PdH and PdD has been observed by Aston et al. (1957) close to 55 K. Its position was found to be independent of hydrogen concentration and its magnitude to be linear in hydrogen concentration. Ferguson's (1965) and Brodowsky's (1972) explanations of the anomaly are shown to be unsatisfactory. This is true also for the detailed mechanical statistical model proposed by Staford and McLellan (1974) for interstitial solid solutions of hydrogen in transition metals. It is shown that Gopal's (1966) simple Schottky model of specific heat anomaly, which considers a system of several levels with Boltzmann statistics, provides much better agreement with experiment than the more elaborate models, both in magnitude and in predicting a linear dependence on hydrogen concentration.

  16. T55 power turbine rotor multiplane-multispeed balancing study

    Science.gov (United States)

    Martin, M. R.

    1982-01-01

    A rotordynamic analysis of the T55-L-11C engine was used to evaluate the balancing needs of the power turbine and to optimize the balancing procedure. As a result, recommendations were made for implementation of a multiplane-multispeed balancing plan. Precision collars for the attachment of trial weights to a slender rotor were designed enabling demonstration balancing on production hardware. The quality of the balance was then evaluated by installing a high speed balanced power turbine in an engine and running in a test cell at the Corpus Christi Army depot. The engine used had been tested prior to the turbine changeout and showed acceptable overall vibration levels for the engine were significantly reduced, demonstrating the ability of multiplane-multispeed balancing to control engine vibration.

  17. Transperitoneal laparoscopic pyeloplasty: Brazilian initial experience with 55 cases

    Directory of Open Access Journals (Sweden)

    Marco T. C. Lasmar

    2010-12-01

    Full Text Available PURPOSE: To evaluate prospectively the results obtained in 55 patients undergoing laparoscopic pyeloplasty through transperitoneal access. MATERIALS AND METHODS: From January 2005 to July 2009, fifty-five patients between 13 and 64 years old, were treated for ureteropelvic junction (UPJ stenosis via a transperitoneal laparoscopy. All patients had clinical symptoms of high urinary obstruction and hydronephrosis confirmed by imaging methods. Anderson-Hynes dismembered pyeloplasty was performed in 51 patients and Fenger technique in the other 4 cases. Patients were clinically and imaging evaluated in the postoperative period at 3 and 6 months and then followed-up annually. RESULTS: The operative time ranged from 95 to 270 min. The mean hospital stay was 2 days. The average blood loss was 170 mL. The time to return to normal activities ranged from 10 to 28 days. Anomalous vessels were identified in 27 patients, intrinsic stenosis in 23 patients and 5 patients had high implantation of the ureter. Laparoscopic pyelolithotomy was successfully performed in 6 patients with associated renal stones. That series monitoring ranged from 1 to 55 months. One patient had longer urinary fistula (11 days, 3 patients had portal infection and 6 patients had prolonged ileus. There was one conversion due to technical difficulties. From the later postoperative complications, 2 patients had re-stenosis, one determined by Anderson-Hynes technique and the other by Fenger technique. The success rate was 95.65%. CONCLUSIONS: Laparoscopic pyeloplasty has functional results comparable to conventional open technique. It offers less morbidity, with aesthetic and post-operative convalescence benefits and lower complication rates.

  18. Nonequilibrium solidification in undercooled Ti45Al55 melts

    Science.gov (United States)

    Hartmann, H.; Galenko, P. K.; Holland-Moritz, D.; Kolbe, M.; Herlach, D. M.; Shuleshova, O.

    2008-04-01

    Ti-Al alloys are of high technological interest as light-weight high-performance materials. When produced by solidification from the liquid state, the material properties of as-solidified materials are strongly dependent on the conditions governing the solidification process. Nonequilibrium solidification from the state of an undercooled liquid may result to the formation of metastable solid materials. On the one hand undercooling under special cases may influence the phase selection behavior during solidification, and on the other hand during rapid growth of solid phases in undercooled melts nonequilibrium effects such as solute trapping and disorder trapping may occur. In the present work containerless processing by electromagnetic levitation is used to undercool Ti45Al55 melts deeply below the liquidus temperature. The dendrite growth velocity during the solidification is measured as a function of undercooling by application of a high-speed video camera. In situ diffraction experiments at ESRF in Grenoble and microstructure investigations are performed in order to identify the primary solidified phases. The experimental findings are interpreted within current theoretical models for dendritic growth and solute trapping.

  19. LAFD: TA-55 General Facility Familiarization Tour, Course #55261

    Energy Technology Data Exchange (ETDEWEB)

    Rutherford, Victor Stephen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Miller, Joshua [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Mason, Robert Clifford [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2018-01-10

    Los Alamos National Laboratory (LANL) will conduct familiarization tours for personnel of the Los Alamos County Fire Department (LAFD) at the TA-55 General Facility. These familiarization tours are official LANL business; the purpose of these tours is to orient LAFD firefighters to the facility so that they can respond efficiently and quickly to a variety of emergency situations. This orientation includes, among other topics, ingress and egress of the area and buildings, layout and organization of the facility, evacuation procedures and assembly points, and areas of concern within the various buildings at the facility. LAFD firefighters have the skills and abilities to perform firefighting operations and other emergency response tasks that cannot be provided by LANL personnel who have the required clearance level. This handout provides details of the information, along with maps and diagrams, to be presented during the familiarization tours. The handout will be distributed to the trainees at the time of the tour. A corresponding checklist will also be used as guidance during the familiarization tours to ensure that all required information is presented to LAFD personnel.

  20. Use of Botulinum toxin in 55 children with cerebral palsy

    Directory of Open Access Journals (Sweden)

    Mohammadi M

    2000-10-01

    Full Text Available Botulinum toxin A (BTA inhibits presynaptic release of acetylcholine at the neuromuscular junction and has reportedly been successful in the treatment of spastic disorders.To evaluate the effect of botulinum toxin on cerebral palsied children with spastic or mixed type of the disease, especially those patiens having spasticity as a cardinal symptom without joint contracture, we designed the following study. Ninety-one cases (55 of referred patients to pediatic Neurology outpatient clinics of children’s Medical Center were given BTA injections in affected muscles of the lower limb. They were reevaluating 3 to 5 weeks and 3 months later for type of walking and range of affected joints’ movement. The study showed a clinically significant gait improvement in 71.2% of patients (P<0.0005 and also an overall increased range of motion in affected limbs after BTA injection (P<0.04. Side effects occurred only in two cases as transient generalized weakness, gent recurvatum and ptosis. Drug effectiveness was time-limited, lasting abot 3 months in all patients ( a golden time for rehabilitation therapists to improve the patients’ condition. Overall, BTA has improved both the type of walking as well as the range of joints motion in our patients. So its’ administration is suggested in cerebral palsied children if the spasticity is a major and disabling sign

  1. The LBL 55-meter spherical grating monochromator at SSRL

    Science.gov (United States)

    McKinney, W. R.; Howells, M. R.; Lauritzen, T.; Chin, J.; DiGennaro, R.; Fong, E.; Gath, W.; Guigli, J.; Hogrefe, H.; Meneghetti, J.; Plate, D.; Heimann, P. A.; Terminello, L.; Ji, Z.; Shirley, D.; Senf, F.

    1990-05-01

    A 55 meter spherical grating monochromator has been completed at the Stanford Synchrotron Radiation Laboratory (SSRL). The monochromator includes a unique capability for water cooled gratings, and is presently operating with a fused silica grating from 180 to 820 eV. A resolution of 60 meV has been achieved at 400 eV, inferred from the linewidths of the nitrogen 1s-π∗ resonance. A photon flux of 4 × 10 10 photon/s has been observed at 440 eV and 40 mA ring current (and with 0.5 eV resolution). It is expected that this flux value will improve by a factor of approximately 10-30 when a full-performance condensing system is installed later this year. The optical and mechanical systems design of the Rowland Circle monochromator with moving entrance and exit slits is reviewed. The details of the laser interferometer encoded wavelength drive, the mounting of the water cooled gratings, and the mechanical design features which improve the stability and accuracy of the system are described. The alignment of the gratings, grating chamber, and slits is discussed.

  2. Cyclotron Production of High–Specific Activity 55Co and In Vivo Evaluation of the Stability of 55Co Metal-Chelate-Peptide Complexes

    Directory of Open Access Journals (Sweden)

    Tara Mastren

    2015-10-01

    Full Text Available This work describes the production of high–specific activity 55Co and the evaluation of the stability of 55Co-metal-chelate-peptide complexes in vivo. 55Co was produced via the 58Ni(p,α55Co reaction and purified using anion exchange chromatography with an average recovery of 92% and an average specific activity of 1.96 GBq/μmol. 55Co-DO3A and 55Co-NO2A peptide complexes were radiolabeled at 3.7 MBq/μg and injected into HCT-116 tumor xenografted mice. Positron emission tomography (PET and biodistribution studies were performed at 24 and 48 hours postinjection and compared to those of 55CoCl2. Both 55Co-metal-chelate complexes demonstrated good in vivo stability by reducing the radiotracers’ uptake in the liver by sixfold at 24 hours with ˜ 1% ID/g and at 48 hours with ˜ 0.5% ID/g and reducing uptake in the heart by fourfold at 24 hours with ˜ 0.7% ID/g and sevenfold at 48 hours with ˜ 0.35% ID/g. These results support the use of 55Co as a promising new radiotracer for PET imaging of cancer and other diseases.

  3. Cyclotron production of high specific activity 55Co and in vivo evaluation of the stability of 55Co metal-chelate-peptide complexes

    Science.gov (United States)

    Mastren, Tara; Marquez, Bernadette V.; Sultan, Deborah E.; Bollinger, Elizabeth; Eisenbeis, Paul; Voller, Tom; Lapi, Suzanne E.

    2016-01-01

    This work describes the production of high-specific activity 55Co and the evaluation of the stability of 55Co-metal-chelate-peptide complexes in vivo. 55Co was produced via the 58Ni(p,α)55Co reaction and purified using anion exchange chromatography with an average recovery of 92% and an average specific activity of 1.96GBq/µmol. 55Co-DO3A and 55Co-NO2A peptide complexes were radiolabelled at 3.7MBq/µg and injected into HCT-116 tumor xenografted mice. PET imaging and biodistribution studies were performed at 24 and 48 hours post injection and compared with that of 55CoCl2. Both 55Co-metal-chelate complexes demonstrated good in vivo stability by reducing the radiotracers’ uptake in the liver by 6-fold at 24 with ~1% ID/g and at 48 hours with ~0.5% ID/g, and reducing uptake in the heart by 4-fold at 24 hours with ~0.7% ID/g and 7-fold at 48 hours with ~0.35% ID/g. These results support the use of 55Co as a promising new radiotracer for Positron Emission Tomography (PET) imaging of cancer and other diseases. PMID:26505224

  4. {sup 55}Co separation from proton irradiated metallic nickel

    Energy Technology Data Exchange (ETDEWEB)

    Valdovinos, H. F., E-mail: hvaldovinos@wisc.edu; Graves, S., E-mail: hvaldovinos@wisc.edu; Barnhart, T., E-mail: hvaldovinos@wisc.edu; Nickles, R. J., E-mail: hvaldovinos@wisc.edu [Department of Medical Physics, University of Wisconsin - Madison, Madison, WI (United States)

    2014-11-07

    {sup 55}Co with > 97% radionuclidic purity 24 hours after end of bombardment (EoB) was produced from the {sup 58}Ni(p,α) reaction using proton irradiations of 16 MeV on natural nickel. Two-hour irradiations with 25 μA on a 254 μm thick nickel foil generate 0.18 ± 0.01 GBq (n = 3) 24 hours after EoB. The separation of cobalt from the target material and other metallic contaminants present at trace levels is accomplished in HCl medium by two rounds of anion exchange chromatography (AG1-X8) using an automated module driven by a peristaltic pump. 80 ± 5 % (n = 3) of the activity generated at EoB is ready for labeling in 0.1 M HCl one hour after the start of separation. Using 99.999% pure Ni, the reactivity (decay corrected to EoB) with the bifunctional chelator (BFC) DOTA was 8.5 GBq/μmol; enough for radiolabeling BFC conjugated biomolecules at a nmol scale with > 90% yield. Using 99.9% pure Ni the reactivity with DOTA and NOTA was 0.19 +/− 0.09 GBq/μmol and 2.9 +/− 1.7 GBq/μmol (n = 2), respectively. Both cobalt complexes showed 100% in vitro stability in PBS and mouse serum over 41 hours at room temperature. MicroPET images of a miniature Derenzo phantom show excellent resolution where rods of 1.5 mm were separated by two times their diameter.

  5. One-neutron knockout from {sup 51-55}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Schwertel, S.; Maierbeck, P.; Gernhaeuser, R.; Bildstein, V.; Boehmer, M.; Eppinger, K.; Faestermann, T.; Friese, J.; Fabbietti, L.; Maier, L.; Winkler, S. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Kruecken, R. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); TRIUMF, Vancouver (Canada); University of British Columbia, Department of Physics and Astronomy, Vancouver (Canada); Kroell, T. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Alvarez-Pol, H.; Benjamim, E.A.; Benlliure, J.; Caamano, M.; Cortina-Gil, D.; Gascon, M.; Kurtukian, T.; Perez, D.; Rodriguez-Tajes, C. [Universidade de Santiago de Compostela, Departamento de Fisica de Particulas, Santiago de Compostela (Spain); Aksouh, F.; Aumann, T.; Behr, K.; Boretzky, K.; Bruenle, A.; Chatillon, A.; Chulkov, L.V.; Geissel, H.; Gerl, J.; Gorska, M.; Kojouharov, I.; Klimkiewicz, A.; Kurz, N.; Nociforo, C.; Schaffner, H.; Simon, H.; Stanoiu, M.; Suemmerer, K.; Weick, H. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Borge, M.J.G.; Pascual-Izarra, C.; Perea, A.; Tengblad, O. [CSIC, Instituto de Estructura de la Materia, Madrid (Spain); Buerger, A. [University of Oslo, SAFE/OCL, Oslo (Norway); CEA, Gif-sur-Yvette (France); Casarejos, E.; Brown, B.A. [University of Vigo, Vigo (Spain); Enders, J.; Schrieder, G. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Hansen, P.G. [Michigan State University, NSCL, East Lansing, Michigan (United States); Jonson, B.; Nyman, G. [Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Kanungo, R. [TRIUMF, Vancouver (Canada); GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Saint Mary' s University, Halifax (Canada); Kiselev, O. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Johannes Gutenberg Universitaet, Mainz (Germany); Paul Scherrer Institut, Villigen (Switzerland); Larsson, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Le Bleis, T. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); IN2P3-CNRS/Universite Louis Pasteur, Institut Pluridisciplinaire Hubert Curien, Strasbourg Cedex 2 (France); Mahata, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Paul Scherrer Institut, Villigen (Switzerland); Nilsson, T. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Prochazka, A. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Comenius University, Faculty of Mathematics and Physics, Bratislava (Slovakia); Rossi, D. [Johannes Gutenberg Universitaet, Mainz (Germany); Sitar, B. [Comenius University, Faculty of Mathematics and Physics, Bratislava (Slovakia); Otsuka, T. [University of Tokyo, Hongo, Bunkyo-ku, Department of Physics, Tokyo (Japan); Tostevin, J.A. [University of Surrey, Department of Physics, Faculty of Engineering and Physical Sciences, Guildford (United Kingdom); Rae, W.D.M. [Garsington, Oxfordshire (United Kingdom)

    2012-12-15

    Results are presented from a one-neutron knockout experiment at relativistic energies of {approx} 420 A MeV on {sup 51-55}Sc using the GSI Fragment Separator as a two-stage magnetic spectrometer and the MINIBALL array for gamma-ray detection. Inclusive longitudinal momentum distributions and cross-sections were measured enabling the determination of the contributions corresponding to knockout from the {nu}p{sub 1/2}, {nu}p{sub 3/2}, (L = 1) and {nu}f{sub 7/2}, {nu}f{sub 5/2} (L = 3) neutron orbitals. The observed L = 1 and L = 3 contributions are compared with theoretical cross-sections using eikonal knockout theory and spectroscopic factors from shell model calculations using the GXPF1A interaction. The measured inclusive knockout cross-sections generally follow the trends expected theoretically and given by the spectroscopic strength predicted from the shell model calculations. However, the deduced L = 1 cross-sections are generally 30-40% higher while the L = 3 contributions are about a factor of two smaller than predicted. This points to a promotion of neutrons from the {nu}f{sub 7/2} to the {nu}p{sub 3/2} orbital indicating a weakening of the N = 28 shell gap in these nuclei. While this is not predicted for the phenomenological GXPF1A interaction such a weakening is predicted by recent calculations using realistic low-momentum interactions V{sub low} {sub k} obtained by evolving a chiral N3LO nucleon-nucleon potential. (orig.)

  6. Prevalence of lung abnormalities in 55 patients with esophageal cancer; Prevalencia de achados pulmonares em 55 pacientes com neoplasias esofagianas

    Energy Technology Data Exchange (ETDEWEB)

    Zan, Tiago Alves de Brito; Cordeiro, Jose Antonio [Faculdade de Medicina do Sao Jose do Rio Preto (FAMERP), SP (Brazil); Franca, Fabricio Correa de [Hospital de Base de Sao Jose do Rio Preto, SP (Brazil). Servico de Radiologia; Muniz, Marcos Pontes [Fundacao Faculdade Regional de Medicina de Sao Jose do Rio Preto (FUNFARME), SP (Brazil). Servico de Radiologia; Borim, Aldenis Albenese [Fundacao Faculdade Regional de Medicina de Sao Jose do Rio Preto (FUNFARME), SP (Brazil). Dept. de Cirurgia; Cury, Patricia Maluf [Fundacao Faculdade Regional de Medicina de Sao Jose do Rio Preto (FUNFARME), SP (Brazil). Dept. de Patologia]. E-mail: pmcury@famerp.br

    2001-02-01

    The objective was to identify lung abnormalities in patients with esophageal cancer, to compare the obtained data and to demonstrate its relationship with smoking. This was a series of cases type of cross-sectional study. We studied 55 patients with esophageal carcinoma diagnosed between 1998 and 2001 at Hospital de Base de Sao Jose do Rio Preto, SP, Brazil. Chest plain films and computed tomography scans were analyzed. The frequency of the tumors and other lung abnormalities in two groups of patients were compared: smokers and non-smokers. The results showed that forty-six (83%) patients had spinous cell carcinoma, seven (13%) adenocarcinomas, one (2%) carcinoma of small cells and one (2%) non-Hodgkin lymphoma. Forty-eight (87%) patients were smokers and seven (13%) were non-smokers. In the smokers group, 89% had spinous cell carcinoma, 9% adenocarcinoma and 2% small cells carcinoma. In the non-smokers group, 57% had adenocarcinoma, 28% spinous cell carcinoma and 15% non-Hodgkin lymphoma. Metastases were identified in four smokers and in two non-smokers. The prevalence of the lung abnormalities (interstitial infiltration, emphysema and pneumonia) was higher in the smokers group (73%) than in the non-smokers group (27%) (p = 0.03). We concluded that this fact reinforces the importance of evaluation of the lungs in patients with esophageal neoplasms. (author)

  7. [Biological characteristics of CD55(hig); side population in breast cancer cell line MCF-7].

    Science.gov (United States)

    Yang, Chao; Cui, Zhi-chao; Liu, Yun-jiang; Wang, Shi-jie

    2012-05-01

    To determine whether the CD55(hig); expression (CD55(hig);) cells in side population (SP) of the cell line MCF-7 possess characteristics of cancer stem cells. Breast cancer cell line MCF-7 was cultured and the nucleic acid dye Hoechst33342 and Verapami were added. Flow cytometry (FCM) was employed to isolate the cells of SP and mian population (MP), the cells were then labeled with CD55 mAb; mean values of fluorescence intensity of CD55 in SP and MP cells were measured. CD55 mAb was used to mark the unsorted MCF-7 cells, the proportion of CD55(hig); cells was determined, and then CD55(hig); cells were sorted and collected, to observe biological characteristics, such as cell morphology, adherence rate, colony formation and cell cycle distribution as well as nude mice implantation. Mean value of fluorescence intensity of CD55 in SP cells was 100.85±4.57, and mean value of fluorescence intensity of CD55 in MP cells was 50.51±4.75; the proportion of CD55(hig); cell in MCF-7 cells was 2.12%; adherent rate of CD55(hig); cells in 24 h was lower than that in CD55(low); cells and 24 h after inoculation adherent rates of both cells had no significant difference (P>0.05); CD55(hig); cells were mostly spherical and kept in a suspended state at 12 hours after inoculation and culture; CD55(hig); cells had the ability of colony formation, the clone-forming rate of CD55(hig); cells was (20.04±1.07)% when the cells were cultured for one week, it was lower than the rate of (27.14±1.07)% in CD55(low); cells (P<0.01); the ratio of G0/G1 resting cells in CD55(hig); cells was (85.4±3.37)% which was higher than that in CD55(low); cells (58.6±2.55)% and in MCF-7 cells (70.73±4.21)%, which had a statistically significant difference (P<0.05). All nude mice implanted with CD55(hig); cells developed the tumor, and the pathological examination of the transplanted tumor had the properties of malignant cells. A few CD55(hig); cells were found in breast cancer MCF-7 cells, and most of CD55

  8. 46 CFR 32.40-55 - Insect screens-T/ALL.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Insect screens-T/ALL. 32.40-55 Section 32.40-55 Shipping... REQUIREMENTS Accommodations for Officers and Crew § 32.40-55 Insect screens—T/ALL. Provisions shall be made to protect the crew quarters against the admission of insects. ...

  9. Visualization of damaged brain tissue after ischemic stroke with cobalt-55 positron emission tomography

    NARCIS (Netherlands)

    Jansen, H M; Pruim, J; vd Vliet, A M; Paans, A M; Hew, J M; Franssen, E J; de Jong, B M; Kosterink, J G; Haaxma, R; Korf, J

    UNLABELLED: In animal experiments, the radionuclide 55Co2+ has been shown to accumulate in degenerating cerebral tissue similar to Ca2+. METHODS: The potential role of 55Co2+ for in vivo brain PET imaging was investigated in four patients after ischemic stroke. RESULTS: PET showed uptake of 55Co2+

  10. 9 CFR 113.55 - Detection of extraneous agents in Master Seed Virus.

    Science.gov (United States)

    2010-01-01

    ... Master Seed Virus. 113.55 Section 113.55 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Ingredient Requirements § 113.55 Detection of extraneous agents in Master Seed Virus... Seed Virus (MSV) shall be tested as prescribed in this section. A MSV found unsatisfactory by any...

  11. 8 CFR 1240.55 - Proceedings commenced prior to April 1, 1997.

    Science.gov (United States)

    2010-01-01

    ..., 1997. 1240.55 Section 1240.55 Aliens and Nationality EXECUTIVE OFFICE FOR IMMIGRATION REVIEW..., 1997) § 1240.55 Proceedings commenced prior to April 1, 1997. Subpart F of 8 CFR part 1240 applies to deportation proceedings commenced prior to April 1, 1997. A deportation proceeding is commenced by the filing...

  12. 33 CFR 55.5 - Who is eligible for child development services?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Who is eligible for child development services? 55.5 Section 55.5 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PERSONNEL CHILD DEVELOPMENT SERVICES General § 55.5 Who is eligible for child development services...

  13. 42 CFR 493.55 - Application for registration certificate and certificate of accreditation.

    Science.gov (United States)

    2010-10-01

    ... annually (excluding waived tests and tests for quality control, quality assurance or proficiency testing... certificate of accreditation. 493.55 Section 493.55 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES... Certificate of Accreditation § 493.55 Application for registration certificate and certificate of...

  14. Inhibition of Decay-Accelerating Factor (CD55 Attenuates Prostate Cancer Growth and Survival In Vivo

    Directory of Open Access Journals (Sweden)

    Robert D. Loberg

    2006-01-01

    Full Text Available Decay-accelerating factor (CD55 is a member of membrane-bound complement-regulatory proteins. CD55 expression correlates with poor survival in patients with colorectal cancer and has been implicated in the survival and tumorigenesis of blood-borne malignancies. Histologic analysis of clinical specimens from patients with advanced prostate cancer revealed an increase in CD55 expression in prostate tumor epithelial cells. CD55 was shown to be functionally active and to inhibit complement-mediated lysis in PC-3 and DU145 cells. The percentage of lysis was correlative with the CD55 expression profile observed in these prostate cancer cell lines. These data suggest that CD55 is an important regulator of prostate cancer cell survival. As a result, we have hypothesized that CD55 expression on prostate cancer cells promotes cell survival and contributes to the metastatic potential of prostate cancer cells. To determine the role of CD55 in prostate cancer tumorigenesis and metastasis, we generated PC-3Luc prostate cancer cells with CD55 siRNA-targeted disruption. We found that PC-3Luc/CD55 siRNA constructs in SCID mice resulted in a significant attenuation of overall tumor burden. Further investigation into the mechanisms of CD55-mediated tumor cell/microenvironment interaction is necessary to understand the role of CD55 in tumor cell survival and metastatic lesion formation.

  15. 10 CFR 32.55 - Same: Quality assurance; prohibition of transfer.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Same: Quality assurance; prohibition of transfer. 32.55 Section 32.55 Energy NUCLEAR REGULATORY COMMISSION SPECIFIC DOMESTIC LICENSES TO MANUFACTURE OR TRANSFER CERTAIN ITEMS CONTAINING BYPRODUCT MATERIAL Generally Licensed Items § 32.55 Same: Quality assurance...

  16. GPR55, a G-protein coupled receptor for lysophosphatidylinositol, plays a role in motor coordination.

    Directory of Open Access Journals (Sweden)

    Chia-Shan Wu

    Full Text Available The G-protein coupled receptor 55 (GPR55 is activated by lysophosphatidylinositols and some cannabinoids. Recent studies found prominent roles for GPR55 in neuropathic/inflammatory pain, cancer and bone physiology. However, little is known about the role of GPR55 in CNS development and function. To address this question, we performed a detailed characterization of GPR55 knockout mice using molecular, anatomical, electrophysiological, and behavioral assays. Quantitative PCR studies found that GPR55 mRNA was expressed (in order of decreasing abundance in the striatum, hippocampus, forebrain, cortex, and cerebellum. GPR55 deficiency did not affect the concentrations of endocannabinoids and related lipids or mRNA levels for several components of the endocannabinoid system in the hippocampus. Normal synaptic transmission and short-term as well as long-term synaptic plasticity were found in GPR55 knockout CA1 pyramidal neurons. Deleting GPR55 function did not affect behavioral assays assessing muscle strength, gross motor skills, sensory-motor integration, motor learning, anxiety or depressive behaviors. In addition, GPR55 null mutant mice exhibited normal contextual and auditory-cue conditioned fear learning and memory in a Pavlovian conditioned fear test. In contrast, when presented with tasks requiring more challenging motor responses, GPR55 knockout mice showed impaired movement coordination. Taken together, these results suggest that GPR55 plays a role in motor coordination, but does not strongly regulate CNS development, gross motor movement or several types of learned behavior.

  17. 42 CFR 484.55 - Condition of participation: Comprehensive assessment of patients.

    Science.gov (United States)

    2010-10-01

    ... assessment of patients. 484.55 Section 484.55 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES... Furnishing of Services § 484.55 Condition of participation: Comprehensive assessment of patients. Each patient must receive, and an HHA must provide, a patient-specific, comprehensive assessment that...

  18. 40 CFR 161.55 - Agricultural vs. non-agricultural pesticides.

    Science.gov (United States)

    2010-07-01

    ... pesticides. 161.55 Section 161.55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS DATA REQUIREMENTS FOR REGISTRATION OF ANTIMICROBIAL PESTICIDES General Provisions § 161.55 Agricultural vs. non-agricultural pesticides. Section 25(a)(1) of FIFRA instructs the...

  19. 28 CFR 2.55 - Disclosure of file prior to parole hearing.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Disclosure of file prior to parole hearing. 2.55 Section 2.55 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.55 Disclosure of file prior to...

  20. Geologic Map of the Lavinia Planitia Quadrangle (V-55), Venus

    Science.gov (United States)

    Ivanov, Mikhail A.; Head, James W.

    2001-01-01

    Introduction The Lavinia Planitia quadrangle (V-55) is in the southern hemisphere of Venus and extends from 25 to 50 south latitude and from 330 to 360 longitude. It covers the central and northern part of Lavinia Planitia and parts of its margins. Lavinia Planitia consists of a centralized, deformed lowland flooded by volcanic deposits and surrounded by Dione Regio to the west (Keddie and Head, 1995), Alpha Regio tessera (Bindschadler and others, 1992a) and Eve Corona (Stofan and others, 1992) to the northeast, itself an extensive rift zone and coronae belt to the east and south (Baer and others, 1994; Magee and Head, 1995), Mylitta Fluctus to the south (Magee Roberts and others, 1992), and Helen Planitia to the southwest (Senske and others, 1991). In contrast to other areas on Venus, the Lavinia Planitia area is one of several large, relatively equidimensional lowlands (basins) and as such is an important region for the analysis of processes of basin formation and volcanic flooding. Before the Magellan mission, Lavinia Planitia was known on the basis of Pioneer-Venus altimetry to be a lowland area (Pettengill and others, 1980);. Arecibo radar images showed that Lavinia Plaitia was surrounded by several corona-like features and rift-like fractures parallel to the basin margin to the east and south (Senske and others, 1991; Campbell and others, 1990). Arecibo data further revealed that the interior contained complex patterns of deformational features in the form of belts and volcanic plains, and several regions along the margins were seen to be the sources of extensive outpourings of digitate lava flows into the interior (Senske and others, 1991; Campbell and others, 1990). Early Magellan results showed that the ridge belts are composed of complex structures of both extensional and contractional origin (Squyres and others, 1992; Solomon and others, 1992) and that the complex lava flows (fluctus) along the margins (Magee Roberts and others, 1992) emanated from a

  1. Deletion of G-protein-coupled receptor 55 promotes obesity by reducing physical activity.

    Science.gov (United States)

    Meadows, A; Lee, J H; Wu, C-S; Wei, Q; Pradhan, G; Yafi, M; Lu, H-C; Sun, Y

    2016-03-01

    Cannabinoid receptor 1 (CB1) is the best-characterized cannabinoid receptor, and CB1 antagonists are used in clinical trials to treat obesity. Because of the wide range of CB1 functions, the side effects of CB1 antagonists pose serious concerns. G-protein-coupled receptor 55 (GPR55) is an atypical cannabinoid receptor, and its pharmacology and functions are distinct from CB1. GPR55 regulates neuropathic pain, gut, bone, immune functions and motor coordination. GPR55 is expressed in various brain regions and peripheral tissues. However, the roles of GPR55 in energy and glucose homeostasis are unknown. Here we have investigated the roles of GPR55 in energy balance and insulin sensitivity using GPR55-null mice (GPR55(-/-)). Body composition of the mice was measured by EchoMRI. Food intake, feeding behavior, energy expenditure and physical activity of GPR55(-/-) mice were determined by indirect calorimetry. Muscle function was assessed by forced treadmill running test. Insulin sensitivity was evaluated by glucose and insulin tolerance tests. Adipose inflammation was assessed by flow cytometry analysis of adipose tissue macrophages. The expression of inflammatory markers in adipose tissues and orexigenic/anorexigenic peptides in the hypothalamus was also analyzed by real-time PCR. GPR55(-/-) mice had normal total energy intake and feeding pattern (i.e., no changes in meal size, meal number or feeding frequency). Intriguingly, whereas adult GPR55(-/-) mice only showed a modest increase in overall body weight, they exhibited significantly increased fat mass and insulin resistance. The spontaneous locomotor activity of GPR55(-/-) mice was dramatically decreased, whereas resting metabolic rate and non-shivering thermogenesis were unchanged. Moreover, GPR55(-/-) mice exhibited significantly decreased voluntary physical activity, showing reduced running distance on the running wheels, whereas muscle function appeared to be normal. GPR55 has an important role in energy

  2. On the Mechanism of Berberine-INF55 (5-Nitro-2-phenylindole) Hybrid Antibacterials.

    Science.gov (United States)

    Dolla, Naveen K; Chen, Chao; Larkins-Ford, Jonah; Rajamuthiah, Rajmohan; Jagadeesan, Sakthimala; Conery, Annie L; Ausubel, Frederick M; Mylonakis, Eleftherios; Bremner, John B; Lewis, Kim; Kelso, Michael J

    Berberine-INF55 hybrids are a promising class of antibacterials that combine berberine and the NorA multidrug resistance pump inhibitor INF55 (5-nitro-2-phenylindole) together in one molecule via a chemically stable linkage. Previous studies demonstrated the potential of these compounds for countering efflux-mediated antibacterial drug resistance but they didn't establish whether the compounds function as originally intended, i.e. with the berberine moiety providing antibacterial activity and the attached INF55 component independently blocking multidrug resistance pumps, thereby enhancing the activity of berberine by reducing its efflux. We hypothesised that if the proposed mechanism is correct, then hybrids carrying more potent INF55 pump inhibitor structures should show enhanced antibacterial effects relative to those bearing weaker inhibitors. Two INF55 analogues showing graded reductions in NorA inhibitory activity compared with INF55 were identified and their corresponding berberine-INF55 hybrids carrying equivalent INF55 inhibitor structures synthesised. Multiple assays comparing the antibacterial effects of the hybrids and their corresponding berberine-INF55 analogue combinations showed that the three hybrids all show very similar activities, leading us to conclude that the antibacterial mechanism(s) of berberine-INF55 hybrids is different from berberine-INF55 combinations.

  3. Rod photoreceptors express GPR55 in the adult vervet monkey retina

    DEFF Research Database (Denmark)

    Bouskila, Joseph; Javadi, Pasha; Casanova, Christian

    2013-01-01

    Cannabinoids exert their actions mainly through two receptors, the cannabinoid CB1 receptor (CB1R) and cannabinoid CB2 receptor (CB2R). In recent years, the G-protein coupled receptor 55 (GPR55) was suggested as a cannabinoid receptor based on its activation by anandamide and tetrahydrocannabinol...... components (Müller cells). The aim of this study was to determine the expression pattern of GPR55 in the monkey retina by using confocal microscopy. Our results show that GPR55 is strictly localized in the photoreceptor layer of the extrafoveal portion of the retina. Co-immunolabeling of GPR55 with rhodopsin......, the photosensitive pigment in rods, revealed a clear overlap of expression throughout the rod structure with most prominent staining in the inner segments. Additionally, double-label of GPR55 with calbindin, a specific marker for cone photoreceptors in the primate retina, allowed us to exclude expression of GPR55...

  4. Neuroplastin-55 binds to and signals through the fibroblast growth factor receptor.

    Science.gov (United States)

    Owczarek, Sylwia; Kiryushko, Darya; Larsen, Marianne Hald; Kastrup, Jette Sandholm; Gajhede, Michael; Sandi, Carmen; Berezin, Vladimir; Bock, Elisabeth; Soroka, Vladislav

    2010-04-01

    Neuroplastin (Np) is a glycoprotein belonging to the immunoglobulin superfamily of cell adhesion molecules (CAMs) and existing in two isoforms, Np55 and Np65, named according to their molecular weights. The extracellular part of Np65 contains three immunoglobulin (Ig)-like modules (Ig1, Ig2, and Ig3), whereas Np55 lacks the Ig1 module. Of these two isoforms, only Np65 is involved in homophilic interactions resulting in cell adhesion, whereas the role of Np55 is poorly understood. The present study reports for the first time the crystal structure of the ectodomain of Np55 at 1.95-A resolution and demonstrates that Np55 binds to and activates the fibroblast growth factor receptor 1 (FGFR1). Furthermore, we identify a sequence motif in the Ig2 module of Np55 interacting with FGFR1 and show that a synthetic peptide encompassing this motif, termed narpin, binds to and activates FGFR1. We show that both Np55 and the narpin peptide induce neurite outgrowth through FGFR1 activation and that Np55 increases synaptic calcium concentration in an FGFR1-dependent manner. Moreover, we demonstrate that narpin has an antidepressive-like effect in rats subjected to the forced swim test, suggesting that Np55-induced signaling may be involved in synaptic plasticity in vivo. Owczarek, S., Kiryushko, D., Larsen, M. H., Kastrup, J. S., Gajhede, M., Sandi, C., Berezin, V., Bock, E., Soroka, V. Neuroplastin-55 binds to and signals through the fibroblast growth factor receptor.

  5. Density functional investigation of the adsorption effects of PH3 and SH2 on the structure stability of the Au55 and Pt55 nanoclusters

    Science.gov (United States)

    Guedes-Sobrinho, Diego; Chaves, Anderson S.; Piotrowski, Maurício J.; Da Silva, Juarez L. F.

    2017-04-01

    Although several studies have been reported for Pt55 and Au55 nanoclusters, our atomistic understanding of the interplay between the adsorbate-surface interactions and the mechanisms that lead to the formation of the distorted reduced core (DRC) structures, instead of the icosahedron (ICO) structure in gas phase, is still far from satisfactory. Here, we report a density functional theory (DFT) investigation of the role of the adsorption effects of PH3 (one lone pair of electrons) and SH2 (two lone pairs) on the relative stability of the Pt55 and Au55 nanoclusters. In gas phase, we found that the DRC structures with 7 and 9 atoms in the core region are about 5.34 eV (Pt55) and 2.20 eV (Au55) lower in energy than the ICO model with Ih symmetry and 13 atoms in the core region. However, the stability of the ICO structure increases by increasing the number of adsorbed molecules from 1 to 18, in which both DRC and ICO structures are nearly degenerate in energy at the limit of 18 ligands, which can be explained as follows. In gas phase, there is a strong compression of the cationic core region by the anionic surface atoms induced by the attractive Coulomb interactions (core+-surface-), and hence, the strain release is obtained by reducing the number of atoms in the cationic core region, which leads to the 55 atoms distorted reduced core structures. Thus, the Coulomb interactions between the core+ and surface- contribute to break the symmetry in the ICO55 structure. On the other hand, the addition of ligands on the anionic surface reduces the charge transfer between the core and surface, which contributes to decrease the Coulomb interactions and the strain on the core region of the ICO structure, and hence, it stabilizes a compact ICO structure. The same conclusion is obtained by adding van der Waals corrections to the plain DFT calculations. Similar results are obtained by the addition of steric effects, which are considered through the adsorption of triphenylphosphine

  6. 46 CFR 7.55 - Cape Henry, VA to Cape Fear, NC.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Cape Henry, VA to Cape Fear, NC. 7.55 Section 7.55 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Atlantic Coast § 7.55 Cape Henry, VA to Cape Fear, NC. (a) A line drawn from Rudee Inlet Jetty Light “2” to...

  7. The Cannabinoid Receptor CB1 Modulates the Signaling Properties of the Lysophosphatidylinositol Receptor GPR55*

    Science.gov (United States)

    Kargl, Julia; Balenga, Nariman; Parzmair, Gerald P.; Brown, Andrew J.; Heinemann, Akos; Waldhoer, Maria

    2012-01-01

    The G protein-coupled receptor (GPCR) 55 (GPR55) and the cannabinoid receptor 1 (CB1R) are co-expressed in many tissues, predominantly in the central nervous system. Seven transmembrane spanning (7TM) receptors/GPCRs can form homo- and heteromers and initiate distinct signaling pathways. Recently, several synthetic CB1 receptor inverse agonists/antagonists, such as SR141716A, AM251, and AM281, were reported to activate GPR55. Of these, SR141716A was marketed as a promising anti-obesity drug, but was withdrawn from the market because of severe side effects. Here, we tested whether GPR55 and CB1 receptors are capable of (i) forming heteromers and (ii) whether such heteromers could exhibit novel signaling patterns. We show that GPR55 and CB1 receptors alter each others signaling properties in human embryonic kidney (HEK293) cells. We demonstrate that the co-expression of FLAG-CB1 receptors in cells stably expressing HA-GPR55 specifically inhibits GPR55-mediated transcription factor activation, such as nuclear factor of activated T-cells and serum response element, as well as extracellular signal-regulated kinases (ERK1/2) activation. GPR55 and CB1 receptors can form heteromers, but the internalization of both receptors is not affected. In addition, we observe that the presence of GPR55 enhances CB1R-mediated ERK1/2 and nuclear factor of activated T-cell activation. Our data provide the first evidence that GPR55 can form heteromers with another 7TM/GPCR and that this interaction with the CB1 receptor has functional consequences in vitro. The GPR55-CB1R heteromer may play an important physiological and/or pathophysiological role in tissues endogenously co-expressing both receptors. PMID:23161546

  8. Deletion of G-protein-coupled receptor 55 promotes obesity by reducing physical activity

    Science.gov (United States)

    Cannabinoid receptor 1 (CB1) is the best-characterized cannabinoid receptor, and CB1 antagonists are used in clinical trials to treat obesity. Because of the wide range of CB1 functions, the side effects of CB1 antagonists pose serious concerns. G-protein-coupled receptor 55 (GPR55) is an atypical c...

  9. 34 CFR 364.55 - What standards shall service providers meet?

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false What standards shall service providers meet? 364.55 Section 364.55 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION STATE INDEPENDENT LIVING SERVICES...

  10. 21 CFR 349.55 - Labeling of ophthalmic astringent drug products.

    Science.gov (United States)

    2010-04-01

    .... 349.55 Section 349.55 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS FOR HUMAN USE OPHTHALMIC DRUG PRODUCTS FOR OVER-THE-COUNTER HUMAN USE Labeling... vision, continued redness or irritation of the eye, or if the condition worsens or persists for more than...

  11. 34 CFR 535.55 - What is the length of the deferment of repayment?

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false What is the length of the deferment of repayment? 535.55 Section 535.55 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF BILINGUAL EDUCATION AND MINORITY LANGUAGES AFFAIRS, DEPARTMENT OF EDUCATION BILINGUAL EDUCATION...

  12. 21 CFR 1311.55 - Requirements for systems used to process digitally signed orders.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Requirements for systems used to process digitally signed orders. 1311.55 Section 1311.55 Food and Drugs DRUG ENFORCEMENT ADMINISTRATION, DEPARTMENT OF... deactivated, the system must clear the plain text private key from the system memory to prevent the...

  13. 46 CFR 78.55-1 - Master and chief engineer responsible.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Master and chief engineer responsible. 78.55-1 Section... OPERATIONS Carrying of Excess Steam § 78.55-1 Master and chief engineer responsible. It shall be the duty of the master and the engineer in charge of the boilers of any vessel to require that a steam pressure is...

  14. TA 55 Reinvestment Project II Phase C Update Project Status May 23, 2017

    Energy Technology Data Exchange (ETDEWEB)

    Giordano, Anthony P. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-05-25

    The TA-55 Reinvestment Project (TRP) II Phase C is a critical infrastructure project focused on improving safety and reliability of the Los Alamos National Laboratory (LANL) TA-55 Complex. The Project recapitalizes and revitalizes aging and obsolete facility and safety systems providing a sustainable nuclear facility for National Security Missions.

  15. 15 CFR 990.55 - Restoration selection-developing restoration plans.

    Science.gov (United States)

    2010-01-01

    ... demonstrable factors. Trustees must, at a minimum, determine what criteria will: (i) Constitute success, such... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Restoration selection-developing restoration plans. 990.55 Section 990.55 Commerce and Foreign Trade Regulations Relating to Commerce and...

  16. Expression of the activation antigen CD97 and its ligand CD55 in rheumatoid synovial tissue

    NARCIS (Netherlands)

    Hamann, J. [=Jörg; Wishaupt, J. O.; van Lier, R. A.; Smeets, T. J.; Breedveld, F. C.; Tak, P. P.

    1999-01-01

    OBJECTIVE: Fibroblast-like synoviocytes (FLS) express decay-accelerating factor (CD55) at high levels. Recently, it was found that CD55 is a specific cellular ligand for the 7-span transmembrane receptor CD97. The objective of this study was to define the expression of this receptor-ligand pair in

  17. Deletion of either CD55 or CD97 ameliorates arthritis in mouse models

    NARCIS (Netherlands)

    Hoek, Robert M.; de Launay, Daphne; Kop, Else N.; Yilmaz-Elis, A. Seda; Lin, Feng; Reedquist, Kris A.; Verbeek, J. Sjef; Medof, M. Edward; Tak, Paul P.; Hamann, Jörg

    2010-01-01

    OBJECTIVE: CD55 (decay-accelerating factor) is best known for its role in the negative regulation of the complement system. Indeed, lack of this molecule leads to disease aggravation in many autoimmune disease models. However, CD55 is abundantly present on fibroblast-like synoviocytes and is also a

  18. Deletion of either CD55 or CD97 ameliorates arthritis in mouse models.

    NARCIS (Netherlands)

    Hoek, R.M.; Launay, D. de; Kop, E.N.; Yilmaz-Elis, A.S.; Lin, F.; Reedquist, K.A.; Verbeek, J.S.; Medof, M.E.; Tak, P.P.; Hamann, J.

    2010-01-01

    OBJECTIVE: CD55 (decay-accelerating factor) is best known for its role in the negative regulation of the complement system. Indeed, lack of this molecule leads to disease aggravation in many autoimmune disease models. However, CD55 is abundantly present on fibroblast-like synoviocytes and is also a

  19. 7 CFR 400.55 - Qualification for actual production history coverage program.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Qualification for actual production history coverage program. 400.55 Section 400.55 Agriculture Regulations of the Department of Agriculture (Continued) FEDERAL CROP INSURANCE CORPORATION, DEPARTMENT OF AGRICULTURE GENERAL ADMINISTRATIVE REGULATIONS Actual...

  20. Simplified synthesis of isotopically labeled 5,5-dimethyl-pyrroline N-oxide.

    Science.gov (United States)

    Leinisch, Fabian; Jiang, Jinjie; Deterding, Leesa J; Mason, Ronald P

    2011-10-10

    5,5-Dimethylpyrroline N-oxide (15N) and 5,5-di(trideuteromethyl)pyrroline N-oxide were synthesized from the respective isotopically labeled 2-nitropropane analogs obtained from the reaction of sodium nitrate with 2-halopropanes. This facile, straightforward process allows synthesizing isotopically labeled DMPO analogs in a 4-step reaction without special equipment.

  1. 45 CFR 1355.55 - Review and assessment of the system developed with enhanced funds.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Review and assessment of the system developed with enhanced funds. 1355.55 Section 1355.55 Public Welfare Regulations Relating to Public Welfare (Continued... CHILDREN, YOUTH AND FAMILIES, FOSTER CARE MAINTENANCE PAYMENTS, ADOPTION ASSISTANCE, AND CHILD AND FAMILY...

  2. 49 CFR 1242.79 - Communication systems operations (account XX-55-77).

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Communication systems operations (account XX-55-77...-Transportation § 1242.79 Communication systems operations (account XX-55-77). Separate common expenses on bases of the percentages calculated for the separation of Communication Systems (account XX-19-20), § 1242...

  3. Simplified Synthesis of Isotopically Labeled 5,5-Dimethyl-pyrroline N-Oxide

    Directory of Open Access Journals (Sweden)

    Ronald P. Mason

    2011-10-01

    Full Text Available 5,5-Dimethylpyrroline N-oxide (15N and 5,5-di(trideuteromethylpyrroline N-oxide were synthesized from the respective isotopically labeled 2-nitropropane analogs obtained from the reaction of sodium nitrate with 2-halopropanes. This facile, straightforward process allows synthesizing isotopically labeled DMPO analogs in a 4-step reaction without special equipment.

  4. 40 CFR 417.55 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Standards of performance for new sources. 417.55 Section 417.55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Glycerine...

  5. 17 CFR 204.55 - Change in notification to Financial Management Service.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Change in notification to Financial Management Service. 204.55 Section 204.55 Commodity and Securities Exchanges SECURITIES AND... Financial Management Service. After the Commission sends FMS notification of an individual's liability for a...

  6. Potent and selective N-(4-sulfamoylphenyl)thiourea-based GPR55 agonists.

    Science.gov (United States)

    Yrjölä, Sari; Parkkari, Teija; Navia-Paldanius, Dina; Laitinen, Tuomo; Kaczor, Agnieszka A; Kokkola, Tarja; Adusei-Mensah, Frank; Savinainen, Juha R; Laitinen, Jarmo T; Poso, Antti; Alexander, Amy; Penman, June; Stott, Lisa; Anskat, Marie; Irving, Andrew J; Nevalainen, Tapio J

    2016-01-01

    To date, many known G protein-coupled receptor 55 (GPR55) ligands are those identified among the cannabinoids. In order to further study the function of GPR55, new potent and selective ligands are needed. In this study, we utilized the screening results from PubChem bioassay AID 1961 which reports the results of Image-based HTS for Selective Agonists of GPR55. Three compounds, CID1792579, CID1252842 and CID1011163, were further evaluated and used as a starting point to create a series of nanomolar potency GPR55 agonists with N-(4-sulfamoylphenyl)thiourea scaffold. The GPR55 activity of the compounds were screened by using a commercial β-arrestin PathHunter assay and the potential compounds were further evaluated by using a recombinant HEK cell line exhibiting GPR55-mediated effects on calcium signalling. The designed compounds were not active when tested against various endocannabinoid targets (CB1R, CB2R, FAAH, MGL, ABHD6 and ABHD12), indicating compounds' selectivity for the GPR55. Finally, structure-activity relationships of these compounds were explored. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  7. 46 CFR 78.47-55 - Instructions for changing steering gear.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Instructions for changing steering gear. 78.47-55... OPERATIONS Markings for Fire and Emergency Equipment, Etc. § 78.47-55 Instructions for changing steering gear..., relating in order, the different steps to be taken in changing to the emergency steering gear. Each clutch...

  8. Neutron spectroscopic factors of 55Ni hole-states from (p,d transfer reactions

    Directory of Open Access Journals (Sweden)

    A. Sanetullaev

    2014-09-01

    Full Text Available Spectroscopic information has been extracted on the hole-states of 55Ni, the least known of the quartet of nuclei (55Ni, 57Ni, 55Co and 57Cu, one nucleon away from 56Ni, the N=Z=28 double magic nucleus. Using the H1(Ni56,dNi55 transfer reaction in inverse kinematics, neutron spectroscopic factors, spins and parities have been extracted for the f7/2, p3/2 and the s1/2 hole-states of 55Ni. These new data provide a benchmark for large basis calculations that include nucleonic orbits in both the sd and pf shells. State of the art calculations have been performed to describe the excitation energies and spectroscopic factors of the s1/2 hole-state below Fermi energy.

  9. Neutron spectroscopic factors of {sup 55}Ni hole-states from (p,d) transfer reactions

    Energy Technology Data Exchange (ETDEWEB)

    Sanetullaev, A. [National Superconducting Cyclotron Laboratory and Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Tsang, M.B., E-mail: tsang@nscl.msu.edu [National Superconducting Cyclotron Laboratory and Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Lynch, W.G.; Lee, Jenny; Bazin, D. [National Superconducting Cyclotron Laboratory and Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Chan, K.P. [National Superconducting Cyclotron Laboratory and Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Physics Department, Hong Kong Chinese University, Shatin, Hong Kong (China); Coupland, D.; Henzl, V.; Henzlova, D.; Kilburn, M.; Rogers, A.M. [National Superconducting Cyclotron Laboratory and Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Sun, Z.Y. [National Superconducting Cyclotron Laboratory and Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Institute of Modern Physics, CAS, Lanzhou 730000 (China); Youngs, M. [National Superconducting Cyclotron Laboratory and Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Charity, R.J.; Sobotka, L.G. [Department of Chemistry, Washington University, St. Louis, MO 63130 (United States); Famiano, M. [Department of Physics, Western Michigan University, Kalamazoo, MI 49008 (United States); Hudan, S. [Department of Chemistry, Indiana University, Bloomington, IN 47405 (United States); Shapira, D. [Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Peters, W.A. [Rutgers University, Piscataway, NJ 08854 (United States); Barbieri, C. [Department of Physics, University of Surrey, Guildford GU2 7XH (United Kingdom); and others

    2014-09-07

    Spectroscopic information has been extracted on the hole-states of {sup 55}Ni, the least known of the quartet of nuclei ({sup 55}Ni, {sup 57}Ni, {sup 55}Co and {sup 57}Cu), one nucleon away from {sup 56}Ni, the N=Z=28 double magic nucleus. Using the {sup 1}H({sup 56}Ni,d){sup 55}Ni transfer reaction in inverse kinematics, neutron spectroscopic factors, spins and parities have been extracted for the f{sub 7/2}, p{sub 3/2} and the s{sub 1/2} hole-states of {sup 55}Ni. These new data provide a benchmark for large basis calculations that include nucleonic orbits in both the sd and pf shells. State of the art calculations have been performed to describe the excitation energies and spectroscopic factors of the s{sub 1/2} hole-state below Fermi energy.

  10. Neuroplastin-55 binds to and signals through the fibroblast growth factor receptor

    DEFF Research Database (Denmark)

    Owczarek, Sylwia; Kiryushko, Darya; Hald Larsen, Marianne

    2010-01-01

    Neuroplastin (Np) is a glycoprotein belonging to the immunoglobulin superfamily of cell adhesion molecules (CAMs) and existing in two isoforms, Np55 and Np65, named according to their molecular weights. The extracellular part of Np65 contains three immunoglobulin (Ig)-like modules (Ig1, Ig2, and ......-induced signaling may be involved in synaptic plasticity in vivo. Owczarek, S., Kiryushko, D., Larsen, M. H., Kastrup, J. S., Gajhede, M., Sandi, C., Berezin, V., Bock, E., Soroka, V. Neuroplastin-55 binds to and signals through the fibroblast growth factor receptor.......55 and the narpin peptide induce neurite outgrowth through FGFR1 activation and that Np55 increases synaptic calcium concentration in an FGFR1-dependent manner. Moreover, we demonstrate that narpin has an antidepressive-like effect in rats subjected to the forced swim test, suggesting that Np55...

  11. Slide 55

    Indian Academy of Sciences (India)

    V. R. Rao. Anthropological Survey of India, Kolkata. K. Gopal, Madras University, Chennai. David Reich, Harvard University, USA. Chris Tyler-Smith, Sanger Institute, UK. Toomas Kivisild, Cambridge University, UK. Gyaneshwer Chaubey, Estonia Bio-Centre, Estonia. Peter Underhill, Stanford University, USA. Students from ...

  12. CLUB 55

    OpenAIRE

    Ramón Rojano

    2000-01-01

    Este artículo presenta una reconceptualización del concepto de envejecimento. Se plantea la necesidad de revisar las etapas del desarrollo psicológico descritas por Erikson. Los recientes cambios demográficos y la prolongación de la expectativa de vida justifican el replanteamiento conceptual. Actualmente la tercera edad no es la última edad. Características que se le atribuían a este período de la vida ahora corresponden a la cuarta edad. El Departamento de Servicios Humano...

  13. 55 | Page

    African Journals Online (AJOL)

    Fr. Ikenga

    Durkheim added more flesh to this rudimentary understanding of religion by saying that it is “a unified system of belief and practices (rite) relative to sacred things, that is to say, things set apart and surrounded by prohibitions –beliefs and practices that unite its adherents in a single moral ecommunity called a Church”.9 His ...

  14. Rod photoreceptors express GPR55 in the adult vervet monkey retina.

    Directory of Open Access Journals (Sweden)

    Joseph Bouskila

    Full Text Available Cannabinoids exert their actions mainly through two receptors, the cannabinoid CB1 receptor (CB1R and cannabinoid CB2 receptor (CB2R. In recent years, the G-protein coupled receptor 55 (GPR55 was suggested as a cannabinoid receptor based on its activation by anandamide and tetrahydrocannabinol. Yet, its formal classification is still a matter of debate. CB1R and CB2R expression patterns are well described for rodent and monkey retinas. In the monkey retina, CB1R has been localized in its neural (cone photoreceptor, horizontal, bipolar, amacrine and ganglion cells and CB2R in glial components (Müller cells. The aim of this study was to determine the expression pattern of GPR55 in the monkey retina by using confocal microscopy. Our results show that GPR55 is strictly localized in the photoreceptor layer of the extrafoveal portion of the retina. Co-immunolabeling of GPR55 with rhodopsin, the photosensitive pigment in rods, revealed a clear overlap of expression throughout the rod structure with most prominent staining in the inner segments. Additionally, double-label of GPR55 with calbindin, a specific marker for cone photoreceptors in the primate retina, allowed us to exclude expression of GPR55 in cones. The labeling of GPR55 in rods was further assessed with a 3D visualization in the XZ and YZ planes thus confirming its exclusive expression in rods. These results provide data on the distribution of GPR55 in the monkey retina, different than CB1R and CB2R. The presence of GPR55 in rods suggests a function of this receptor in scotopic vision that needs to be demonstrated.

  15. Comparison of two-stage thermophilic (68 degrees C/55 degrees C) anaerobic digestion with one-stage thermophilic (55 degrees C) digestion of cattle manure

    DEFF Research Database (Denmark)

    Nielsen, H.B.; Mladenovska, Zuzana; Westermann, Peter

    2004-01-01

    , was compared with a conventional single-stage reactor running at 55degreesC with 15-days HRT. When an organic loading of 3 g volatile solids (VS) per liter per day was applied, the two-stage setup had a 6% to 8% higher specific methane yield and a 9% more effective VS-removal than the conventional single...

  16. Pattern of Coronary Artery Disease Risk Factors in Population Younger than 55 Years and Above 55 Years: A Population Study of 31999 Healthy Individuals

    Directory of Open Access Journals (Sweden)

    Zinat Nadia Hatmi

    2011-06-01

    Full Text Available More than eighty percent of patients with coronary heart diseases (CHD have conventional risk factors. Prevalence of well known risk factors seems to show a different pattern in younger patients and individual above 55 years. To evaluate the pattern of conventional CHD risk factors in healthy individuals in two different age groups. A large scale population based survey of 31999 individuals from ten medical centers was designed. Screening of risk factors was performed upon these protocols: taking medical history, physical examination and blood tests of complete blood cell counts, fasting blood sugar, lipid profile, urinalysis and creatinine. Prevalence of the risk factors in healthy people aged above 55 years were: 8.1% for systolic blood pressure (SBP>140 mmHg, 3.8% for diastolic blood pressure (DBP>90mmHg, 13.9% for fasting blood glucose (FBS≥126 Mg/dl, 36.9% for total cholesterol>200 Mg/dl, 19.2% for triglyceride (TG>200 Mg/dl, 67.8% for HDL-c130 Mg/dl, 4.72 for TC/HDL-c ratio, 2.88 for LDL-c/HDL/c ratio and 4.24 for TG/HDL-c ratio. Prevalence of risk factors in individuals younger than 55 years were: 1.7% for SBP>140 mmHg, 1.2% for DBP>90 mmHg, 5.2% for FBS≥126 Mg/dl, 31.3% for TC>200 Mg/dl, 21.5% for TG>200 Mg/dl, 69.4% for HDL-c130 Mg/dl, 4.7 for TC/HDL-c ratio, 2.83 for LDL-c/HDL-c ratio and 4.43 for TG/HDL-c ratio. In univariate model of analysis: prevalence of the risk factors were significantly higher in age above 55 years than in people younger than 55 years except for hypertriglyceridemia and HDL-c200 Mg/dl P= 0.002, HDL-c140 mmHg P=0.001. Pattern of such a CHD risk factors of FBS≥126 Mg/dl, TG>200 Mg/dl, HDL-c140 mmHg demonstrated a statistically significant difference in the age above 55 years to the healthy people younger than 55 years. These results cab be implicated to set up prediction models for stratifying individuals at higher risk of CHD.

  17. Keratin-associated protein 5-5 controls cytoskeletal function and cancer cell vascular invasion.

    Science.gov (United States)

    Berens, E B; Sharif, G M; Schmidt, M O; Yan, G; Shuptrine, C W; Weiner, L M; Glasgow, E; Riegel, A T; Wellstein, A

    2017-02-02

    Cancer cell vascular invasion is a crucial step in the malignant progression toward metastasis. Here we used a genome-wide RNA interference screen with E0771 mammary cancer cells to uncover drivers of endothelial monolayer invasion. We identified keratin-associated protein 5-5 (Krtap5-5) as a candidate. Krtap5-5 belongs to a large protein family that is implicated in crosslinking keratin intermediate filaments during hair formation, yet these Krtaps have no reported role in cancer. Depletion of Krtap5-5 from cancer cells led to cell blebbing and a loss of keratins 14 and 18, in addition to the upregulation of vimentin intermediate filaments. This intermediate filament subtype switching induced dysregulation of the actin cytoskeleton and reduced the expression of hemidesmosomal α6/β4-integrins. We further demonstrate that knockdown of keratin 18 phenocopies the loss of Krtap5-5, suggesting that Krtap5-5 crosstalks with keratin 18 in E0771 cells. Disruption of the keratin cytoskeleton by perturbing Krtap5-5 function broadly altered the expression of cytoskeleton regulators and the localization of cell surface markers. Krtap5-5 depletion did not impact cell viability but reduced cell motility and extracellular matrix invasion, as well as extravasation of cancer cells into tissues in zebrafish and mice. We conclude that Krtap5-5 is a previously unknown regulator of cytoskeletal function in cancer cells that modulates motility and vascular invasion. Thus, in addition to its physiologic function, a Krtap can serve as a switch toward malignant progression.

  18. Structures and Energetic Properties of Two New Salts Comprising the 5,5'-Azotetrazolate Dianion

    Directory of Open Access Journals (Sweden)

    Raik Deblitz

    2015-09-01

    Full Text Available Two new potentially energetic salts comprising the 5,5'-azotetrazolate dianion have been prepared and structurally characterized. The new azotetrazolates are tetraphenylphosphonium-5,5'-azotetrazolate (1 and 1H-1,2,4-triazole-1-carboxamidine-5,5'-azotetrazolate (2. The crystal structures of both compounds have been determined by single-crystal X-ray diffraction and their energetic properties have been tested. Due to its high nitrogen-content of 73.14%, compound 2 was found to be significantly impact-sensitive.

  19. Incision sizes with 5.5 mm total optic, 3-piece foldable intraocular lenses.

    Science.gov (United States)

    Kohnen, T

    2000-12-01

    To determine incision sizes for 5.5 mm total optic, foldable intraocular lenses (IOLs) made of silicone or hydrophobic acrylic. Johann Wolfgang Goethe-University, Department of Ophthalmology, Frankfurt am Main, Germany. In a prospective randomized clinical study including 40 cataract procedures with a temporal limbal tunnel approach, incision sizes for 5.5 mm optic, 3-piece foldable IOLs were measured before and after phacoemulsification and before and after IOL implantation using calipers. Three 5.5 mm optic, 3-piece foldable IOLs were used: 2 silicone (Pharmacia CeeOn 912, Allergan SI-55NB) and 1 hydrophobic acrylic (Alcon AcrySof MA30BA). Ten lenses of each model were implanted with a forceps, and 10 SI-55NB IOLs were implanted with the AMO Unfolder injector. Measurements of the tunnel incisions at various times were statistically evaluated using an analysis of variance and the Tukey-Kramer multiple comparison test. Mean tunnel width before and after implantation, respectively, was 3.32 mm+/- 0.06 (SD) and 3.42+/- 0.06 mm for the CeeOn 912 using a Nichamin implantation forceps, 3.28+/- 0.09 mm and 3.42+/- 0.09 mm for the AcrySof MA30BA using a Buratto implantation forceps, 3.00+/- 0.07 mm and 3.10+/- 0.05 mm for the SI-55NB using a Fine Universal II Folder, and 2.66+/- 0.08 mm and 2.81+/- 0.11 mm for the SI-55NB using the AMO Unfolder. Incision sizes before and after implantation were statistically different between 2 IOLs (CeeOn 912 and MA30BA) and the SI-55NB groups. Implantation of the SI-55NB with the Unfolder was associated with significantly smaller incision sizes before and after implantation than implantation with the Fine folder. Incisions sizes of 2.8 to 3.4 mm were associated with 5.5 mm total optic, 3-piece foldable IOLs. The Allergan SI-55NB high-refractive-index silicone IOL implanted with the AMO Unfolder system provided the smallest postimplantation incision; however, the refractive optic of this IOL is 5.0 mm versus 5.5 mm for of the CeeOn 912

  20. 26 CFR 55.6060-1 - Reporting requirements for tax return preparers.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) MISCELLANEOUS EXCISE TAXES (CONTINUED) EXCISE TAX ON REAL ESTATE INVESTMENT TRUSTS AND REGULATED INVESTMENT COMPANIES Procedure and Administration § 55.6060-1 Reporting requirements for tax return preparers...

  1. 26 CFR 55.6161-1 - Extension of time for paying tax or deficiency.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) MISCELLANEOUS EXCISE TAXES (CONTINUED) EXCISE TAX ON REAL ESTATE INVESTMENT TRUSTS AND REGULATED INVESTMENT COMPANIES Procedure and Administration § 55.6161-1 Extension of time for paying tax or deficiency...

  2. 26 CFR 55.6151-1 - Time and place for paying of tax shown on returns.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) MISCELLANEOUS EXCISE TAXES (CONTINUED) EXCISE TAX ON REAL ESTATE INVESTMENT TRUSTS AND REGULATED INVESTMENT COMPANIES Procedure and Administration § 55.6151-1 Time and place for paying of tax shown on...

  3. 26 CFR 55.6696-1 - Claims for credit or refund by tax return preparers.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) MISCELLANEOUS EXCISE TAXES (CONTINUED) EXCISE TAX ON REAL ESTATE INVESTMENT TRUSTS AND REGULATED INVESTMENT COMPANIES Procedure and Administration § 55.6696-1 Claims for credit or refund by tax return...

  4. Multimorbidity patterns in a primary care population aged 55 years and over

    NARCIS (Netherlands)

    Sinnige, J.; Korevaar, J.C.; Westert, G.P.; Spreeuwenberg, P.; Schellevis, F.G.; Braspenning, J.C.C.

    2015-01-01

    BACKGROUND: To support the management of multimorbid patients in primary care, evidence is needed on prevalent multimorbidity patterns. OBJECTIVE: To identify the common and distinctive multimorbidity patterns. METHODS: Clinical data of 120480 patients (>/=55 years) were extracted from 158

  5. 7 CFR 301.55-7 - Assembly and inspection of regulated articles.

    Science.gov (United States)

    2010-01-01

    ... PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE DOMESTIC QUARANTINE NOTICES South American Cactus Moth § 301.55-7 Assembly and inspection of regulated articles. (a) Any person (other than a person...

  6. 7 CFR 301.55-8 - Attachment and disposition of certificates and limited permits.

    Science.gov (United States)

    2010-01-01

    ...) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE DOMESTIC QUARANTINE NOTICES South American Cactus Moth § 301.55-8 Attachment and disposition of certificates and limited permits. (a) A...

  7. 19 CFR 134.55 - Compensation of Customs officers and employees.

    Science.gov (United States)

    2010-04-01

    ... SECURITY; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.55... articles so as to exempt them from the application of marking duties shall be computed in accordance with...

  8. WP5 Evaluation: D54-D55 Evaluation Results V2 (V3)

    NARCIS (Netherlands)

    Van Rosmalen, Peter

    2011-01-01

    Van Rosmalen, P. (2010, 19 May). WP5 Evaluation: D54-D55 Evaluation Results V2 (V3). Presentation at idSpace Final Review, Heerlen, The Netherlands: Open University of the Netherlands. idSpace-project.

  9. Fabrication and characterization of thin films of covalently interconnected Au{sub 55} clusters; Herstellung und Charakterisierung duenner Filme aus kovalent vernetzten Au{sub 55}-Clustern

    Energy Technology Data Exchange (ETDEWEB)

    Pollmeier, K.

    2006-07-01

    The aim of the present thesis was the synthesis of novel ligands for the Au{sub 55} for the production of interconnected arrangements. First an approach could be optimized, where Au{sub 55}(PPh{sub 3}){sub 12}Cl{sub 6} on PVP was arranged on the phase boundary of water and dichloromethane, whereby the system was further chemically stabilized by addition of a phosphate containing buffer solution and the change of the polymer connected with this. The obtained cluster layers exhibited extensions of several mm{sup 2}, whereby however the layers were not completely closed. Additionally on the layers stabilized with PVP aging problems and the formation of nanocrystals resulting from this could be observed. Next it was tried to connect the gold clusters covalently together. Furthermore the preparation of octavinyldisilanolsilsesquioxane-stabilized Au{sub 55} clusters was shown. In the first performed polymerization attempts by this cluster layers of many cm{sup 2} could be produced. In a further reaction the polymerization of the gold cluster by means of vinyl-substituated triphylene phosphate was successfully performed.

  10. Assessment of DR-55 as a Drop-In Replacement for R-410A

    Energy Technology Data Exchange (ETDEWEB)

    Shen, Bo [ORNL; Abdelaziz, Omar [ORNL

    2016-01-01

    R410A has no ozone depletion potential (ODP), and is the most commonly used refrigerant in vapor compression systems for space cooling and heating applications. However, it has significant global warming potential with GWP higher than 1900. To mitigate the global warming effect, industry and research institutes are actively pursuing a replacement for R-410A with the following attributes, much lower GWP along with similar or higher efficiency and capacity. DR-55 (aka R452B) is a design-compatible refrigerant replacement for R-410A. It decreases the GWP by 70%, and has lower working pressure, comparable discharge temperature, and uses the same lubricant, tubing, and valves. In this study, we experimentally evaluated the performance of DR-55 as a drop-in replacement for R-410A in a high efficiency rooftop air conditioning unit. The experimental results demonstrated that DR-55 led to 5% higher efficiency at the working conditions of Integrated Energy Efficiency Rating (IEER). DR-55 also showed significantly better high ambient performance from 95 F to 125 F. In addition to the experimental study, we used the DOE/ORNL Heat Pump Design Model to model the RTU using R-410A and DR-55, respectively. The model results were compared to the laboratory measurements. The model validation demonstrates that the refrigerant heat transfer and pressure drop correlations, developed for conventional refrigerants like R-410A, are usable for DR-55. Also, a converted compressor model for DR-55, i.e. reducing volumetric and isentropic efficiencies as a function of the suction and discharge pressures from an R-410A compressor map can predict the compressor mass flow rate and power accurately.

  11. A novel role for CD55 in granulocyte homeostasis and anti-bacterial host defense.

    Directory of Open Access Journals (Sweden)

    Henrike Veninga

    Full Text Available BACKGROUND: In addition to its complement-regulating activity, CD55 is a ligand of the adhesion class G protein-coupled receptor CD97; however, the relevance of this interaction has remained elusive. We previously showed that mice lacking a functional CD97 gene have increased numbers of granulocytes. METHODOLOGY/RESULTS: Here, we demonstrate that CD55-deficient mice display a comparable phenotype with about two-fold more circulating granulocytes in the blood stream, the marginated pool, and the spleen. This granulocytosis was independent of increased complement activity. Augmented numbers of Gr-1-positive cells in cell cycle in the bone marrow indicated a higher granulopoietic activity in mice lacking either CD55 or CD97. Concomitant with the increase in blood granulocyte numbers, Cd55⁻/⁻ mice challenged with the respiratory pathogen Streptococcus pneumoniae developed less bacteremia and died later after infection. CONCLUSIONS: Collectively, these data suggest that complement-independent interaction of CD55 with CD97 is functionally relevant and involved in granulocyte homeostasis and host defense.

  12. [Instrumental delivery with perineum-fetal head distance >55 MM on ultrasound].

    Science.gov (United States)

    Magnard, C; Perrot, M; Fanget, C; Paviot-Trombert, B; Raia-Barjat, T; Chauleur, C

    2016-02-01

    Compare the issue of an operative vaginal delivery associated to the fetal presentation diagnosed by transperineal ultrasound. Three groups were formed: ≥55 mm, between 45 and 55 mm, and <45 mm. A monocentric prospective study on 108 patients has been conducted between April 2011 and August 2014. The distance between perinea and skull has been analyzed to compare the success of operative vaginal delivery considering the level of the fetal presentation in the pelvic cavity. The failed operative vaginal deliveries are more frequent while the fetal head is above 55 mm (16.7%) or while the fetal head is between 45 and 55 mm (9.1%) than while the fetal skull is under 45 mm (1.8%) (P=0.04). However there is no significant difference for the fetal shoulder dystocia (5.6% vs 3.0% vs 3.5%, P=0.5), nor for the newborn outcomes (16.7 vs 15.2 vs 14; P=0.9). Despite the high rate of failed operative vaginal delivery above 55 mm, it should be considered not to prohibit but send free to the obstetrician appreciation. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  13. Berberine-INF55 (5-Nitro-2-Phenylindole) Hybrid Antimicrobials: Effects of Varying the Relative Orientation of the Berberine and INF55 Components ▿

    Science.gov (United States)

    Tomkiewicz, Danuta; Casadei, Gabriele; Larkins-Ford, Jonah; Moy, Terence I.; Garner, James; Bremner, John B.; Ausubel, Frederick M.; Lewis, Kim; Kelso, Michael J.

    2010-01-01

    Hybrid antimicrobials containing an antibacterial linked to a multidrug resistance (MDR) pump inhibitor make up a promising new class of agents for countering efflux-mediated bacterial drug resistance. This study explores the effects of varying the relative orientation of the antibacterial and efflux pump inhibitor components in three isomeric hybrids (SS14, SS14-M, and SS14-P) which link the antibacterial alkaloid and known substrate for the NorA MDR pump berberine to different positions on INF55 (5-nitro-2-phenylindole), an inhibitor of NorA. The MICs for all three hybrids against wild-type, NorA-knockout, and NorA-overexpressing Staphylococcus aureus cells were found to be similar (9.4 to 40.2 μM), indicating that these compounds are not effectively effluxed by NorA. The three hybrids were also found to have similar curing effects in a Caenorhabditis elegans live infection model. Each hybrid was shown to accumulate in S. aureus cells to a greater extent than either berberine or berberine in the presence of INF55, and the uptake kinetics of SS14 were found to differ from those of SS14-M and SS14-P. The effects on the uptake and efflux of the NorA substrate ethidium bromide into S. aureus cells in the presence or absence of the hybrids were used to confirm MDR inhibition by the hybrids. MDR-inhibitory activity was confirmed for SS14-M and SS14-P but not for SS14. Molecular dynamics simulations revealed that SS14 prefers to adopt a conformation that is not prevalent in either SS14-M or SS14-P, which may explain why some properties of SS14 diverge from those of its two isomers. In summary, subtle repositioning of the pump-blocking INF55 moiety in berberine-INF55 hybrids was found to have a minimal effect on their antibacterial activities but to significantly alter their effects on MDR pumps. PMID:20498327

  14. Increasing the reference populations for the 55 AISNP panel: the need and benefits.

    Science.gov (United States)

    Pakstis, Andrew J; Kang, Longli; Liu, Lijun; Zhang, Zhiying; Jin, Tianbo; Grigorenko, Elena L; Wendt, Frank R; Budowle, Bruce; Hadi, Sibte; Al Qahtani, Mariam Salam; Morling, Niels; Mogensen, Helle Smidt; Themudo, Goncalo E; Soundararajan, Usha; Rajeevan, Haseena; Kidd, Judith R; Kidd, Kenneth K

    2017-07-01

    Ancestry inference for an individual can only be as good as the reference populations with allele frequency data on the SNPs being used. If the most relevant ancestral population(s) does not have data available for the SNPs studied, then analyses based on DNA evidence may indicate a quite distantly related population, albeit one among the more closely related of the existing reference populations. We have added reference population allele frequencies for 14 additional population samples (with >1100 individuals studied) to the 125 population samples previously published for the Kidd Lab 55 AISNP panel. Allele frequencies are now publicly available for all 55 SNPs in ALFRED and FROG-kb for a total of 139 population samples. This Kidd Lab panel of 55 ancestry informative SNPs has been incorporated in commercial kits by both ThermoFisher Scientific and Illumina for massively parallel sequencing. Researchers employing those kits will find the enhanced set of reference populations useful.

  15. Targeting CB2-GPR55 receptor heteromers modulates cancer cell signaling.

    Science.gov (United States)

    Moreno, Estefanía; Andradas, Clara; Medrano, Mireia; Caffarel, María M; Pérez-Gómez, Eduardo; Blasco-Benito, Sandra; Gómez-Cañas, María; Pazos, M Ruth; Irving, Andrew J; Lluís, Carme; Canela, Enric I; Fernández-Ruiz, Javier; Guzmán, Manuel; McCormick, Peter J; Sánchez, Cristina

    2014-08-08

    The G protein-coupled receptors CB2 (CB2R) and GPR55 are overexpressed in cancer cells and human tumors. Because a modulation of GPR55 activity by cannabinoids has been suggested, we analyzed whether this receptor participates in cannabinoid effects on cancer cells. Here we show that CB2R and GPR55 form heteromers in cancer cells, that these structures possess unique signaling properties, and that modulation of these heteromers can modify the antitumoral activity of cannabinoids in vivo. These findings unveil the existence of previously unknown signaling platforms that help explain the complex behavior of cannabinoids and may constitute new targets for therapeutic intervention in oncology. © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.

  16. Directly detected (55)Mn MRI: application to phantoms for human hyperpolarized (13)C MRI development.

    Science.gov (United States)

    von Morze, Cornelius; Carvajal, Lucas; Reed, Galen D; Swisher, Christine Leon; Tropp, James; Vigneron, Daniel B

    2014-12-01

    In this work we demonstrate for the first time directly detected manganese-55 ((55)Mn) magnetic resonance imaging (MRI) using a clinical 3T MRI scanner designed for human hyperpolarized (13)C clinical studies with no additional hardware modifications. Due to the similar frequency of the (55)Mn and (13)C resonances, the use of aqueous permanganate for large, signal-dense, and cost-effective "(13)C" MRI phantoms was investigated, addressing the clear need for new phantoms for these studies. Due to 100% natural abundance, higher intrinsic sensitivity, and favorable relaxation properties, (55)Mn MRI of aqueous permanganate demonstrates dramatically increased sensitivity over typical (13)C phantom MRI, at greatly reduced cost as compared with large (13)C-enriched phantoms. A large sensitivity advantage (22-fold) was demonstrated. A cylindrical phantom (d=8 cm) containing concentrated aqueous sodium permanganate (2.7 M) was scanned rapidly by (55)Mn MRI in a human head coil tuned for (13)C, using a balanced steady state free precession acquisition. The requisite penetration of radiofrequency magnetic fields into concentrated permanganate was investigated by experiments and high frequency electromagnetic simulations, and found to be sufficient for (55)Mn MRI with reasonably sized phantoms. A sub-second slice-selective acquisition yielded mean image signal-to-noise ratio of ~60 at 0.5 cm(3) spatial resolution, distributed with minimum central signal ~40% of the maximum edge signal. We anticipate that permanganate phantoms will be very useful for testing HP (13)C coils and methods designed for human studies. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. Genomic structure and nucleotide sequence of the p55 gene of the puffer fish Fugu rubripes

    Energy Technology Data Exchange (ETDEWEB)

    Elgar, G.; Rattray, F.; Greystrong, J.; Brenner, S. [Univ. of Cambridge (United Kingdom)

    1995-06-10

    The p55 gene, which codes for a 55-kDa erythrocyte membrane protein, has been cloned and sequenced from the genome of the Japanese puffer fish Fugu rubripes (Fugu). This organism has the smallest recorded vertebrate genome and therefore provides an efficient way to sequence genes at the genomic level. The gene encoding p55 covers 5.5 kb from the beginning to the end of the coding sequence, four to six times smaller than the estimated size of the human gene, and is encoded by 12 exons. The structure of this gene has not been previously elucidated, but from this and other data we would predict a similar or identical structure in mammals. The predicted amino acid sequence of this gene in Fugu, coding for a polypeptide of 467 amino acids, is very similar to that of the human gene with the exception of the first two exons, which differ considerably. The predicted Fugu protein has a molecular weight (52.6 kDa compared with 52.3 kDa) and an isoelectric point very similar to those of human p55. In human, the p55 gene lies in the gene-dense Xq28 region, just 30 kb 3{prime} to the Factor VIII gene, and is estimated to cover 20-30 kb. Its 5{prime} end is associated with a CpG island, although there is no evidence that this is the case in Fugu. The small size of genes in Fugu and the high coding homology that they share with their mammalian equivalents, both in structure and sequence, make this compact vertebrate genome an ideal model for genomic studies. 23 refs., 3 figs.

  18. Definitive hypofractionated radiotherapy for early glottic carcinoma: experience of 55Gy in 20 fractions

    OpenAIRE

    Ermiş, Ekin; Teo, Mark; Dyker, Karen E.; Fosker, Chris; Sen, Mehmet; Prestwich, Robin JD

    2015-01-01

    Introduction A wide variety of fractionation schedules have been employed for the treatment of early glottic cancer. The aim is to report our 10-year experience of using hypofractionated radiotherapy with 55Gy in 20 fractions at 2.75Gy per fraction. Methods Patients treated between 2004 and 2013 with definitive radiotherapy to a dose of 55Gy in 20 fractions over 4 weeks for T1/2 N0 squamous cell carcinoma of the glottis were retrospectively identified. Patients with prior therapeutic minor su...

  19. Characterization-curing-property studies of HBRF 55A resin formulations

    Science.gov (United States)

    Pearce, E. M.; Mijovic, J.

    1985-01-01

    Characterization curing property investigations on HBRF 55A resin formulations are reported. The initial studies on as received cured samples cut from a full-size FWC are reviewed. Inadequacies of as-received and aged samples are pointed out and additional electron microscopic evidence is offered. Characterization of as-received ingredients of HBRF 55A formulation is described. Specifically, Epon 826, Epon 828, EpiRez 5022, RD-2 and various amines, including Tonox and Tonox 60.40, were characterized. Cure kinetics of various formulations are investigated. Changes in physical/thermal properties (viscosity, specific heat, thermal conductivity and density) during cure are described.

  20. Miastenia grave: avaliação clinica e terapêutica de 55 casos

    OpenAIRE

    Werneck, Lineu Cesar; Teive, Hélio A. Ghizoni

    1987-01-01

    Foram estudados 55 casos de miastenia grave, avaliando os sinais e sintomas clínicos que ocorreram no início e na evolução dos pacientes, bem como os procedimentos diagnósticos e avaliação das medidas terapêuticas utilizadas. No manejo dos pacientes foram utilizados anticolinesterásicos, corticoesteróides, azathioprina, plasmaferese e timectomia, sem que fosse possível encontrar relação estatística significante entre os diferentes procedimentos com respeito à resolução da doença. Dos 55 casos...

  1. Correlating the content and context of PAS 55 with the ISO 55000 series

    Directory of Open Access Journals (Sweden)

    Van den Honert, A. F.

    2013-08-01

    Full Text Available The ISO 55000 series is soon to supersede PAS 55 as the most recognised international standard for asset management. A correlation of the content and context of PAS 55 with the ISO 55000 series is required to assist organisations with the transition. After analysis of the structures, similarities, differences, and omissions of the two standards, a map was created to correlate the summarised content and context. The map established that, although both sets of standards have a similar structural framework, the ISO 55000 series is a more comprehensive and detailed standard, creating a clearer way to implement an asset management system within an organisation.

  2. Role of P27 -P55 operon from Mycobacterium tuberculosis in the resistance to toxic compounds

    Directory of Open Access Journals (Sweden)

    Cataldi Angel A

    2011-07-01

    Full Text Available Abstract Background The P27-P55 (lprG-Rv1410c operon is crucial for the survival of Mycobacterium tuberculosis, the causative agent of human tuberculosis, during infection in mice. P55 encodes an efflux pump that has been shown to provide Mycobacterium smegmatis and Mycobacterium bovis BCG with resistance to several drugs, while P27 encodes a mannosylated glycoprotein previously described as an antigen that modulates the immune response against mycobacteria. The objective of this study was to determine the individual contribution of the proteins encoded in the P27-P55 operon to the resistance to toxic compounds and to the cell wall integrity of M. tuberculosis. Method In order to test the susceptibility of a mutant of M. tuberculosis H37Rv in the P27-P55 operon to malachite green, sodium dodecyl sulfate, ethidium bromide, and first-line antituberculosis drugs, this strain together with the wild type strain and a set of complemented strains were cultivated in the presence and in the absence of these drugs. In addition, the malachite green decolorization rate of each strain was obtained from decolorization curves of malachite green in PBS containing bacterial suspensions. Results The mutant strain decolorized malachite green faster than the wild type strain and was hypersensitive to both malachite green and ethidium bromide, and more susceptible to the first-line antituberculosis drugs: isoniazid and ethambutol. The pump inhibitor reserpine reversed M. tuberculosis resistance to ethidium bromide. These results suggest that P27-P55 functions through an efflux-pump like mechanism. In addition, deletion of the P27-P55 operon made M. tuberculosis susceptible to sodium dodecyl sulfate, suggesting that the lack of both proteins causes alterations in the cell wall permeability of the bacterium. Importantly, both P27 and P55 are required to restore the wild type phenotypes in the mutant. Conclusions The results clearly indicate that P27 and P55 are

  3. 41 CFR 102-80.55 - Are Federal agencies responsible for managing the execution of risk reduction projects?

    Science.gov (United States)

    2010-07-01

    ... responsible for managing the execution of risk reduction projects? 102-80.55 Section 102-80.55 Public... Management Risks and Risk Reduction Strategies § 102-80.55 Are Federal agencies responsible for managing the execution of risk reduction projects? Yes, Federal agencies must manage the execution of risk reduction...

  4. 45 CFR 260.55 - What are the additional requirements for Federal recognition of good cause domestic violence...

    Science.gov (United States)

    2010-10-01

    ... recognition of good cause domestic violence waivers? 260.55 Section 260.55 Public Welfare Regulations Relating...) PROVISIONS What Special Provisions Apply to Victims of Domestic Violence? § 260.55 What are the additional requirements for Federal recognition of good cause domestic violence waivers? To be federally recognized, good...

  5. 31 CFR 5.5 - How will Treasury entities add interest, penalty charges, and administrative costs to a Treasury...

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false How will Treasury entities add interest, penalty charges, and administrative costs to a Treasury debt? 5.5 Section 5.5 Money and Finance... Debts § 5.5 How will Treasury entities add interest, penalty charges, and administrative costs to a...

  6. 21 CFR 111.55 - What are the requirements to implement a production and process control system?

    Science.gov (United States)

    2010-04-01

    ... production and process control system? 111.55 Section 111.55 Food and Drugs FOOD AND DRUG ADMINISTRATION... to Establish a Production and Process Control System § 111.55 What are the requirements to implement a production and process control system? You must implement a system of production and process...

  7. 19 CFR 148.55 - Exemption for articles bearing American trademark.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Exemption for articles bearing American trademark... § 148.55 Exemption for articles bearing American trademark. (a) Application of exemption. An exemption... 42 of the Act of July 5, 1946 (60 Stat. 440; 15 U.S.C. 1124), because the trademark has been...

  8. Assessing deposition levels of 55Fe, 60Co and 63Ni in the Ignalina NPP environment

    DEFF Research Database (Denmark)

    Gudelis, A.; Druteikienė, R.; Lukšienė, B.

    2010-01-01

    . Non-destructive analysis by the HPGe gamma-spectrometry was followed by radiochemical separation. Radiochemical analysis was based on anion-exchange and extraction chromatography. 55Fe and 63Ni activities were measured by liquid scintillation counting (LSC). The results indicate that the deposition...

  9. The Unyvero P55 ‘sample-in, answer-out’ pneumonia assay: A performance evaluation

    Directory of Open Access Journals (Sweden)

    C. Ozongwu

    2017-09-01

    Conclusions: The Unyvero P55 is a rapid pathogen detection test for lower respiratory specimens, which identifies a larger number of pathogens than routine microbiology. The clinical significance of these additional organisms is yet to be determined. Further studies are required to determine the effect of the test in practise on antimicrobial prescribing and patient outcomes.

  10. 49 CFR 178.55 - Specification 4B240ET welded or brazed cylinders.

    Science.gov (United States)

    2010-10-01

    ... repairs to longitudinal joints is permitted. (3) Welding procedures and operators must be qualified in... 49 Transportation 2 2010-10-01 2010-10-01 false Specification 4B240ET welded or brazed cylinders... SPECIFICATIONS FOR PACKAGINGS Specifications for Cylinders § 178.55 Specification 4B240ET welded or brazed...

  11. 26 CFR 55.6091-1 - Place for filing Chapter 44 tax returns.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) MISCELLANEOUS EXCISE TAXES (CONTINUED) EXCISE TAX ON REAL ESTATE INVESTMENT TRUSTS AND REGULATED INVESTMENT COMPANIES Procedure and Administration § 55.6091-1 Place for filing Chapter 44 tax returns. Except... estate investment trust or regulated investment company. (b) Returns filed with service centers or by...

  12. Computational exploration of Fe55@C240-catalyzed Fischer-Tropsch synthesis.

    Science.gov (United States)

    Cilpa-Karhu, Geraldine; Laasonen, Kari

    2018-01-11

    Single-shell carbon-encapsulated iron nanoparticles (SCEINs), Fe@C, have been shown to be charge-transfer complexes that can act as effective catalysts in the hydrogen and oxygen evolution reactions. A new generation of Fe-based catalysts for Fischer-Tropsch synthesis (FTS) which resembles SCEINs, e.g. single carbide nanoparticles encapsulated in carbon shells, has demonstrated enhanced activity and stability for FTS as compared to other carbon-supported Fe-based FTS. Thus the catalytic ability of SCEINs for the water splitting reactions and the Fe-based FTS catalyst with SCEINs-like features stimulated our exploration of SCEINs-catalyzed FTS. We performed ab initio DFT calculations using a realistic SCEINs model system Fe55@C240 to investigate for the first time the adsorption of the main reactants in FTS (CO and H/H2) and further to evaluate the catalytic ability of Fe55@C240 by reproducing the key steps of the well-known Fe-based FTS mechanisms (carbide, enol and CO insertion). Our calculations revealed: (i) a determinant role of Fe in enhancing CO adsorption (ii) strong cooperative effects with the adsorbates that stabilize the binding (iii) a less favourable two-sites reaction on Fe55@C240 due to preferential positions of the reactants farther to each other which prevent enol and carbide FTS mechanisms. We propose therefore a possible CO insertion path for hydrocarbon growth on Fe55@C240.

  13. Reading Ruth 4 and Leviticus 25:8–55 in the light of the landless ...

    African Journals Online (AJOL)

    2016-06-24

    Jun 24, 2016 ... texts bear on the reading of Ruth 4 and Leviticus 25:8–55 in South Africa? ... landless and poor women in South Africa: A conversation with Fernando F. Segovia and Ernesto 'Che' Guevara. Read online: Scan this QR code with your .... It is difficult to reconstruct the concept of redemption in the book of Ruth.

  14. TOP 55 : Svodnõi reiting avtotransportnõhh predprijatii Estonii po itogam 2007 goda

    Index Scriptorium Estoniae

    2008-01-01

    Autotranspordi ettevõtete TOP 55 2007. aasta tulemuste alusel. Vt. samas: Metodika sostavlenija reitinga; Nadezhda Bersenjova. V liderõ võvela komanda; Vsjo vremja v poiske; Marika Roomere. Firma EST-Trans Kaubaveod zarabatõvajet na perevozke produktov

  15. 26 CFR 55.6011-1 - General requirement of return, statement, or list.

    Science.gov (United States)

    2010-04-01

    ... INVESTMENT COMPANIES Procedure and Administration § 55.6011-1 General requirement of return, statement, or list. Every person liable for tax under Chapter 44 shall file an annual return with respect to the tax... by a real estate investment trust on Form 8612 and by a regulated investment company on Form 8613. ...

  16. Survival outcomes of younger men (< 55 years undergoing radical prostatectomy

    Directory of Open Access Journals (Sweden)

    Lynn Tan

    2018-03-01

    Conclusion: Men aged 45–54 years undergoing RP had better overall survival compared to men aged 55–74 years, but these effects were not seen in men aged 35–44 years. There were no differences in prostate cancer specific survival in these groups.

  17. A User's Guide to the Meade LXD55 and LXD75 Telescopes

    CERN Document Server

    Peston, Martin

    2007-01-01

    A comprehensive introductory guide to "choosing and using" an LXD55/75 computer-controlled "Goto" series of telescopes. It is suitable for both beginners and more advanced practical amateur astronomers. It brings together the information needed to help owners get the best out of their LXD telescopes

  18. 12 CFR 622.55 - Notice of assessment of civil money penalty.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Notice of assessment of civil money penalty... PRACTICE AND PROCEDURE Rules and Procedures for Assessment and Collection of Civil Money Penalties § 622.55 Notice of assessment of civil money penalty. (a) Notice of assessment. The notice of assessment for a...

  19. Measurement equivalence of the newly developed Quality of Life in Childhood Epilepsy Questionnaire (QOLCE-55).

    Science.gov (United States)

    Ferro, Mark A; Goodwin, Shane W; Sabaz, Mark; Speechley, Kathy N

    2016-03-01

    The aim of this study was to examine measurement equivalence of the newly developed Quality of Life in Childhood Epilepsy Questionnaire (QOLCE-55) across age, sex, and time in a representative sample of children with newly diagnosed epilepsy. Data come from 373 children enrolled in the Health-related Quality of Life in Children with Epilepsy Study (HERQULES), a multisite prospective cohort study. Measurement equivalence was examined using a multiple-group confirmatory factor analysis framework, whereby increasingly stringent parameter constraints are imposed on the model. Comparison groups were stratified based on age (4-7 years vs. 8-12 years), sex (male vs. female), and time (measurement of health-related quality of life at diagnosis vs. 24 months later). The QOLCE-55 demonstrated measurement equivalence at the level of strict invariance for each model tested--age: χ(2) (3,123) = 4,097.3, p QOLCE-55 are perceived similarly among groups stratified by age, sex, and time and provide further evidence supporting the validity of the scale in children with epilepsy. Health professionals and researchers should be confident that group comparisons made using the QOLCE-55 are unbiased and that any group differences detected are meaningful; that is, not related to differences in the interpretation of items by informants. Future research replicating these findings is encouraged. Wiley Periodicals, Inc. © 2016 International League Against Epilepsy.

  20. 7 CFR 1955.55 - Taking abandoned real or chattel property into custody and related actions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Taking abandoned real or chattel property into custody... Management of Property § 1955.55 Taking abandoned real or chattel property into custody and related actions... under Public Law 103-354 custody. When security property is determined to be abandoned, the running...

  1. 21 CFR 20.55 - Indexing trade secrets and confidential commercial or financial information.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Indexing trade secrets and confidential commercial... OF HEALTH AND HUMAN SERVICES GENERAL PUBLIC INFORMATION Procedures and Fees § 20.55 Indexing trade... itemization and indexing of the records. If the affected person fails to intervene to defend the exempt status...

  2. Bulletin of Animal Health and Production in Africa - Vol 55, No 3 (2007)

    African Journals Online (AJOL)

    Study On Parasites Of Fish At Lake Awassa, Ethiopia · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T Zekarias, E Yimer, 149-155. http://dx.doi.org/10.4314/bahpa.v55i3.32803 ...

  3. Communications Strategies on Alcohol and Highway Safety. Volume I. Adults 18-55. Final Report.

    Science.gov (United States)

    Grey Advertising, Inc., New York, NY.

    The first part of a two-part, two volume study deals with adults aged 18-55 and identifies target populations and communications strategies for encouraging personal action steps to prevent drunk driving. Fully 54% of adult Americans participate once a month in social or business situations where alcohol is served. They are termed Alcohol Related…

  4. 7 CFR 301.55 - Restrictions on interstate movement of regulated articles.

    Science.gov (United States)

    2010-01-01

    ... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE DOMESTIC QUARANTINE NOTICES South American Cactus Moth § 301.55 Restrictions on interstate movement of regulated articles. No person may move... the Plant Protection Act (7 U.S.C. 7714, 7731, and 7754). ...

  5. 7 CFR 301.55-5 - Issuance and cancellation of certificates and limited permits.

    Science.gov (United States)

    2010-01-01

    ...) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE DOMESTIC QUARANTINE NOTICES South American Cactus Moth § 301.55-5 Issuance and cancellation of certificates and limited permits. (a) An... determines that: 4 Services of an inspector may be requested by contacting local offices of Plant Protection...

  6. Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55

    NARCIS (Netherlands)

    Kotterman, M.

    1998-01-01

    Outline of this thesis
    In this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations,

  7. 33 CFR 55.11 - How are child development center fees established?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false How are child development center... HOMELAND SECURITY PERSONNEL CHILD DEVELOPMENT SERVICES General § 55.11 How are child development center fees established? (a) Fees for the provision of services at child development centers shall be set by...

  8. CD55 deposited on synovial collagen fibers protects from immune complex-mediated arthritis

    NARCIS (Netherlands)

    Karpus, Olga N.; Kiener, Hans P.; Niederreiter, Birgit; Yilmaz-Elis, A. Seda; van der Kaa, Jos; Ramaglia, Valeria; Arens, Ramon; Smolen, Josef S.; Botto, Marina; Tak, Paul P.; Verbeek, J. Sjef; Hamann, Jörg

    2015-01-01

    CD55, a glycosylphosphatidylinositol-anchored, complement-regulating protein (decay-accelerating factor), is expressed by fibroblast-like synoviocytes (FLS) with high local abundance in the intimal lining layer. We here explored the basis and consequences of this uncommon presence. Synovial tissue,

  9. A novel role for CD55 in granulocyte homeostasis and anti-bacterial host defense

    NARCIS (Netherlands)

    Veninga, Henrike; Hoek, Robert M.; de Vos, Alex F.; de Bruin, Alex M.; An, Feng-Qi; van der Poll, Tom; van Lier, René A. W.; Medof, M. Edward; Hamann, Jörg

    2011-01-01

    In addition to its complement-regulating activity, CD55 is a ligand of the adhesion class G protein-coupled receptor CD97; however, the relevance of this interaction has remained elusive. We previously showed that mice lacking a functional CD97 gene have increased numbers of granulocytes. Here, we

  10. Lack of Association of CD55 Receptor Genetic Variants and Severe Malaria in Ghanaian Children

    Directory of Open Access Journals (Sweden)

    Kathrin Schuldt

    2017-03-01

    Full Text Available In a recent report, the cellular receptor CD55 was identified as a molecule essential for the invasion of human erythrocytes by Plasmodium falciparum, the causal agent of the most severe form of malaria. As this invasion process represents a critical step during infection with the parasite, it was hypothesized that genetic variants in the gene could affect severe malaria (SM susceptibility. We performed high-resolution variant discovery of rare and common genetic variants in the human CD55 gene. Association testing of these variants in over 1700 SM cases and unaffected control individuals from the malaria-endemic Ashanti Region in Ghana, West Africa, were performed on the basis of single variants, combined rare variant analyses, and reconstructed haplotypes. A total of 26 genetic variants were detected in coding and regulatory regions of CD55. Five variants were previously unknown. None of the single variants, rare variants, or haplotypes showed evidence for association with SM or P. falciparum density. Here, we present the first comprehensive analysis of variation in the CD55 gene in the context of SM and show that genetic variants present in a Ghanaian study group appear not to influence susceptibility to the disease.

  11. The stromal component in rheumatoid arthritis: CD55 expression, cell death and beyond

    NARCIS (Netherlands)

    Karpus, O.N.

    2014-01-01

    Since 1990, when CD55 expression in synovial tissue was first described, this molecule has become a broadly used marker for detection of intimal lining synovial fibroblasts. In this thesis, we clarify the reason for its high expression and identify a collagen fiber meshwork in the synovial lining.

  12. Radioactivity analysis of {sup 55}Fe and {sup 63}Ni in dismantled concrete

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Mun Ja; Chung, Kun Ho; Hong, Sang Bum; Choi, Geun Sik; Lee, Chang Woo [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2007-03-15

    Combined method of extraction chromatography and liquid scintillation analysis was established for determinating {sup 55}Fe and {sup 61}Ni radioactivity in solid samples. Activated concrete wastes generated from dismantling KRR-2 were analysed. The sequential separation including precipitation and extraction chromatography resulted in the above 90% chemical recoveries of Fe. Above 62% recoveries of Ni were obtained by this procedure exception to 43.6 and 46.5% recoveries. The seperation and counting procedure was also confirmed with spiked samples of known quantity. The measured and spiked quantity were agreed with the 3.7% and 0.7% variations in the {sup 55}Fe and {sup 63}Ni experiments, respectively. The radioactivities of {sup 55}Fe in the dismantled concretes are shown from below MDA to maximum 362 Bq/g. The radioactivities of {sup 63}Ni in all concrete samples are below MDA. The {sup 63}Ni doesn't exist in dismantled concretes from KRR-2. The radioactivity of {sup 55}Fe is decreased rapidly as the sampling depth is increased from the concrete surface.

  13. 28 CFR 55.13 - Language used for oral assistance and publicity.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Language used for oral assistance and... THE PROVISIONS OF THE VOTING RIGHTS ACT REGARDING LANGUAGE MINORITY GROUPS Determining the Exact Language § 55.13 Language used for oral assistance and publicity. (a) Languages with more than one dialect...

  14. 20 CFR 229.55 - Reduction for spouse social security benefit.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Reduction for spouse social security benefit... RETIREMENT ACT SOCIAL SECURITY OVERALL MINIMUM GUARANTEE Computation of the Overall Minimum Rate § 229.55 Reduction for spouse social security benefit. A spouse benefit under the overall minimum, after any...

  15. Arthroscopically assisted osteosynthesis of tibial plateau fractures in patients older than 55 years

    NARCIS (Netherlands)

    Roerdink, WH; Oskam, J; Vierhout, PAM

    2001-01-01

    Purpose: To evaluate the end results of arthroscopically assisted osteosynthesis of tibial plateau fractures in patients older than 55 years of age. Type of Study: Case series. Methods: Over a 5-year period, 201 consecutive patients presented with tibial plateau fracture; 131 of these patients were

  16. 41 CFR 102-34.55 - Are there fleet average fuel economy standards we must meet?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are there fleet average... Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 34-MOTOR VEHICLE MANAGEMENT Obtaining Fuel Efficient Motor Vehicles § 102-34.55 Are there fleet...

  17. Long-term quality of life in patients surviving at least 55 months after lung transplantation

    NARCIS (Netherlands)

    Vermeulen, KM; Ouwens, JP; van der Bij, W; Koeter, GH; TenVergert, EM

    2003-01-01

    The aim of this study was to examine the long-term effect of lung transplantation on Health Related Quality of Life by studying 28 patients who survived at least 55 months after lung transplantation. Measures included the Nottingham Health Profile, questions concerning lung-specific problems, the

  18. Assessment of the feasibility of exon 45–55 multiexon skipping for duchenne muscular dystrophy

    Directory of Open Access Journals (Sweden)

    van Ommen Gert-Jan B

    2008-12-01

    Full Text Available Abstract Background The specific skipping of an exon, induced by antisense oligonucleotides (AON during splicing, has shown to be a promising therapeutic approach for Duchenne muscular dystrophy (DMD patients. As different mutations require skipping of different exons, this approach is mutation dependent. The skipping of an entire stretch of exons (e.g. exons 45 to 55 has recently been suggested as an approach applicable to larger groups of patients. However, this multiexon skipping approach is technically challenging. The levels of intended multiexon skips are typically low and highly variable, and may be dependent on the order of intron removal. We hypothesized that the splicing order might favor the induction of multiexon 45–55 skipping. Methods We here tested the feasibility of inducing multiexon 45–55 in control and patient muscle cell cultures using various AON cocktails. Results In all experiments, the exon 45–55 skip frequencies were minimal and comparable to those observed in untreated cells. Conclusion We conclude that current state of the art does not sufficiently support clinical development of multiexon skipping for DMD.

  19. 10 CFR 35.55 - Training for an authorized nuclear pharmacist.

    Science.gov (United States)

    2010-01-01

    ...; (D) Chemistry of byproduct material for medical use; and (E) Radiation biology; and (ii) Supervised... Section 35.55 Energy NUCLEAR REGULATORY COMMISSION MEDICAL USE OF BYPRODUCT MATERIAL General... hours of classroom and laboratory training in the following areas— (A) Radiation physics and...

  20. 5,5-Dimethyl-2-methylseleno-1,3,2-dioxaphosphorinan-2-one

    Directory of Open Access Journals (Sweden)

    Grzegorz Cholewinski

    2010-04-01

    Full Text Available The title compound, C6H13O3PSe, was obtained in the reaction of 5,5-dimethyl-2-oxo-2-seleno-1,3,2-dioxaphosphorinane potassium salt with methyl iodide. The selenomethyl group is in the axial position in relation to the six-membered dioxaphosphorinane ring.

  1. Automated Test Assembly Using lp_Solve Version 5.5 in R

    Science.gov (United States)

    Diao, Qi; van der Linden, Wim J.

    2011-01-01

    This article reviews the use of the software program lp_solve version 5.5 for solving mixed-integer automated test assembly (ATA) problems. The program is freely available under Lesser General Public License 2 (LGPL2). It can be called from the statistical language R using the lpSolveAPI interface. Three empirical problems are presented to…

  2. Automated test assembly using lp_solve version 5.5 in R

    NARCIS (Netherlands)

    Diao, Qi; van der Linden, Willem J.

    2011-01-01

    This article reviews the use of the software program lp_solve version 5.5 for solving mixed-integer automated test assembly (ATA) problems. The program is freely available under Lesser General Public License 2 (LGPL2). It can be called from the statistical language R using the lpSolveAPI interface.

  3. 29 CFR 531.55 - Examples of amounts not received as tips.

    Science.gov (United States)

    2010-07-01

    ... Tipped Employees § 531.55 Examples of amounts not received as tips. (a) A compulsory charge for service... received in applying the provisions of section 3(m) and 3(t). Similarly, where negotiations between a hotel and a customer for banquet facilities include amounts for distribution to employees of the hotel, the...

  4. Derivation of Escherichia coli O157:H7 from Its O55:H7 Precursor

    Science.gov (United States)

    Zhou, Zhemin; Li, Xiaomin; Liu, Bin; Beutin, Lothar; Xu, Jianguo; Ren, Yan; Feng, Lu; Lan, Ruiting; Reeves, Peter R.; Wang, Lei

    2010-01-01

    There are 29 E. coli genome sequences available, mostly related to studies of species diversity or mode of pathogenicity, including two genomes of the well-known O157:H7 clone. However, there have been no genome studies of closely related clones aimed at exposing the details of evolutionary change. Here we sequenced the genome of an O55:H7 strain, closely related to the major pathogenic O157:H7 clone, with published genome sequences, and undertook comparative genomic and proteomic analysis. We were able to allocate most differences between the genomes to individual mutations, recombination events, or lateral gene transfer events, in specific lineages. Major differences include a type II secretion system present only in the O55:H7 chromosome, fewer type III secretion system effectors in O55:H7, and 19 phage genomes or phagelike elements in O55:H7 compared to 23 in O157:H7, with only three common to both. Many other changes were found in both O55:H7 and O157:H7 lineages, but in general there has been more change in the O157:H7 lineages. For example, we found 50% more synonymous mutational substitutions in O157:H7 compared to O55:H7. The two strains also diverged at the proteomic level. Mutational synonymous SNPs were used to estimate a divergence time of 400 years using a new clock rate, in contrast to 14,000 to 70,000 years using the traditional clock rates. The same approaches were applied to three closely related extraintestinal pathogenic E. coli genomes, and similar levels of mutation and recombination were found. This study revealed for the first time the full range of events involved in the evolution of the O157:H7 clone from its O55:H7 ancestor, and suggested that O157:H7 arose quite recently. Our findings also suggest that E. coli has a much lower frequency of recombination relative to mutation than was observed in a comparable study of a Vibrio cholerae lineage. PMID:20090843

  5. Lysophosphatidylinositol causes neurite retraction via GPR55, G13 and RhoA in PC12 cells.

    Directory of Open Access Journals (Sweden)

    Yutaro Obara

    Full Text Available GPR55 was recently identified as a putative receptor for certain cannabinoids, and lysophosphatidylinositol (LPI. Recently, the role of cannabinoids as GPR55 agonists has been disputed by a number of reports, in part, because studies investigating GPR55 often utilized overexpression systems, such as the GPR55-overexpressing HEK293 cells, which make it difficult to deduce the physiological role of endogenous GPR55. In the present study, we found that PC12 cells, a neural model cell line, express endogenous GPR55, and by using these cells, we were able to examine the role of endogenous GPR55. Although GPR55 mRNA and protein were expressed in PC12 cells, neither CB(1 nor CB(2 mRNA was expressed in these cells. GPR55 was predominantly localized on the plasma membrane in undifferentiated PC12 cells. However, GPR55 was also localized in the growth cones or the ruffled border in differentiated PC12 cells, suggesting a potential role for GPR55 in the regulation of neurite elongation. LPI increased intracellular Ca(2+ concentration and RhoA activity, and induced ERK1/2 phosphorylation, whereas endogenous and synthetic cannabinoids did not, thereby suggesting that cannabinoids are not GPR55 agonists. LPI also caused neurite retraction in a time-dependent manner accompanied by the loss of neurofilament light chain and redistribution of actin in PC12 cells differentiated by NGF. This LPI-induced neurite retraction was found to be G(q-independent and G(13-dependent. Furthermore, inactivation of RhoA function via C3 toxin and GPR55 siRNA knockdown prevented LPI-induced neurite retraction. These results suggest that LPI, and not cannabinoids, causes neurite retraction in differentiated PC12 cells via a GPR55, G(13 and RhoA signaling pathway.

  6. Structural modeling and DNA binding autoinhibition analysis of Ergp55, a critical transcription factor in prostate cancer.

    Directory of Open Access Journals (Sweden)

    Shanti P Gangwar

    Full Text Available BACKGROUND: The Ergp55 protein belongs to Ets family of transcription factor. The Ets proteins are highly conserved in their DNA binding domain and involved in various development processes and regulation of cancer metabolism. To study the structure and DNA binding autoinhibition mechanism of Ergp55 protein, we have produced full length and smaller polypeptides of Ergp55 protein in E. coli and characterized using various biophysical techniques. RESULTS: The Ergp55 polypeptides contain large amount of α-helix and random coil structures as measured by circular dichorism spectroscopy. The full length Ergp55 forms a flexible and elongated molecule as revealed by molecular modeling, dynamics simulation and structural prediction algorithms. The binding analyses of Ergp55 polypeptides with target DNA sequences of E74 and cfos promoters indicate that longer fragments of Ergp55 (beyond the Ets domain showed the evidence of auto-inhibition. This study also revealed the parts of Ergp55 protein that mediate auto-inhibition. SIGNIFICANCE: The current study will aid in designing the compounds that stabilize the inhibited form of Ergp55 and inhibit its binding to promoter DNA. It will contribute in the development of drugs targeting Ergp55 for the prostate cancer treatment.

  7. Measurements of 55Fe activity in activated steel samples with GEMPix

    Science.gov (United States)

    Curioni, A.; Dinar, N.; La Torre, F. P.; Leidner, J.; Murtas, F.; Puddu, S.; Silari, M.

    2017-03-01

    In this paper we present a novel method, based on the recently developed GEMPix detector, to measure the 55Fe content in samples of metallic material activated during operation of CERN accelerators and experimental facilities. The GEMPix, a gas detector with highly pixelated read-out, has been obtained by coupling a triple Gas Electron Multiplier (GEM) to a quad Timepix ASIC. Sample preparation, measurements performed on 45 samples and data analysis are described. The calibration factor (counts per second per unit specific activity) has been obtained via measurements of the 55Fe activity determined by radiochemical analysis of the same samples. Detection limit and sensitivity to the current Swiss exemption limit are calculated. Comparison with radiochemical analysis shows inconsistency for the sensitivity for only two samples, most likely due to underestimated uncertainties of the GEMPix analysis. An operative test phase of this technique is already planned at CERN.

  8. Investigating Neanderthal dispersal above 55°N in Europe during the Last Interglacial Complex

    DEFF Research Database (Denmark)

    Nielsen, Trine Kellberg; Benito, Blas M.; Svenning, Jens Christian

    2017-01-01

    When dealing with the northern boundary of Neanderthals (Homo neanderthalensis) and the question of whether or not they dispersed into Southern Scandinavia, two contradictory hypotheses can be identified. The first, and also the most widely endorsed, hereafter, hypothesis A, argues primarily...... that Neanderthals did not occupy regions above 55°N because of 1) climatic constraints and 2) dispersal barriers. The second, hypothesis B, argues that they possibly occasionally dispersed above 55°N, but that factors such as 1) research- and/or 2) taphonomic bias are responsible for their archaeological...... to the two hypotheses. Our results are inconsistent with the claim that climatic constraint and/or a lack of suitable habitats can fully explain the absence of Neanderthals in Southern Scandinavia during the Eemian Interglacial and Early Weichselian Glaciation. We do, however, find evidence that a geographic...

  9. A GMBCG Galaxy Cluster Catalog of 55,424 Rich Clusters from SDSS DR7

    Energy Technology Data Exchange (ETDEWEB)

    Hao, Jiangang; /Fermilab; McKay, Timothy A.; /Michigan U.; Koester, Benjamin P.; /Chicago U.; Rykoff, Eli S.; /UC, Santa Barbara /LBL, Berkeley; Rozo, Eduardo; /Chicago U.; Annis, James; /Fermilab; Wechsler, Risa H.; /SLAC; Evrard, August; /Michigan U.; Siegel, Seth R.; /Michigan U.; Becker, Matthew; /Chicago U.; Busha, Michael; /SLAC; Gerdes, David; /Michigan U.; Johnston, David E.; /Fermilab; Sheldon, Erin; /Brookhaven

    2011-08-22

    We present a large catalog of optically selected galaxy clusters from the application of a new Gaussian Mixture Brightest Cluster Galaxy (GMBCG) algorithm to SDSS Data Release 7 data. The algorithm detects clusters by identifying the red sequence plus Brightest Cluster Galaxy (BCG) feature, which is unique for galaxy clusters and does not exist among field galaxies. Red sequence clustering in color space is detected using an Error Corrected Gaussian Mixture Model. We run GMBCG on 8240 square degrees of photometric data from SDSS DR7 to assemble the largest ever optical galaxy cluster catalog, consisting of over 55,000 rich clusters across the redshift range from 0.1 < z < 0.55. We present Monte Carlo tests of completeness and purity and perform cross-matching with X-ray clusters and with the maxBCG sample at low redshift. These tests indicate high completeness and purity across the full redshift range for clusters with 15 or more members.

  10. A GMBCG galaxy cluster catalog of 55,880 rich clusters from SDSS DR7

    Energy Technology Data Exchange (ETDEWEB)

    Hao, Jiangang; McKay, Timothy A.; Koester, Benjamin P.; Rykoff, Eli S.; Rozo, Eduardo; Annis, James; Wechsler, Risa H.; Evrard, August; Siegel, Seth R.; Becker, Matthew; Busha, Michael; /Fermilab /Michigan U. /Chicago U., Astron. Astrophys. Ctr. /UC, Santa Barbara /KICP, Chicago /KIPAC, Menlo Park /SLAC /Caltech /Brookhaven

    2010-08-01

    We present a large catalog of optically selected galaxy clusters from the application of a new Gaussian Mixture Brightest Cluster Galaxy (GMBCG) algorithm to SDSS Data Release 7 data. The algorithm detects clusters by identifying the red sequence plus Brightest Cluster Galaxy (BCG) feature, which is unique for galaxy clusters and does not exist among field galaxies. Red sequence clustering in color space is detected using an Error Corrected Gaussian Mixture Model. We run GMBCG on 8240 square degrees of photometric data from SDSS DR7 to assemble the largest ever optical galaxy cluster catalog, consisting of over 55,000 rich clusters across the redshift range from 0.1 < z < 0.55. We present Monte Carlo tests of completeness and purity and perform cross-matching with X-ray clusters and with the maxBCG sample at low redshift. These tests indicate high completeness and purity across the full redshift range for clusters with 15 or more members.

  11. Investigating Neanderthal dispersal above 55°N in Europe during the Last Interglacial Complex

    DEFF Research Database (Denmark)

    Nielsen, Trine Kellberg; Benito, Blas; Svenning, Jens-Christian

    2017-01-01

    that Neanderthals did not occupy regions above 55°N because of 1) climatic constraints and 2) dispersal barriers. The second, hypothesis B, argues that they possibly occasionally dispersed above 55°N, but that factors such as 1) research- and/or 2) taphonomic bias are responsible for their archaeological...... combined with a novel habitat modelling approach, a review of relevant archaeological localities, and a discussion of the possible impacts of both research biases and the taphonomic effects on the archaeological data. We focus particularly on the climatic and geological explanatory factors relevant...... barrier may have impeded northerly migrations during the Eemian. The evidence reviewed here suggests that both research bias and taphonomy – consistent with hypothesis B – could account for the archaeological invisibility of Neanderthals in Southern Scandinavia, highlighting the need for further strategic...

  12. Measurements of {sup 55}Fe activity in activated steel samples with GEMPix

    Energy Technology Data Exchange (ETDEWEB)

    Curioni, A. [CERN, 1211 Geneva 23 (Switzerland); Politecnico di Milano, Piazza Leonardo da Vinci 32, 20133 Milano (Italy); Dinar, N. [CERN, 1211 Geneva 23 (Switzerland); Université de Paris VII, 5 rue Thomas-Mann, 75013 Paris (France); La Torre, F.P. [CERN, 1211 Geneva 23 (Switzerland); Leidner, J., E-mail: johannes.leidner@cern.ch [CERN, 1211 Geneva 23 (Switzerland); RWTH Aachen, Templergraben 55, 52056 Aachen (Germany); Murtas, F. [CERN, 1211 Geneva 23 (Switzerland); INFN-LNF, Via E. Fermi 40, 00044 Frascati (Italy); Puddu, S.; Silari, M. [CERN, 1211 Geneva 23 (Switzerland)

    2017-03-21

    In this paper we present a novel method, based on the recently developed GEMPix detector, to measure the {sup 55}Fe content in samples of metallic material activated during operation of CERN accelerators and experimental facilities. The GEMPix, a gas detector with highly pixelated read-out, has been obtained by coupling a triple Gas Electron Multiplier (GEM) to a quad Timepix ASIC. Sample preparation, measurements performed on 45 samples and data analysis are described. The calibration factor (counts per second per unit specific activity) has been obtained via measurements of the {sup 55}Fe activity determined by radiochemical analysis of the same samples. Detection limit and sensitivity to the current Swiss exemption limit are calculated. Comparison with radiochemical analysis shows inconsistency for the sensitivity for only two samples, most likely due to underestimated uncertainties of the GEMPix analysis. An operative test phase of this technique is already planned at CERN.

  13. Expression of the membrane complement regulatory proteins (CD55 and CD59 in human thymus.

    Directory of Open Access Journals (Sweden)

    Agnieszka Kinsner

    2007-01-01

    Full Text Available CD59 is one of the key molecules involved in cell protection against autologus complement. The fact that complement regulatory proteins are able to prevent hyperacute rejection of organs in pig to primate model, raises the question of possible complement regulatory protein (CRP involvement in the maturation of immunological system. We report here that in foetal and postnatal human thymus, CD59 and CD55 are primarily located on Hassall's corpuscles and medullary epithelial cells. This localization highly correlates with the expression of CD30L, which is the member of the tumour necrosis factor superfamily. Additionally, TUNEL technique was used to visualize distribution of apoptotic cells in the thymus, which revealed the presence of apoptotic cells closely associated with the Hassall's corpuscles. The observed co-localization of CD59, CD55 and CD30L might suggest an involvement of the complement system in thymic selection in humans.

  14. Quesnoin, a novel pentacyclic ent-diterpene from 55 million years Old Oise Amber.

    Science.gov (United States)

    Jossang, Jean; Bel-Kassaoui, Hakima; Jossang, Akino; Seuleiman, Mannan; Nel, André

    2008-01-18

    Amber, fossilized tree resin, found at the Oise River area of the Paris basin (France) was dated as being 55 million years old. Quesnoin, a novel unique pure organic compound, was isolated from Oise amber. 1H and 13C NMR spectroscopic analysis indicated an unknown diterpene skeleton, quesnane. The absolute configurations of the eight chiral centers of quesnoin were determined to be 4S, 5S, 8R, 9S, 10S, 13S, 14R, and 16S by chiral auxiliary (R)- and (S)-phenylglycine methyl ester derivatization. Quesnoin allowed us to disclose the tree producer, corresponding to modern Hymenaea oblongifolia, Fabaceae, a subfamily of Caesalpiniaceae, one of the oldest angiosperm. The presence of the Amazon rainforest tree, H. oblongifolia, indicated that the climate of the Paris basin might have been tropical in the early Eocene period, 55 million years ago.

  15. Instalación de Dspace 5.5 en Windows 7

    OpenAIRE

    Ortiz Ancona, Dante

    2016-01-01

    Purpose: Simplify the installation process for one of the most complete and common free software tools for build and administrate digital repositories for bring disseminate, interchange and preserve information. Design / methodology / approach: This work use metodology described in “Curso DSPACE para Bibliotecólogos” by Gómez Dueñas Laureano Felipe and “DSpace 5.x Documentation”. Findings:: This manual shows metodology for DSpace 5.5 installation for Windows 7. However, this metodolo...

  16. Bibliography of Soviet Laser Developments, Number 55. September-October 1981.

    Science.gov (United States)

    1983-01-01

    relaxation time of vibration 401 in H 20 by an optoacoustic laser spectrometer. OiS, v. 51, no. 3, 1981, 563-565. 467. Asimov , M.M., V.N. Gavrilenko, and A.N...BERNIKOV YR V 65 ASHMARIN G V 54 PERSON I YA 52 C * ASIMOV M4 M 71 PREL’ I M4 10 ASKAR’YAN G A 31 BFSSONOVA TP S 79 CFIAPNIN V A 55 ASLANYAN L, S 71 BEYLIN YE

  17. Effect of sulfate on methanol degradation in thermophilic (55 oC) methanogenic UASB reactors

    NARCIS (Netherlands)

    Vallero, M.V.G.; Lens, P.N.L.; Paulo, P.L.; Trevino, R.H.M.; Lettinga, G.

    2003-01-01

    A thermophilic (55 degreesC) lab-scale (0.921) methanol-fed upflow anaerobic sludge bed (UASB) reactor (pH 7.0 and hydraulic retention time (HRT) of 7.5 h) was operated at chemical oxygen demand (COD) to sulfate (SO42-) ratios of 10, 5 and 0.5 during 155 days to evaluate the effects of the presence

  18. Assessment Of DR-55 As A Drop-In Replacement For R410A

    OpenAIRE

    Shen, Bo; Abdelaziz, Omar; Liudahl, Lane

    2016-01-01

    R410A has zero ozone depletion potential (ODP), and is the most commonly used refrigerant in vapor compression systems for space cooling and space heating applications. However, it has significant global warming potential with GWP higher than 2000. To mitigate the global warming effect, industry and research institutes are actively pursuing a replacement for R410A, which should have much lower GWP, similar or higher efficiency. Â DR-55 is a design-compatible refrigerant replacement for R410A...

  19. Citation Classics in the Burn Literature During the Past 55 Years

    Science.gov (United States)

    2014-04-01

    infection in a murine model. Surgery 1988;104:882–7. 119 #50 Jones WG, et al. Bacterial translocation and intestinal atrophy after thermal-injury...Arch Surg 1971;102:476–82. 109 #55 Alexander JW, et al. Distribution and survival of Escherichia coli translocating from the intestine after thermal... Intestinal permeability is increased in burn patients shortly after injury. Surgery 1990;107:411–6. 211 #14 Czaja AJ, et al. Acute gastroduodenal disease

  20. A High Mass & Low Envelope Fraction for the Warm Neptune K2-55b

    Science.gov (United States)

    Dressing, Courtney; Sinukoff, Evan; Fulton, Benjamin; Lopez, Eric; Beichman, Charles; Howard, Andrew; Knutson, Heather; Werner, Michael; Schlieder, Joshua; Benneke, Björn; Crossfield, Ian; Isaacson, Howard; Krick, Jessica; Gorjian, Varoujan; Livingston, John; Petigura, Erik; Akeson, Rachel; Batygin, Konstantin; Christiansen, Jessie; Ciardi, David; Crepp, Justin; Jasmine Gonzales, Erica; Hardegree-Ullman, Kevin; Hirsch, Lea; Kosiarek, Molly; Weiss, Lauren

    2018-01-01

    The NASA K2 mission is using the Kepler spacecraft to search for transiting planets in multiple fields along the ecliptic plane. One of the planets detected by K2 is K2-55b, a warm Neptune in a short-period orbit (2.8 days) around a late K dwarf. We previously obtained near-infrared spectra from IRTF/SpeX to characterize the system and found that the host star K2-55 has a radius of 0.715 (+0.043/-0.040) solar radii, a mass of 0.668 (+/- 0.069) solar masses, and an effective temperature of 4300K (+100/-107). We then combined our updated stellar properties with new fits to the K2 photometry to estimate a planet radius of 4.38 (+0.29/-0.25) Earth radii, confirmed the transit ephemeris using Spitzer/IRAC (GO 11026, PI Werner), and embarked on radial velocity observations with Keck/HIRES to measure the planet mass. Our RV data suggest that K2-55b is much more massive than expected, indicating that the planet has a high density despite having a relatively high mass. The lack of a significant volatile envelope tests current theories of gas giant formation and indicates that K2-55b may have avoided runaway accretion by migration, delayed formation, or inefficient core accretion. We gratefully acknowledge funding from the NASA Sagan Fellowship Program and the NASA K2 Guest Observer Program. This work is based in part on observations made with the Spitzer Space Telescope, which is operated by the Jet Propulsion Laboratory, California Institute of Technology under a contract with NASA. Support for this work was provided by NASA through an award issued by JPL/Caltech.

  1. Kontrastunterstützte Sonographie bei Lungenembolie : eine retrospektive Studie bei n=55 Patienten

    OpenAIRE

    Bartelt, Sybille

    2013-01-01

    In dieser Studie wurde bei n=55 Patienten mit dem klinischen Verdacht auf eine Lungenembolie (LE) eine kontrastunterstützte Sonographie (CEUS – contrast-enhanced ultrasound) des Thorax durchgeführt. Bei n=35 Patienten wurde eine Lungenembolie durch CT oder Szintigraphie gesichert (Gruppe A). Bei n=9 Patienten lag eine tiefe Beinvenenthrombose (TBVT) ohne Diagnosesicherung einer Lungenembolie vor (Gruppe B). In n=11 Fällen fanden ...

  2. Pharmacologically induced hypothermia with cannabinoid receptor agonist WIN55, 212-2 after cardiopulmonary resuscitation.

    Science.gov (United States)

    Sun, Shijie; Tang, Wanchun; Song, Fengqing; Chung, Sung Phil; Weng, Yinlun; Yu, Tao; Weil, Max Harry

    2010-12-01

    To investigate whether hypothermia could be induced pharmacologically after resuscitation with the cannabinoid CB1/CB2 receptor agonist in a rat model and its effects on outcomes of cardiopulmonary resuscitation. Prospective, randomized, placebo-controlled experimental study. University-affiliated animal research laboratory. Ten healthy male Sprague-Dawley rats. Ventricular fibrillation was induced and untreated for 6 mins. Defibrillation was attempted after 8 mins of cardiopulmonary resuscitation. Thirty minutes after resuscitation, animals were randomized to receive either WIN55, 212-2 (1.0 mg/kg/hr) or vehicle placebo (1.4 mL/kg/hr) for 6 hrs. Before infusion, the temperature was maintained at 37°C in all the animals with the help of a heating lamp. The same temperature environment was maintained for both groups after infusion. Hemodynamic measurements and cardiac output, ejection fraction, and myocardial performance index were measured at baseline and hourly for 6 hrs after resuscitation. Survival time up to 72 hrs was observed. Blood temperature decreased progressively after infusion of WIN55, 212-2 from 37°C to 34°C 4 hrs after resuscitation. There was no significant change in blood temperature after 6 hrs of placebo infusion of the same volume and same infusate temperature. Significantly better postresuscitation myocardial function and longer durations of survival were observed in WIN55, 212-2-treated animals. The selective cannabinoid agonist, WIN55, 212-2, produced a significant reduction in blood temperature and improved postresuscitation myocardial functions and survival after cardiopulmonary resuscitation. The study results may provide a further option for early and effective induction of therapeutic hypothermia in settings of cardiopulmonary resuscitation.

  3. Social isolation and loneliness in people aged 55 and over in Milton Keynes

    OpenAIRE

    Minocha, Shailey; Holland, Caroline; McNulty, Catherine; Banks, Duncan; Palmer, Jane

    2015-01-01

    Professor Shailey Minocha and Catherine McNulty of the Faculty of Mathematics, Computing and Technology along with Dr Caroline Holland of Faculty of Health and Social Care and Dr Duncan Banks of Faculty of Science of The Open University, UK, in association with Age UK Milton Keynes, have conducted research to investigate the conditions that lead to social isolation and loneliness among older people (55 years and above) in Milton Keynes, and to recommend possible strategies and solutions to pr...

  4. Social isolation and loneliness in people aged 55 and over in the UK

    OpenAIRE

    Minocha, Shailey; Holland, Caroline; McNulty, Catherine; Banks, Duncan; Palmer, Jane

    2016-01-01

    In association with Age UK Milton Keynes, we have conducted research to investigate the conditions that lead to social isolation and loneliness among older people (55 years and above) in Milton Keynes, and to recommend possible strategies and solutions to prevent and mitigate isolation. The project was funded by the Milton Keynes Council and commissioned by the Senior Joint Commissioner, Adult Community Services. The research has involved a review of academic and policy literature on social i...

  5. Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55

    OpenAIRE

    Kotterman, M.

    1998-01-01

    Outline of this thesis
    In this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations, which influenced the oxidation of the PAH compound anthracene and the ligninolytic indicator dye Poly R-478 by the white rot fungus, were studied. Two parameters were identified as the most important P...

  6. Oral ulcerative lesions: a review of 55 cases in Benin-City, Nigeria ...

    African Journals Online (AJOL)

    Result: A total of 55 (1.3%) cases of oral ulcers were diagnosed amongst the 4092 oral lesions seen within the study period. There were 33(60.0%) males and 22 (40.0%) females, giving a ratio of 1.5:1. Most of the patients were in the 3rd decade (n=18, 32.7%). Recurrent aphthous ulcer (n=26, 47.3%) was the most frequent ...

  7. Online Habits of the 55 plus Generation in a Selected Region of the Czech Republic

    OpenAIRE

    Celer, Čeněk; Jánská, Michaela

    2017-01-01

    Purpose – The Internet is now becoming part of the 55 and up generation. This study assumes that there is an increasing number of elderly people using the Internet. Based on this assumption, this article’s objective is to explore the impact of selected demographic characteristics on Internet usage variables. These variables include the frequency of the Internet use, the Internet access location, the type of information sought, and the overall frequency of use of this media for a particular pu...

  8. A POSSIBLE CARBON-RICH INTERIOR IN SUPER-EARTH 55 Cancri e

    Energy Technology Data Exchange (ETDEWEB)

    Madhusudhan, Nikku [Department of Physics and Department of Astronomy, Yale University, New Haven, CT 06511 (United States); Lee, Kanani K. M. [Department of Geology and Geophysics, Yale University, New Haven, CT 06511 (United States); Mousis, Olivier, E-mail: Nikku.Madhusudhan@yale.edu [Universite de Franche-Comte, Institut UTINAM, CNRS/INSU, UMR 6213, Observatoire des Sciences de l' Univers THETA, CP 1615, F-25010 Besancon Cedex (France)

    2012-11-10

    Terrestrial planets in the solar system, such as the Earth, are oxygen-rich, with silicates and iron being the most common minerals in their interiors. However, the true chemical diversity of rocky planets orbiting other stars is yet unknown. Mass and radius measurements are used to constrain the interior compositions of super-Earths (exoplanets with masses of 1-10 M{sub Circled-Plus }), and are typically interpreted with planetary interior models that assume Earth-centric oxygen-rich compositions. Using such models, the super-Earth 55 Cancri e (mass 8 M{sub Circled-Plus }, radius 2 R{sub Circled-Plus }) has been suggested to bear an interior composition consisting of Fe, silicates, and an envelope ({approx}> 10% by mass) of supercritical water. We report that the mass and radius of 55 Cancri e can also be explained by a carbon-rich solid interior made of Fe, C, SiC, and/or silicates and without a volatile envelope. While the data allow Fe mass fractions of up to 40%, a wide range of C, SiC, and/or silicate mass fractions are possible. A carbon-rich 55 Cancri e is also plausible if its protoplanetary disk bore the same composition as its host star, which has been reported to be carbon-rich. However, more precise estimates of the stellar elemental abundances and observations of the planetary atmosphere are required to further constrain its interior composition. The possibility of a C-rich interior in 55 Cancri e opens a new regime of geochemistry and geophysics in extraterrestrial rocky planets, compared to terrestrial planets in the solar system.

  9. Mesiodens: A clinical and radiographic study of 82 teeth in 55 children below 14 years

    Directory of Open Access Journals (Sweden)

    Krishnan Ramesh

    2013-01-01

    Full Text Available Introduction: Supernumerary teeth refers to an excessive number of teeth and are relatively common in the oral cavity. The supernumerary tooth located in the midline of the maxilla between the central incisors is referred to as "mesiodens." The present study emphasizes the importance of multidisciplinary management and long-term follow-up of patients with mesiodens. Aim of the Study: This study investigates the characteristics of mesiodens among children in patients reported to department of pediatric and preventive dentistry in an institution in the state of Tamil Nadu, India. Materials and Methods: The study population consisted of 55 children below 14 years. The characteristics of mesiodens were obtained from radiographs and clinical examination. And all these were confirmed as mesiodens by surgical intervention. Results: Results showed that males were affected approximately 2 times as frequently as females. Predominant shape of the mesiodens was conical (79.7%. 27 (49.09% of 55 patients had multiple mesiodens. 25 (45.45% of 55 patients required orthodontic correction after surgery. Conclusions: Mesiodens can cause many complications. So routine radiographic examination of all pediatric patients is advised. And when identified, they should be extracted as early as possible in children and adolescents in order to avoid possible complications.

  10. Mesiodens: A clinical and radiographic study of 82 teeth in 55 children below 14 years.

    Science.gov (United States)

    Ramesh, Krishnan; Venkataraghavan, Karthik; Kunjappan, Shiji; Ramesh, Maya

    2013-06-01

    Supernumerary teeth refers to an excessive number of teeth and are relatively common in the oral cavity. The supernumerary tooth located in the midline of the maxilla between the central incisors is referred to as "mesiodens". The present study emphasizes the importance of multidisciplinary management and long-term follow-up of patients with mesiodens. This study investigates the characteristics of mesiodens among children in patients reported to department of pediatric and preventive dentistry in an institution in the state of Tamil Nadu, India. The study population consisted of 55 children below 14 years. The characteristics of mesiodens were obtained from radiographs and clinical examination. And all these were confirmed as mesiodens by surgical intervention. Results showed that males were affected approximately 2 times as frequently as females. Predominant shape of the mesiodens was conical (79.7%). 27 (49.09%) of 55 patients had multiple mesiodens. 25 (45.45%) of 55 patients required orthodontic correction after surgery. Mesiodens can cause many complications. So routine radiographic examination of all pediatric patients is advised. And when identified, they should be extracted as early as possible in children and adolescents in order to avoid possible complications.

  11. Impact of functional determinants on 5.5-year mortality in Amazon riparian elderly

    Directory of Open Access Journals (Sweden)

    Tiago C. Antonini

    Full Text Available ABSTRACT Objective To ascertain whether modifiable physical performance–based measurements predicted 5.5-year mortality in a riparian elderly cohort in the Amazon rainforest region. Methods A longitudinal study evaluating the impact of functional determinants on 5.5-year mortality in a riparian elderly cohort from Maués City in the state of Amazonas, Brazil, was performed. The study was a follow-up of a previous observational investigation that evaluated various fitness tests in 630 Amazonian riparian elderly (291 males and 339 females aged 72.3 ± 8.0 (60–99 years old. The cohort was selected for its adverse environmental conditions, which increased the risk of falls yet required maintenance of good physical condition for carrying out relatively rigorous daily activities, and restricted access to specialized health services. Official death records were obtained from the Maués Municipal Health Department. Results A total of 80 study participants (12.7% died over the 5.5-year study period. Kaplan-Meier regression analysis showed significant association between Timed Up and Go (TUG test scores ≥ 14 seconds and mortality risk, independent of sex, age, and other health variables. Conclusions The study results suggest that the TUG test can be used as an indicator for initiating therapeutic and preventive actions, including conducting exercises or physical activities adapted to the health and functional conditions of the elderly, by identifying elderly people with a higher relative risk of mortality.

  12. Midbody Targeting of the ESCRT Machinery by a Noncanonical Coiled Coil in CEP55

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Hyung Ho; Elia, Natalie; Ghirlando, Rodolfo; Lippincott-Schwartz, Jennifer; Hurley, James H. (NIH)

    2008-11-14

    The ESCRT (endosomal sorting complex required for transport) machinery is required for the scission of membrane necks in processes including the budding of HIV-1 and cytokinesis. An essential step in cytokinesis is recruitment of the ESCRT-I complex and the ESCRT-associated protein ALIX to the midbody (the structure that tethers two daughter cells) by the protein CEP55. Biochemical experiments show that peptides from ALIX and the ESCRT-I subunit TSG101 compete for binding to the ESCRT and ALIX-binding region (EABR) of CEP55. We solved the crystal structure of EABR bound to an ALIX peptide at a resolution of 2.0 angstroms. The structure shows that EABR forms an aberrant dimeric parallel coiled coil. Bulky and charged residues at the interface of the two central heptad repeats create asymmetry and a single binding site for an ALIX or TSG101 peptide. Both ALIX and ESCRT-I are required for cytokinesis, which suggests that multiple CEP55 dimers are required for function.

  13. Leuconostoc mesenteroides SJRP55: A Bacteriocinogenic Strain Isolated from Brazilian Water Buffalo Mozzarella Cheese.

    Science.gov (United States)

    de Paula, Aline Teodoro; Jeronymo-Ceneviva, Ana Beatriz; Silva, Luana Faria; Todorov, Svetoslav Dimitrov; Franco, Bernadette Dora Gombossy de Melo; Choiset, Yvan; Haertlé, Thomas; Chobert, Jean-Marc; Dousset, Xavier; Penna, Ana Lúcia Barretto

    2014-12-01

    The production of bacteriocins by Leuconostoc mesenteroides represents an important opportunity for exploration of their potential use for industrial purpose. The antimicrobial compounds produced by L. mesenteroides subsp. mesenteroides SJRP55 strain were characterized and purified. Cell-free supernatant of Leuc. mesenteroides subsp. mesenteroides SJRP55 produced antibacterial compounds against Listeria spp. strains and not inhibiting against Lactobacillus spp. The antimicrobial substances were stable at high temperatures (100 °C for 2 h and 121 °C for 20 min) and low pH (pH 2-4) values, but sensitive to proteolytic enzymes and resistant to α-amylase, lipase and catalase enzymes. The optimal temperature for active peptides production was 25 °C. The antimicrobial compounds were purified by ammonium sulfate precipitation, affinity column and reverse-phase chromatography. Mass spectrometry and amino acids analyses showed that the bacteriocins were identical to mesentericin Y105 and B105. The producer strain's DNA analysis revealed presence of open reading frames possibly coding for virulence factors, such as enterococcal surface protein (esp), collagen adhesion (ace) and intrinsic vancomycin resistance (vanA); however, biogenic amines encoding genes were not observed. Leuc. mesenteroides subsp. mesenteroides SJRP55 is a promising biopreservative culture in fermented milk, and the purified bacteriocins can also be applied in food preservation.

  14. A truncating TPO mutation (Y55X) in patients with hypothyroidism and total iodide organification defect.

    Science.gov (United States)

    Cangul, Hakan; Darendeliler, Feyza; Saglam, Yaman; Kucukemre, Banu; Kendall, Michaela; Boelaert, Kristien; Barrett, Timothy G; Maher, Eamonn R

    2015-01-01

    Absract Purpose: Mutations in the TPO gene have been reported to cause congenital hypothyroidism (CH), and our aim in this study was to determine the genetic basis of congenital hypothyroidism in two affected children coming from a consanguineous family. Since CH is usually inherited in autosomal recessive manner in consanguineous/multi case-families, we adopted a two-stage strategy of genetic linkage studies and targeted sequencing of the candidate genes. First we investigated the potential genetic linkage of the family to any known CH locus using microsatellite markers and then screened for mutations in linked-gene by Sanger sequencing. The family showed potential linkage to the TPO gene and we detected a non-sense mutation (Y55X) in both cases that had total iodode organification defect (TIOD). The mutation segregated with disease status in the family. Y55X is the only truncating mutation in the exon 2 of the TPO gene reported in the literature and results in the earliest stop codon known in the gene to date. This study confirms the pathogenicity of Y55X mutation and demonstrates that a nonsense mutation in the amino-terminal coding region of the TPO gene could totally abolish the function of the TPO enzyme leading to TIOD. Thus it helps to establish a strong genotype/phenotype correlation associated with this mutation. It also highlights the importance of molecular genetic studies in the definitive diagnosis and accurate classification of CH.

  15. Eye development under the control of SRp55/B52-mediated alternative splicing of eyeless.

    Directory of Open Access Journals (Sweden)

    Weronika Fic

    2007-02-01

    Full Text Available The genetic programs specifying eye development are highly conserved during evolution and involve the vertebrate Pax-6 gene and its Drosophila melanogaster homolog eyeless (ey. Here we report that the SR protein B52/SRp55 controls a novel developmentally regulated splicing event of eyeless that is crucial for eye growth and specification in Drosophila. B52/SRp55 generates two isoforms of eyeless differing by an alternative exon encoding a 60-amino-acid insert at the beginning of the paired domain. The long isoform has impaired ability to trigger formation of ectopic eyes and to bind efficiently Eyeless target DNA sequences in vitro. When over-produced in the eye imaginal disc, this isoform induces a small eye phenotype, whereas the isoform lacking the alternative exon triggers eye over-growth and strong disorganization. Our results suggest that B52/SRp55 splicing activity is used during normal eye development to control eye organogenesis and size through regulation of eyeless alternative splicing.

  16. Development and assessment of a shortened Quality of Life in Childhood Epilepsy Questionnaire (QOLCE-55).

    Science.gov (United States)

    Goodwin, Shane W; Lambrinos, Anastasia I; Ferro, Mark A; Sabaz, Mark; Speechley, Kathy N

    2015-06-01

    To develop and validate a shortened version of the Quality of Life in Childhood Epilepsy Questionnaire (QOLCE). A secondary aim was to compare baseline risk factors predicting health-related quality of life (HRQoL) in children newly diagnosed with epilepsy, as identified using the original and shortened version. Data came from the Health-Related Quality of Life in Children with Epilepsy Study (HERQULES, N = 373), a multicenter prospective cohort study. Principal component analysis reduced the number of items from the original QOLCE, and factor analysis was used to assess the factor structure of the shortened version. Convergent and divergent validity was assessed by correlating the Child Health Questionnaire (CHQ) with the shortened QOLCE. Multiple regression identified risk factors at diagnosis for HRQoL at 24 months. A four-factor, higher-order, 55-item solution was obtained. A total of 21 items were removed. The final model represents functioning in four dimensions of HRQoL: Cognitive, Emotional, Social, and Physical. The shortened QOLCE demonstrated acceptable fit: Bentler's Comparative Fit Index = 0.944; Tucker-Lewis Index = 0.942; root mean square approximation = 0.058 (90% CI: 0.056-0.061); weighted root mean square residuals (WRMR) = 1.582, and excellent internal consistency (α = 0.96, subscales α > 0.80). Factor loadings were good (first-order: λ = 0.66-0.93; higher-order λ = 0.66-0.85; p QOLCE scores correlated strongly with similar subscales of the Child Health Questionnaire (ρ = 0.38-0.70) while correlating weakly with dissimilar subscales (ρ = 0.30-0.31). While controlling for HRQoL at diagnosis, predictors for better HRQoL at 24 months were the following: no cognitive problems reported (p = 0.001), better family functioning (p = 0.014), fewer family demands (p = 0.008), with an interaction between baseline HRQoL and cognitive problems (p = 0.011). Results offer initial evidence regarding reliability and validity of the proposed 55-item shortened

  17. Expression and prognostic value of soluble CD97 and its ligand CD55 in intrahepatic cholangiocarcinoma.

    Science.gov (United States)

    Meng, Ze-Wu; Liu, Min-Chao; Hong, Hai-Jie; Du, Qiang; Chen, Yan-Ling

    2017-03-01

    The incidence rate of intrahepatic cholangiocarcinoma is rising, and treatment options are limited. Therefore, new biological markers of intrahepatic cholangiocarcinoma are needed. Immunohistochemistry and enzyme-linked immunosorbent assay were applied to analyze the expressions of CD97, CD55, and soluble CD97 in 71 patients with intrahepatic cholangiocarcinoma and 10 patients with hepatolithiasis. CD97 and CD55 were not expressed in hepatolithiatic tissues, but positive expression was observed in 76.1% (54/71) and 70.4% (50/71) of intrahepatic cholangiocarcinoma patients. The univariate analyses indicated that the positive expressions of CD97 and CD55 were related to short intrahepatic cholangiocarcinoma survival of patients (both p = 0.001). Furthermore, CD97 and CD55 expressions and biliary soluble CD97 levels were significantly associated with histological grade (p = 0.004, 0.002, and 0.012, respectively), lymph node metastases (p = 0.020, 0.038, and 0.001, respectively), and venous invasion (p = 0.003, 0.002, and 0.001, respectively). The multivariate analyses indicated that lymph node metastases (hazard ratio: 2.407, p = 0.003), positive CD55 expression (hazard ratio: 4.096, p = 0.003), and biliary soluble CD97 levels (hazard ratio: 2.434, p = 0.002) were independent risk factors for the intrahepatic cholangiocarcinoma survival. The receiver operating characteristic (ROC) curve analysis indicated that when the cutoff values of biliary soluble CD97 were 1.15 U/mL, the diagnostic value for predicting lymph node metastasis had a sensitivity of 87.5% and a specificity of 51.3%. For intrahepatic cholangiocarcinoma patient death within 60 months at a cutoff value of 0.940 U/mL, the diagnostic value sensitivity was 89.3% and the specificity was 93.3%. Biliary soluble CD97 may be a new biological marker for early diagnosis, prediction of lymph node metastasis and poor prognosis, and discovery of a therapeutic target.

  18. 'Freestyle' - 5.5 kWp photovoltaic roof; Toiture photovoltaique Freestyle de 5,5 kWp

    Energy Technology Data Exchange (ETDEWEB)

    Affolter, P. [Solstis, Lausanne (Switzerland)

    2005-07-01

    This illustrated final report for the Swiss Federal Office of Energy (SFOE) describes a photovoltaics installation on a villa in the vineyards above the Lake of Geneva in Switzerland. The 'Freestyle' roofing system used, which allows a roof to be covered with an unglazed, watertight photovoltaic system, is described. This system features aluminium profiles that are fixed to the roof structure, corrugated panels that form a self-draining sub-roof and laminated photovoltaic (PV) cells based on triple-cell amorphous silicon technology. This pilot system with a peak power of 5.5 kW covers an area of 160 m{sup 2}. The active PV area amounts to 100 m{sup 2}. The aesthetics of the installation is discussed. The operation and performance of the system, which was put into service in May 2003, is discussed. The results of measurements made over a period of more than 12 months are presented. The author states that these results are far better than expected.

  19. Proceedings of the 55th Meeting on Cryogenics and Superconductivity; Dai 55 kai 1996 nendo shuki teion kogaku chodendo gakkai koen gaiyoshu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-06

    This is a proceedings of the 55th Meeting on Cryogenics and Superconductivity. As for wires, made public were Bi-system 2223, Y-system NbTi, NbSn, Nb3Al, etc. As to oxide superconductors, some of them are promising. The study of those characteristics and the developmental application to the electric power field such as coils and cables were introduced. Beside wires, multilayer film superconductors were also introduced. With relation to fundamentals and theories, became topics were pinning characteristics, NbTi proximity effects, magnetic flux and visualization, stability, etc. About the application, large refrigerators are discussed in the refrigeration field in addition to GM/pulse tube refrigerators. Concerning cooling technology, made public were the development of a floating railroad use 80K cooling system, etc. Also studied were power leads, superconducting magnet, control action characteristics, etc. SMES (superconducting magnetic energy storage) also became a topic, and the element coil energization experiment, stability and mechanical properties were described. The paper also touched on accelerators, large superconducting devices such as LHD (large helical device) and ITER (international thermal-nuclear experimental reactor) as well as generators and current limiters. The cryogenetic engineering was also reported such as fracture toughness and superfluidity of cryostats and structural materials for extremely low temperatures.

  20. Lithium insertion in reduced tungsten oxides. I. Li/sub 9. 0/W/sub 19/O/sub 55/

    Energy Technology Data Exchange (ETDEWEB)

    Rosique-Perez, C.; Gonzalez-Calbet, J.; Vallet-Regi, M.; Alario-Franco, M.A.

    1988-10-01

    Lithium has been inserted chemically at room temperature into the crystallographic shear phase W/sub 19/O/sub 55/. Maximum lithium content was Li/sub 9.0/W/sub 19/O/sub 55/. X-ray diffraction and electron microscopy show that lithium insertion contracts the lattice and causes the doubling of a and b parameters of the W/sub 19/O/sub 55/ unit cell.

  1. Scandium doped Strontium Titanate Ceramics: Structure, Microstructure, and Dielectric Properties

    Directory of Open Access Journals (Sweden)

    Tkach, Alexander

    2008-08-01

    Full Text Available Sc-doped strontium titanate (ST ceramics were synthesised by solid state reaction, according to the composition Sr1-1.5xScxTiO3 with x = 0-0.01. Structural properties and microstructure development was examined by XRD and SEM. The dielectric properties were evaluated as a function of the temperature and frequency in the radio frequency range. Lattice parameter, density and grain size, were found to decrease slightly with increasing Sc content. The dielectric permittivity and losses decrease also. Sc-doping has only a weak effect on the quantum paraelectric behaviour of ST and no dielectric anomaly was observed, what is probably related to the limited solubility of Sc on the Sr site of the perovskite lattice of ST.

    Se sintetizaron materiales cerámicos de titanato de estroncio dopado con escandio mediante reacción en estado sólido De acuerdo a la composición Sr1-1.5xScxTiO3 con x= 0-0.1. Las propiedades estructurales y el desarrollo microestructural se estudiaron mediante XRD y SEM. La propiedades dieléctricas se estudiaron como función de la temperatura y de la frecuencia en el rango de la frecuencias de radio. Se observó que los parámetros de red, la densidad y el tamaño del grano disminuyen ligeramente con el contenido en Sc. La permitividad dieléctrica y las perdidas también disminuyen. El dopado con Sc tiene un efecto muy ligero sobre el comportamiento paraeléctrico cuántico del titanato de estroncio y no se observó anomalías dioeléctricas , lo que está probablemente relacionado con la baja solubilidad del Sc en posiciones del Sr en la estructura tipo perovskita del titanato de estroncio.

  2. Phenoxyl radical complexes of gallium, scandium, iron and manganese.

    Science.gov (United States)

    Adam, B; Bill, E; Bothe, E; Goerdt, B; Haselhorst, G; Hildenbrand, K; Sokolowski, A; Steenken, S; Weyhermüller, T; Wieghardt, K

    1997-02-01

    The hexadentate macrocyclic ligands 1,4,7-tris(3,5-dimethyl-2-hydroxybenzyl)-1,4,7-triazacyclononane (L CH 3H3 ), 1,4,7-tris(3,5-di-tert-butyl-2-hydroxybenzyl)-1,4,7-triazacyclononane (L(Bu) H3 ) and 1,4,7-tris(3-tert-butyl-5-methoxy-2-hydroxybenzyl)-1,4,7-triazacyclononane (L OCH 3-H3 ) form very stable octahedral neutral complexes LM(III) with trivalent (or tetravalent) metal ions (Ga(III) , Sc(III) , Fe(III) , Mn(III) , Mn(IV) ). The following complexes have been synthesized: [L(Bu) M], where M = Ga (1), Sc (2), Fe (3); [L(Bu) Mn(IV) ]PF6 (4'); [L OCH 3M], where M = Ga (1 a), Sc (2 a), Fe (3 a); [L OCH 3Mn(IV) ]PF6 (4 a'); [L CH 3M], where M = Sc (2 b), Fe (3 b), Mn(III) (4 b); [L CH 3Mn(IV) ]2 (ClO4 )3 (H3 O)(H2 O)3 (4 b'). An electrochemical study has shown that complexes 1, 2, 3, 1 a, 2 a and 3 a each display three reversible, ligand-centred, one-electron oxidation steps. The salts [L OCH 3Fe(III) ]ClO4 and [L OCH 3Ga(III) ]ClO4 , have been isolated as stable crystalline materials. Electronic and EPR spectra prove that these oxidations produce species containing one, two or three coordinated phenoxyl radicals. The Mössbauer spectra of 3 a and [3 a](+) show conclusively that both compounds contain high-spin iron(III) central ions. Temperature-dependent magnetic susceptibility measurements reveal that 3 a has an S = 5/2 and [3a](+) an S = 2 ground state. The latter is attained through intramolecular antiferromagnetic exchange coupling between a high-spin iron(III) (S1 = 5/2) and a phenoxyl radical (S2 = 1/2) (H = - 2JS1 S2 ; J = - 80 cm(-1) ). The manganese complexes undergo metal- and ligand-centred redox processes, which were elucidated by spectroelectrochemistry; a phenoxyl radical Mn(IV) complex [Mn(IV) L OCH 3](2+) is accessible. Copyright © 1997 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Atomic layer deposition of scandium-based oxides

    Energy Technology Data Exchange (ETDEWEB)

    Nyns, Laura; Lisoni, Judit G.; Bosch, Geert van den; Elshocht, Sven van; Houdt, Jan van [IMEC, Leuven (Belgium)

    2014-02-15

    Gd{sub x}Sc{sub 2-x}O{sub 3} and Al{sub x}Sc{sub 2-x}O{sub 3} have been investigated as potential high-k intergate dielectric (IGD) in planar NAND flash technology, such as hybrid floating gate (HFG). We have examined the atomic layer deposition (ALD) of Sc{sub 2}O{sub 3}, Gd{sub x}Sc{sub 2-x}O{sub 3}, and Al{sub x}Sc{sub 2-x}O{sub 3} on Si using Sc(MeCp){sub 3}, Gd({sup i}PrCp){sub 3}, TMA, and H{sub 2}O as precursors. The composition of Gd{sub x}Sc{sub 2-x}O{sub 3} and Al{sub x}Sc{sub 2-x}O{sub 3} ranged from 4% to 76% Gd and from 7% to 66% Al, respectively. All compositions show linear growth behavior. While pure Sc{sub 2}O{sub 3} is crystalline as-deposited, the layer becomes amorphous once ∝20% of Al is added. The (222) reflection of the cubic phase is also seen for Gd{sub x}Sc{sub 2-x}O{sub 3} with less than 9% Gd. The bandgap of as-deposited Gd{sub x}Sc{sub 2-x}O{sub 3} decreases with increasing Gd content while the opposite trend is observed for Al{sub x}Sc{sub 2-x}O{sub 3}. A k-value of ∝21 can be obtained for Gd{sub x}Sc{sub 2-x}O{sub 3} with approximately 26-52% Gd, irrespective of the Gd content. For Al{sub x}Sc{sub 2-x}O{sub 3} on the other hand, a maximum k-value of ∝19 is achieved with ∝48% Al. Although the k-value of Al{sub x}Sc{sub 2-x}O{sub 3} is lower than that of Gd{sub x}Sc{sub 2-x}O{sub 3}, its large breakdown field makes this material more suitable for HFG flash applications. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. Spark plasma sintering of aluminum powders prealloyed with scandium additions

    Energy Technology Data Exchange (ETDEWEB)

    Cooke, R.W.; Kraus, N.P.; Bishop, D.P., E-mail: Paul.Bishop@dal.ca

    2016-03-07

    The objective of this research was to commence work on the spark plasma sintering (SPS) of Al–Sc alloys in an effort to develop fundamental data in this area. In this precursory study, a series of binary systems containing 0.1 to 0.4 wt% Sc were processed in laboratory and industrial-scale equipment. Data revealed that all powders were responsive to SPS in both scenarios and that sintering temperature was a variable of critical importance. Hardness of as-sintered products scaled directly with Sc concentration but varied inversely with SPS temperature owing to in-situ aging of the raw powders. Hardness losses could be recovered through a post-SPS heat treatment into the T6 condition. Industrially processed slugs of Al-0.4Sc-T6 exhibited full densification and offered the highest hardness (786+/−8 MPa). This was accompanied by a nominal tensile yield strength of 197 MPa, UTS of 226 MPa and tensile ductility of 11%.

  5. Tin etching from metallic and oxidized scandium thin films

    NARCIS (Netherlands)

    Pachecka, Malgorzata; Lee, Christopher James; Sturm, J.M.; Bijkerk, Frederik

    The role of oxide on Sn adhesion to Sc surfaces was studied with in-situ ellipsometry, X-ray photoelectron spectroscopy and secondary electron microscopy. Sn etching with hydrogen radicals was performed on metallic Sc, metallic Sc with a native oxide, and a fully oxidized Sc layer. The results show

  6. The structural and magnetic properties of holmium/scandium superlattices

    DEFF Research Database (Denmark)

    Bryn-Jacobsen, C.; Cowley, R.A.; McMorrow, D.F.

    1997-01-01

    The properties of Ho/Sc superlattices grown by molecular beam epitaxy (MBE) have been investigated using X-ray and neutron diffraction techniques. Structural studies reveal the novel existence of more than one a lattice parameter. Examining the magnetic properties, it is found that the Ho 4f...

  7. Prevalência de achados pulmonares em 55 pacientes com neoplasias esofagianas Prevalence of lung abnormalities in 55 patients with esophageal cancer

    Directory of Open Access Journals (Sweden)

    Tiago Alves de Brito Zan

    2005-02-01

    Full Text Available OBJETIVO: Identificar alterações pulmonares em pacientes com neoplasia esofágica. Comparar os dados obtidos, além de mostrar sua relação com o tabagismo. MATERIAIS E MÉTODOS: Estudo transversal tipo série de casos. Foram analisados prontuários e exames de imagem (tomografias computadorizadas e radiografias de 55 pacientes com câncer de esôfago, diagnosticados entre 1998 e 2001, no Hospital de Base de São José do Rio Preto. Comparou-se a freqüência dos tumores encontrados e outras alterações pulmonares em dois grupos de pacientes: tabagistas e não tabagistas. RESULTADOS: Quarenta e seis (83% pacientes apresentaram carcinomas espinocelulares, sete (13% adenocarcinomas, um (2% carcinoma de pequenas células e um (2% linfoma não-Hodgkin. Quarenta e oito (87% pacientes eram tabagistas e sete (13% eram não tabagistas. Entre os tabagistas, 89% possuíam carcinoma espinocelular, 9% adenocarcinoma e 2% carcinoma de pequenas células. Entre os não tabagistas, 57% apresentaram adenocarcinoma, 28% carcinoma espinocelular e 15% linfoma não-Hodgkin. Houve metástases em quatro tabagistas e em dois não tabagistas. A prevalência das alterações pulmonares (infiltrado intersticial, enfisema e pneumonia foi maior nos tabagistas (73% do que nos não tabagistas (27% (p = 0,03. CONCLUSÃO: Este fato reforça a importância da avaliação pulmonar nos pacientes com neoplasia esofágica.OBJECTIVE: To identify lung abnormalities in patients with esophageal cancer, to compare the obtained data and to demonstrate its relationship with smoking. MATERIALS AND METHODS: This was a series of cases type of cross-sectional study. We studied 55 patients with esophageal carcinoma diagnosed between 1998 and 2001 at "Hospital de Base de São José do Rio Preto", SP, Brazil. Chest plain films and computed tomography scans were analyzed. The frequency of the tumors and other lung abnormalities in two groups of patients were compared: smokers and non

  8. Doença de Hirschsprung: experiência com uma série de 55 casos Hirschsprung's disease: experiment with a serie of 55 cases

    Directory of Open Access Journals (Sweden)

    Maria Auxiliadora Monteiro Villar

    2009-09-01

    Full Text Available OBJETIVOS: analisar aspectos clínicos de pacientes com Doença de Hirschprung (DH. MÉTODOS: realizou-se estudo de caso institucional, retrospectivo, via revisão de prontuários de pacientes com DH atendidos no Instituto Fernandes Figueira entre 1993 e 2003. RESULTADOS: Em um total de 55 pacientes, 98% apresentaram sintomas neonatais, sendo 47,2% diagnosticados nesse período; em 88,9% o enema baritado foi conclusivo; 69% tinham DH de segmento curto; 16,3% síndrome de Down; 15,2% outras anomalias congênitas; 40% foram rastreados para mutações RET associadas a neoplasias endócrinas múltiplas (MEN2A, não sendo detectada nenhuma; 63,6% fizeram abaixamento estagiado do colon/íleo; 12,72% abaixamento endoretal transanal primário; as principais complicações cirúrgicas foram sepse, enterocolite e obstrução intestinal; distúrbios da defecação foram detectados anos pós-cirurgia; a taxa de letalidade foi 9,25%; os óbitos relacionaram-se a enterocolite e sepse pós-operatórias. CONCLUSÃO: embora apresentasse sintomas neonatais, a maioria dos pacientes foi diagnosticada tardiamente. Enterocolite foi a principal causa de morbimortalidade. Distúrbios da defecação ocorrem com frequência, demandando follow-up prolongado. Embora rara, a associação com MEN2A precisa ser investigada devido à agressividade da doença. A heterogeneidade clínica e genética da DH exige atuação de equipe multidisciplinar.OBJECTIVES: to analyze clinical features of patients with Hirschprung's Disease (HD. METHODS: a retrospective institutional case study was carried out using the medical records of patients with HD attending the Fernandes Figueira Institute between 1993 and 2003. RESULTS: out of a total of 55 patients, 98% presented symptoms on birth, 47.2% of whom were diagnosed during the neonatal period; in 88.9% of cases the barium enema was conclusive; 69% had short segment HD; 16.3% Down's Syndrome; 15.2% other congenital anomalies; 40% were

  9. TRMM Ground Validation Radar Site 3D Rain Map L3 1 month 2 km V7 (TRMM_3A55) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The 3A55, 'Monthly 3-D Structure', provides radar site monthly 3-D structure information obtained from 2A55. The 2A55 'Radar Site 3-D Reflectivities', is composed of...

  10. A Case for an Atmosphere on Super-Earth 55 Cancri e

    Science.gov (United States)

    Angelo, Isabel; Hu, Renyu

    2017-12-01

    One of the primary questions when characterizing Earth-sized and super-Earth-sized exoplanets is whether they have a substantial atmosphere like Earth and Venus or a bare-rock surface like Mercury. Phase curves of the planets in thermal emission provide clues to this question, because a substantial atmosphere would transport heat more efficiently than a bare-rock surface. Analyzing phase-curve photometric data around secondary eclipses has previously been used to study energy transport in the atmospheres of hot Jupiters. Here we use phase curve, Spitzer time-series photometry to study the thermal emission properties of the super-Earth exoplanet 55 Cancri e. We utilize a semianalytical framework to fit a physical model to the infrared photometric data at 4.5 μm. The model uses parameters of planetary properties including Bond albedo, heat redistribution efficiency (I.e., ratio between radiative timescale and advective timescale of the atmosphere), and the atmospheric greenhouse factor. The phase curve of 55 Cancri e is dominated by thermal emission with an eastward-shifted hotspot. We determine the heat redistribution efficiency to be {1.47}-0.25+0.30, which implies that the advective timescale is on the same order as the radiative timescale. This requirement cannot be met by the bare-rock planet scenario because heat transport by currents of molten lava would be too slow. The phase curve thus favors the scenario with a substantial atmosphere. Our constraints on the heat redistribution efficiency translate to an atmospheric pressure of ˜1.4 bar. The Spitzer 4.5 μm band is thus a window into the deep atmosphere of the planet 55 Cancri e.

  11. Predicting the risk of osteopenia for women aged 40-55 years.

    Science.gov (United States)

    Chen, Jen-Hau; Chen, Yen-Ching; Tsai, Min-Kuang; Chiou, Jeng-Min; Lee, Wen-Chung; Tsao, Chwen-Keng; Tsai, Keh-Sung; Chie, Wei-Chu

    2017-11-01

    Osteoporosis has been linked to an increased fracture risk and subsequent mortality in the later life. Previous prediction models have focused on osteoporosis in postmenopausal women; however, a prediction tool for osteopenia is needed. Our objective was to establish a prediction model for osteopenia risk in women aged 40-55 years. This was a cross-sectional study. A total of 1350 Taiwanese women aged 40-55 years were recruited from a health checkup center from 2009 to 2010. The main outcome measure was osteopenia (-1≥bone mineral density T-score > -2.5). The Osteoporosis Preclinical Assessment Tool (OPAT) developed in this study was based on variables with biological importance to osteopenia and variables that remained significant (p<0.05) in the multivariable analysis, which include age, menopausal status, weight, and alkaline phosphatase level. The OPAT has a total score that ranges from 0 to 7, and categorizes women into high-, moderate-, and low-risk groups. The predictive ability of the OPAT (area under the receiver operating characteristic curve=0.77) was significantly better than that of the Osteoporosis Self-assessment Tool for Asians (area under the receiver operating characteristic curve=0.69). The inclusion of serum total alkaline phosphatase level in the model, which is easy to obtain from routine health checkups, significantly enhanced the sensitivity (McNemar test, p=0.004) for detecting osteopenia in women aged 40-55 years. Our findings provide an important tool for identifying women at risk of osteoporosis at the preclinical phase. Copyright © 2017. Published by Elsevier B.V.

  12. Photometric Selection of a Massive Galaxy Catalog with z ≥ 0.55

    Science.gov (United States)

    Núñez, Carolina; Spergel, David N.; Ho, Shirley

    2017-02-01

    We present the development of a photometrically selected massive galaxy catalog, targeting Luminous Red Galaxies (LRGs) and massive blue galaxies at redshifts of z≥slant 0.55. Massive galaxy candidates are selected using infrared/optical color-color cuts, with optical data from the Sloan Digital Sky Survey (SDSS) and infrared data from “unWISE” forced photometry derived from the Wide-field Infrared Survey Explorer (WISE). The selection method is based on previously developed techniques to select LRGs with z> 0.5, and is optimized using receiver operating characteristic curves. The catalog contains 16,191,145 objects, selected over the full SDSS DR10 footprint. The redshift distribution of the resulting catalog is estimated using spectroscopic redshifts from the DEEP2 Galaxy Redshift Survey and photometric redshifts from COSMOS. Restframe U - B colors from DEEP2 are used to estimate LRG selection efficiency. Using DEEP2, the resulting catalog has an average redshift of z = 0.65, with a standard deviation of σ =2.0, and an average restframe of U-B=1.0, with a standard deviation of σ =0.27. Using COSMOS, the resulting catalog has an average redshift of z = 0.60, with a standard deviation of σ =1.8. We estimate 34 % of the catalog to be blue galaxies with z≥slant 0.55. An estimated 9.6 % of selected objects are blue sources with redshift z< 0.55. Stellar contamination is estimated to be 1.8%.

  13. Acute coronary syndrome in young women under 55 years of age: clinical characteristics, treatment, and outcomes.

    Science.gov (United States)

    Davis, Melinda; Diamond, Jamie; Montgomery, Daniel; Krishnan, Sangeetha; Eagle, Kim; Jackson, Elizabeth

    2015-08-01

    Young women with acute coronary syndrome (ACS) may represent a high risk group, but little is known about specific age and sex differences in clinical characteristics, treatment, outcomes, and trends over time. Data from 3237 men and women admitted with an ACS event from 1999 to 2006 were analyzed. Patients were grouped by sex and age less than 55 years. Demographics, presentation, treatment, and outcomes at 6 months were analyzed. Primary outcomes included mortality, recurrent myocardial infarction, rehospitalization, and stroke at 6 months. Secondary analyses assessed risk factors, management, and trends over time. Women under 55 years represented 8% of the entire cohort, and 26% of patients under age 55 years. Compared to older women, young women were more likely to be smokers (51 vs. 14%, p < 0.001) and obese (44 vs. 34%, p = 0.006). Young women had more diabetes and hypertension than young men. Mortality was lowest among young women and did not change over time. Young women received less treatment with aspirin, beta blockers, lipid-lowering agents, and ACE inhibitors, and underwent less coronary angiography and stenting than young men (44 vs. 59%, p < 0.001). Rehospitalization was higher among young women than young men (37 vs. 27%, p < 0.001), with no change over time. Modifiable risk factors such as smoking, obesity, diabetes, and hypertension should be addressed in young women. Following ACS, young women received fewer evidence-based medications, were treated less invasively, and had higher readmission rates within 6 months compared to young men.

  14. 3-Hydroxy-5,5-dimethyl-2-(2-oxopropylcyclohex-2-enone

    Directory of Open Access Journals (Sweden)

    Jose Camacho

    2009-12-01

    Full Text Available The title compound, C11H16O3, was obtained by reaction of dimedone, 5,5-dimethylcyclohexane-1,3-dione, and α-chloroacetone. The cyclohexenone ring exhibits an envelope conformation with puckering amplitudes Q = 0.433 (2 and Φ = −109.0 (3°. The 2-oxopropyl fragment is almost perpendicular to the cyclohexanone ring [dihedral angle = 77.72 (8°]. In the crystal, the molecules are linked to each other through O—H...O hydrogen bonding, building a chain parallel to the b axis.

  15. A 55-Year Old Man with Acute Painful Flank Mass, a Case Report

    Directory of Open Access Journals (Sweden)

    Aida Alavi-Moghaddam

    2014-03-01

    Full Text Available Lumbar hernias (LH accounts for less than 1.5% of total hernia incidence. It can occur in two separate triangular areas of the flank. About 300 cases have been reported in the literature. Here, we report a 55-year old man with acute painful left side flank mass and final diagnosis of LH. The mass was appeared about three hours before admission and his pain was slight at first but became more severe gradually. He had stable vital sign and the only positive finding on his physical examination was the sphere shape, firm, mobile, and mild tender mass at his left flank.

  16. Financial Analysis Of Citrus “Keprok 55” In Coventional Way and Using Sprinkler Irrigation

    Directory of Open Access Journals (Sweden)

    Bambang Suharto

    2017-03-01

    Full Text Available Batu-Malang Government area is one of central production of citrus ”Keprok 55” in East Java. In dry season, citrus produce low production level, because there is unsufficient water inside the soil. Based on this facts, some efforts is needed in order to increase the citrus production especially to face the dry season, through sprinkle irrigation system to increase citrus production. Sprinkle irrigation system has been installed on citrus plantation in Selorejo Village, Batu. Citrus is one of the horticultural commodities which have priority to be developed. One type of citrus that favored consumers are mandarin (tangerine. During the period 2005-2009 tangerine imports reached 504,063 tonnes, or about 100,813 tonnes per year with a value of US $ 80,569,300. Management of commodity Citrus 55 in Selorejo village, subdistrict Dau, Malang not get maximum benefit due to the limitations of the use of technological innovation as well as the lack of capital. The experiment calculated HPP, BEP, NPV, R/C ratio, IRR and PP. This study was to compare the effect of management changes Citrus 55 between conventional and sprinkler irrigation. The financial viability of commodity management Citrus 55 in Selorejo Village declared eligible to run either conventionally or with sprinkler irrigation. Age commodity management business is ten years. Conventional management NVP value is IDR 1,234,468,408 and the value of NVP management with the use of sprinkler irrigation is IDR 5,200,599,957. PP value of conventional management is 5 years 2 months and sprinkler irrigation is 2 years and 5 months. Conventional management IRR value is 59.47% and value of management use sprinkle is 68.08%. R/C Ratio with conventional management is 1.4 and value R/C Ratio with sprinkle is 5.7. BEP value with management conventional is 5,719 kilograms and with sprinkle is 16,059 Kilograms. HPP value with management conventional is IDR 784 and with sprinkle is IDR 191.

  17. Water Resistant Container Technical Basis Document for the TA-55 Criticality Safety Program

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Paul Herrick [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Teague, Jonathan Gayle [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-04-30

    Criticality safety at TA-55 relies on nuclear material containers that are water resistant to prevent significant amounts of water from coming into contact with fissile material in the event of a fire that causes a breach of glovevbox confinement and subsequent fire water ingress. A “water tight container” is a container that will not allow more than 50ml of water ingress when fully submerged, except when under sufficient pressure to produce structural discontinuity. There are many types of containers, welded containers, hermetically sealed containers, filtered containers, etc.

  18. Point-Defect Mediated Bonding of Pt Clusters on (5,5) Carbon Nanotubes

    DEFF Research Database (Denmark)

    Wang, J. G.; Lv, Y. A.; Li, X. N.

    2009-01-01

    The adhesion of various sizes of Pt clusters on the metallic (5,5) carbon nanotubes (CNTs) with and without the point defect has been investigated by means of density functional theory (DFT). The calculations show that the binding energies of Pt-n (n = 1-6) clusters on the defect free CNTs are more......). The stronger orbital hybridization between the Pt atom and the carbon atom shows larger charge transfers on the defective CNTs than on the defect free CNTs, which allows the strong interaction between Pt clusters and CNTs. On the basis of DFT calculations, CNTs with point defect can be used as the catalyst...

  19. Sports engagement and age at first myocardial infarction in men under 55 years of age.

    Science.gov (United States)

    Janggen, Christoph; Gräni, Christoph; Brunner, Jonas; Trachsel, Lukas D; Windecker, Stephan; Eser, Prisca; Räber, Lorenz; Wilhelm, Matthias

    2017-01-01

    Low levels of physical activity in childhood are associated with clustering of cardiovascular risk factors (CVRF) as predisposition for atherosclerosis. We assessed the association between sports engagement and age at first myocardial infarction (MI) in a cohort of men under 55 years of age. The Bern percutaneous coronary intervention Registry (NCT 02241291) was analyzed from March 2009 until January 2012. Male patients with first MI, age 18 to 54 years and body mass index ≤25kg/m2 were included. Patients were stratified into two groups based on their starting age with organized sports ≥1 h/week outside school (EARLY: lifestyle and favorable CVRF profile.

  20. Synthesis of Racemic β-Chamigrene, a Spiro[5.5]undecane Sequiterpene

    Directory of Open Access Journals (Sweden)

    Simen Antonsen

    2014-12-01

    Full Text Available The present paper describes a total synthesis of racemic β-chamigrene (1, a sesquiterpene with a spiro[5.5]undecane carbon framework. Compared with previously reported β-chamigrene syntheses, we were able to reduce the total number of reaction steps, which also resulted in a significant improvement of the overall yield. The commercially available ketone 6-methylhept-5-en-2-one was transformed by known simple procedures into 3,3-dimethyl-2-methylenecyclohexanone. This reacted with isoprene by a Diels-Alder reaction to give a spiro ketone. An olefination reaction on this compound gave the target molecule.

  1. Probabilistic Robustness Analysis of Timber Structures—Results from EU COST Action E55:WG3

    DEFF Research Database (Denmark)

    Kirkegaard, Poul Henning; Sørensen, John Dalsgaard

    2011-01-01

    The present paper outlines results from Working Group 3 (WG3) in the EU COST Action E55—‘Modelling of the performance of timber structures’. The objectives of the project are related to the three main research activities: the identification and modelling of relevant load and environmental exposure...... scenarios, the improvement of knowledge concerning the behaviour of timber structural elements and the development of a generic framework for the assessment of the life-cycle vulnerability and robustness of timber structures....

  2. 26 CFR 55.4982-1 - Imposition of excise tax on undistributed income of regulated investment companies.

    Science.gov (United States)

    2010-04-01

    ... income of regulated investment companies. 55.4982-1 Section 55.4982-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS EXCISE TAXES (CONTINUED) EXCISE TAX ON REAL ESTATE INVESTMENT TRUSTS AND REGULATED INVESTMENT COMPANIES Excise Tax on Regulated Investment Companies...

  3. 50 CFR 23.55 - How may I use a CITES specimen after import into the United States?

    Science.gov (United States)

    2010-10-01

    ... import into the United States? 23.55 Section 23.55 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE... How may I use a CITES specimen after import into the United States? You may use CITES specimens after import into the United States for the following purposes: If the species is listed in Allowed use after...

  4. 41 CFR 102-72.55 - What are the requirements for obtaining a delegation of real property management and operation...

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the requirements for obtaining a delegation of real property management and operation authority from GSA? 102-72.55 Section 102-72.55 Public Contracts and Property Management Federal Property Management Regulations System...

  5. 20 CFR 404.1585 - Trial work period for persons age 55 or older who are blind.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Trial work period for persons age 55 or older... § 404.1585 Trial work period for persons age 55 or older who are blind. If you become eligible for... or older, you are entitled to a trial work period if— (a) You later return to substantial gainful...

  6. 9 CFR 55.8 - Official CWD tests and approval of laboratories to conduct official CWD tests.

    Science.gov (United States)

    2010-01-01

    ... Laboratories (NVSL); (2) The use of proteinase-resistant protein analysis methods including but not limited to... laboratories to conduct official CWD tests. 55.8 Section 55.8 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE COOPERATIVE CONTROL AND ERADICATION OF LIVESTOCK OR...

  7. 41 CFR 102-117.55 - What are the advantages and disadvantages of using a rate tender?

    Science.gov (United States)

    2010-07-01

    ... the advantages and disadvantages of using a rate tender? (a) Using a rate tender is an advantage when... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the advantages and disadvantages of using a rate tender? 102-117.55 Section 102-117.55 Public Contracts and Property...

  8. 29 CFR 570.55 - Occupations involved in the operation of power-driven woodworking machines (Order 5).

    Science.gov (United States)

    2010-07-01

    ... woodworking machines (Order 5). 570.55 Section 570.55 Labor Regulations Relating to Labor (Continued) WAGE AND... woodworking machines (Order 5). Link to an amendment published at 75 FR 28455, May 20, 2010. (a) Finding and... power-driven woodworking machines, including supervising or controlling the operation of such machines...

  9. 10 CFR 73.55 - Requirements for physical protection of licensed activities in nuclear power reactors against...

    Science.gov (United States)

    2010-01-01

    ... activities in nuclear power reactors against radiological sabotage. 73.55 Section 73.55 Energy NUCLEAR... power reactors against radiological sabotage. (a) Introduction. (1) By March 31, 2010, each nuclear... this section as applicable to operating nuclear power reactor facilities. (6) Applicants for an...

  10. 34 CFR 600.55 - Additional criteria for determining whether a foreign graduate medical school is eligible to...

    Science.gov (United States)

    2010-07-01

    ... training program for foreign medical students that has been approved by all medical licensing boards and... on the exams; or (ii) The school's clinical training program was approved by a State as of January 1... graduate medical school is eligible to apply to participate in the FFEL programs. 600.55 Section 600.55...

  11. Effects of Organized Physical Activity on Selected Health Indices among Women Older than 55 Years

    Directory of Open Access Journals (Sweden)

    Piotr Zmijewski

    2015-01-01

    Full Text Available The main aim of this study was to determine health benefits among women older than 55 years who participated in organized, group-based physical activity (OPA. Thirty-five women aged 65.0 ± 7.3 years volunteered for this study. The classical and nonclassical cardiovascular (CVD risk factors were measured before and after a 2-week OPA camp in a remote location and 3 months of OPA. Self-guided physical activity was analyzed 18 months after OPA. Two-week effects included significant decreases in body mass index, waist and hip circumferences, resting systolic and diastolic blood pressure (BP and resting heart rate, improved exercise capacity (EC, improved low-density lipoprotein and high-density lipoprotein (HDL-C, cholesterol, and other atherogenic lipid indices (ALI, and a reduction in 10-year estimated risk of death from CVD. Three-month effects included a further decrease in systolic BP, improvements in EC and HDL-C, and maintenance of lower levels of ALI, as well as lower CVD risk. The implementation of the OPA programme had a positive impact on somatic features, exercise capacity, biochemical indices, and risk for death from CVD. The presented programme can be regarded as an effective element of primary prevention of cardiovascular diseases among women older than 55 years.

  12. Occurrence of brain tumors in rhesus monkeys exposed to 55-MeV protons

    Science.gov (United States)

    Wood, D. H.; Yochmowitz, M. G.; Hardy, K. A.; Salmon, Y. L.

    Twenty-year observation of monkeys exposed to single doses of high energy protons simulating solar particles revealed that the most prevalent fatal cancers were brain tumors in the group of animals exposed to 55-MeV protons. Of 72 animals (50 males and 22 females) receiving 0.25 to 8.0 Gy total body surface dose, nine developed fatal tumors classified as grade IV astrocytoma or glioblastoma multiforme. The latent period for tumor development ranged from 14 months to 20 years, with a median of 5 years. Doses associated with the tumors were 4.0 to 8.0 Gy. Eight males and one female were affected. Depth-dose determinations suggest that the high incidence of cerebral neoplasia is associated with the Bragg Peak energy distribution of the 55-MeV protons. Comparison of the tumor incidence with that in humans with brain exposures incidental to radiotherapy indicates a high biological effectiveness compared with gamma radiation. Studies are in progress to attempt to replicate the results in rodents and establish a dose-response curve for proton-induced brain tumors.

  13. A Typology of Interprofessional Teamwork in Acute Geriatric Care: A Study in 55 units in Belgium.

    Science.gov (United States)

    Piers, Ruth D; Versluys, Karen J J; Devoghel, Johan; Lambrecht, Sophie; Vyt, André; Van Den Noortgate, Nele J

    2017-09-01

    To explore the quality of interprofessional teamwork in acute geriatric care and to build a model of team types. Cross-sectional multicenter study. Acute geriatric units in Belgium. Team members of different professional backgrounds. Perceptions of interprofessional teamwork among team members of 55 acute geriatric units in Belgium were measured using a survey covering collaborative practice and experience, managerial coaching and open team culture, shared reflection and decision-making, patient files facilitating teamwork, members' belief in the power of teamwork, and members' comfort in reporting incidents. Cluster analysis was used to determine types of interprofessional teamwork. Professions and clusters were compared using analysis of variance. The overall response rate was 60%. Of the 890 respondents, 71% were nursing professionals, 20% other allied health professionals, 5% physicians, and 4% logistic and administrative staff. More than 70% of respondents scored highly on interprofessional teamwork competencies, consultation, experiences, meetings, management, and results. Fewer than 55% scored highly on items about shared reflection and decision-making, reporting incidents from a colleague, and patient files facilitating interprofessional teamwork. Nurses in this study rated shared reflection and decision-making lower than physicians on the same acute geriatric units (P teamwork in acute geriatric units is satisfactory, but shared reflection and decision-making needs improvement. Four types of interprofessional teamwork are identified and can be used to benchmark the teamwork of individual teams. © 2017, Copyright the Authors Journal compilation © 2017, The American Geriatrics Society.

  14. Propionic acidemia: clinical course and outcome in 55 pediatric and adolescent patients

    Directory of Open Access Journals (Sweden)

    Grünert Sarah C

    2013-01-01

    Full Text Available Abstract Background Propionic acidemia is an inherited disorder caused by deficiency of propionyl-CoA carboxylase. Although it is one of the most frequent organic acidurias, information on the outcome of affected individuals is still limited. Study design/methods Clinical and outcome data of 55 patients with propionic acidemia from 16 European metabolic centers were evaluated retrospectively. 35 patients were diagnosed by selective metabolic screening while 20 patients were identified by newborn screening. Endocrine parameters and bone age were evaluated. In addition, IQ testing was performed and the patients’ and their families’ quality of life was assessed. Results The vast majority of patients (>85% presented with metabolic decompensation in the neonatal period. Asymptomatic individuals were the exception. About three quarters of the study population was mentally retarded, median IQ was 55. Apart from neurologic symptoms, complications comprised hematologic abnormalities, cardiac diseases, feeding problems and impaired growth. Most patients considered their quality of life high. However, according to the parents’ point of view psychic problems were four times more common in propionic acidemia patients than in healthy controls. Conclusion Our data show that the outcome of propionic acidemia is still unfavourable, in spite of improved clinical management. Many patients develop long-term complications affecting different organ systems. Impairment of neurocognitive development is of special concern. Nevertheless, self-assessment of quality of life of the patients and their parents yielded rather positive results.

  15. Propionic acidemia: clinical course and outcome in 55 pediatric and adolescent patients.

    Science.gov (United States)

    Grünert, Sarah C; Müllerleile, Stephanie; De Silva, Linda; Barth, Michael; Walter, Melanie; Walter, Kerstin; Meissner, Thomas; Lindner, Martin; Ensenauer, Regina; Santer, René; Bodamer, Olaf A; Baumgartner, Matthias R; Brunner-Krainz, Michaela; Karall, Daniela; Haase, Claudia; Knerr, Ina; Marquardt, Thorsten; Hennermann, Julia B; Steinfeld, Robert; Beblo, Skadi; Koch, Hans-Georg; Konstantopoulou, Vassiliki; Scholl-Bürgi, Sabine; van Teeffelen-Heithoff, Agnes; Suormala, Terttu; Sperl, Wolfgang; Kraus, Jan P; Superti-Furga, Andrea; Schwab, Karl Otfried; Sass, Jörn Oliver

    2013-01-10

    Propionic acidemia is an inherited disorder caused by deficiency of propionyl-CoA carboxylase. Although it is one of the most frequent organic acidurias, information on the outcome of affected individuals is still limited. Clinical and outcome data of 55 patients with propionic acidemia from 16 European metabolic centers were evaluated retrospectively. 35 patients were diagnosed by selective metabolic screening while 20 patients were identified by newborn screening. Endocrine parameters and bone age were evaluated. In addition, IQ testing was performed and the patients' and their families' quality of life was assessed. The vast majority of patients (>85%) presented with metabolic decompensation in the neonatal period. Asymptomatic individuals were the exception. About three quarters of the study population was mentally retarded, median IQ was 55. Apart from neurologic symptoms, complications comprised hematologic abnormalities, cardiac diseases, feeding problems and impaired growth. Most patients considered their quality of life high. However, according to the parents' point of view psychic problems were four times more common in propionic acidemia patients than in healthy controls. Our data show that the outcome of propionic acidemia is still unfavourable, in spite of improved clinical management. Many patients develop long-term complications affecting different organ systems. Impairment of neurocognitive development is of special concern. Nevertheless, self-assessment of quality of life of the patients and their parents yielded rather positive results.

  16. An ECMA-55 Minimal BASIC Compiler for x86-64 Linux®

    Directory of Open Access Journals (Sweden)

    John Gatewood Ham

    2014-10-01

    Full Text Available This paper describes a new non-optimizing compiler for the ECMA-55 Minimal BASIC language that generates x86-64 assembler code for use on the x86-64 Linux® [1] 3.x platform. The compiler was implemented in C99 and the generated assembly language is in the AT&T style and is for the GNU assembler. The generated code is stand-alone and does not require any shared libraries to run, since it makes system calls to the Linux® kernel directly. The floating point math uses the Single Instruction Multiple Data (SIMD instructions and the compiler fully implements all of the floating point exception handling required by the ECMA-55 standard. This compiler is designed to be small, simple, and easy to understand for people who want to study a compiler that actually implements full error checking on floating point on x86-64 CPUs even if those people have little programming experience. The generated assembly code is also designed to be simple to read.

  17. GROUND-BASED TRANSIT OBSERVATIONS OF THE SUPER-EARTH 55 Cnc e

    Energy Technology Data Exchange (ETDEWEB)

    De Mooij, E. J. W. [Astronomy and Astrophysics, University of Toronto, Toronto (Canada); López-Morales, M. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA (United States); Karjalainen, R.; Hrudkova, M. [Isaac Newton Group of Telescopes, La Palma (Spain); Jayawardhana, Ray, E-mail: demooij@astro.utoronto.ca [Physics and Astronomy, York University, Toronto (Canada)

    2014-12-20

    We report the first ground-based detections of the shallow transit of the super-Earth exoplanet 55 Cnc e using a 2 m class telescope. Using differential spectrophotometry, we observed one transit in 2013 and another in 2014, with average spectral resolutions of ∼700 and ∼250, spanning the Johnson BVR photometric bands. We find a white light planet-to-star radius ratio of 0.0190{sub −0.0027}{sup +0.0023} from the 2013 observations and 0.0200{sub −0.0018}{sup +0.0017} from the 2014 observations. The two data sets combined result in a radius ratio of 0.0198{sub −0.0014}{sup +0.0013}. These values are all in agreement with previous space-based results. Scintillation noise in the data prevents us from placing strong constraints on the presence of an extended hydrogen-rich atmosphere. Nevertheless, our detections of 55 Cnc e in transit demonstrate that moderate-sized telescopes on the ground will be capable of routine follow-up observations of super-Earth candidates discovered by the Transiting Exoplanet Survey Satellite around bright stars. We expect it also will be possible to place constraints on the atmospheric characteristics of those planets by devising observational strategies to minimize scintillation noise.

  18. Analysis of single-nucleotide polymorphisms of PEO1 gene in 55 ethnic groups of India

    Directory of Open Access Journals (Sweden)

    Ashok Singh

    2012-01-01

    Full Text Available Background: Progressive External Opthalmoplegia (PEO1 or Chromosome 10 open reading frame 2 gene (OMIM ID 606075 encodes Twinkle protein, a phage T7 gene 4-like hexameric helicase, and is associated with mitochondrial DNA (mtDNA deletions and neuromuscular disease called autosomal dominant PEO (adPEO. Twinkle has also been known to play an important role in the stability and maintenance of the mtDNA. Aims: In this study as an effort of Indian Genome Variation Consortium, we screened the SNPs of PEO1 gene such as rs7184, rs1535349, rs2863095, rs3740484, rs3740488, rs3740489, rs4919511, rs17113613, rs3824783, rs3740485, rs3740486, and rs3740487 in discovery panel (a population set of 40 DNA samples, and four synonymous SNPs, namely rs3824783 (ancestral allele=A, rs3740485 (ancestral allele=T, rs3740486 (ancestral allele=C, and rs3740487 (ancestral allele=A in a large validation panel composed of 55 Indian subpopulations. Materials and Methods: In present study, a total of 55 Indian subpopulations were identified and collected for validation panel to check the frequencies of SNPs in PEO1 gene. Results and Conclusion: The allelic and genotype frequencies are found to be variable among different ethnic groups of India.

  19. A PSMA Ligand Labeled with Cobalt-55 for PET Imaging of Prostate Cancer

    DEFF Research Database (Denmark)

    Dam, Johan Hygum; Olsen, Birgitte Brinkmann; Baun, Christina

    2017-01-01

    PURPOSE: Prostate-specific membrane antigen (PSMA) comprises a recognized target for molecular imaging of prostate cancer. As such, radiolabeled PSMA inhibitors are of great value for diagnosis and staging of this disease. Herein, we disclose the preclinical characterization of [(55)Co]PSMA-617...... for positron emission tomography (PET)/x-ray computed tomography (CT) imaging of prostate cancer lesions. PROCEDURES: By the application of microwave heating, PSMA-617 in acetate buffer (0.4 M, pH 4.4) was labeled with the radioisotopes cobalt-55/57. The extents of internalization and dissociation constants (K...... to the biodistribution in LNCaP xenograft mice, [(57)Co]PSMA-617 displayed a high and relatively constant uptake in the tumor (12.9 %IA/g at 1 h to 10.5 %IA/g at 24 h) with an initial but transient high uptake in the kidneys, adrenals, and spleen. Tumor-to-background ratios improved over time as normal tissue cleared...

  20. A PSMA Ligand Labeled with Cobalt-55 for PET Imaging of Prostate Cancer

    DEFF Research Database (Denmark)

    Dam, Johan Hygum; Olsen, Birgitte Brinkmann; Baun, Christina

    2017-01-01

    PURPOSE: Prostate-specific membrane antigen (PSMA) comprises a recognized target for molecular imaging of prostate cancer. As such, radiolabeled PSMA inhibitors are of great value for diagnosis and staging of this disease. Herein, we disclose the preclinical characterization of [(55)Co]PSMA-617...... for positron emission tomography (PET)/x-ray computed tomography (CT) imaging of prostate cancer lesions. PROCEDURES: By the application of microwave heating, PSMA-617 in acetate buffer (0.4 M, pH 4.4) was labeled with the radioisotopes cobalt-55/57. The extents of internalization and dissociation constants (K......-specific activities were 18.2 MBq/nmol and 3.3 MBq/nmol. The cellular K D were determined to be 4.7 nM for LNCaP and 9.8 nM for PC3-PIP, correspondingly. Internalization of 76 and 71 % of the cell-associated radioactivity was found for LNCaP and PC3-PIP cells after incubation up to 240 min, respectively. In regard...

  1. Design of a silicon RCE Schottky photodetector working at 1.55 {mu}m

    Energy Technology Data Exchange (ETDEWEB)

    Casalino, M. [Istituto per la Microelettronica e Microsistemi (IMM), Consiglio Nazionale delle Ricerche, Via P. Castellino, 80131 Naples (Italy); Universita degli studi ' Mediterranea' di Reggio Calabria, Localita Feo di Vito, 89060 Reggio Calabria (Italy); Sirleto, L. [Istituto per la Microelettronica e Microsistemi (IMM), Consiglio Nazionale delle Ricerche, Via P. Castellino, 80131 Naples (Italy)]. E-mail: luigi.sirleto@imm.cnr.it; Moretti, L. [Universita degli studi ' Mediterranea' di Reggio Calabria, Localita Feo di Vito, 89060 Reggio Calabria (Italy); Della Corte, F. [Universita degli studi ' Mediterranea' di Reggio Calabria, Localita Feo di Vito, 89060 Reggio Calabria (Italy); Rendina, I. [Istituto per la Microelettronica e Microsistemi (IMM), Consiglio Nazionale delle Ricerche, Via P. Castellino, 80131 Naples (Italy)

    2006-12-15

    In this paper, the design of a resonant cavity-enhanced (RCE) Schottky photodetector, based on internal photoemission effect and working at 1.55 {mu}m, is presented. In order to estimate the theoretical quantum efficiency we take the advantage of analytical formulation of the internal photoemission effect (Fowler theory), and its extension for thin films, while for the optical analysis of device a numerical method, based on the transfer matrix method, has been implemented. Finally, we complete our design calculating bandwidth and bandwidth-efficiency product. Our numerical results prove that a quantum efficiency of 0.1% is obtained at resonant wavelength (1.55 {mu}m) with a very thin absorbing metal layer (30 nm). Theoretical values of 100 GHz and 100 MHz were obtained, respectively, for the carrier-transit time limited 3-dB bandwidth and bandwidth-efficiency. The proposed photodetector can work at room temperature and its fabrication is completely compatible with standard silicon technology.

  2. Linking the Climate and Thermal Phase Curve of 55 Cancri e

    Science.gov (United States)

    Hammond, Mark; Pierrehumbert, Raymond T.

    2017-11-01

    The thermal phase curve of 55 Cancri e is the first measurement of the temperature distribution of a tidally locked super-Earth, but raises a number of puzzling questions about the planet’s climate. The phase curve has a high amplitude and peak offset, suggesting that it has a significant eastward hot-spot shift as well as a large day–night temperature contrast. We use a general circulation model to model potential climates, and investigate the relation between bulk atmospheric composition and the magnitude of these seemingly contradictory features. We confirm theoretical models of tidally locked circulation are consistent with our numerical model of 55 Cnc e, and rule out certain atmospheric compositions based on their thermodynamic properties. Our best-fitting atmosphere has a significant hot-spot shift and day–night contrast, although these are not as large as the observed phase curve. We discuss possible physical processes that could explain the observations, and show that night-side cloud formation from species such as SiO from a day-side magma ocean could potentially increase the phase curve amplitude and explain the observations. We conclude that the observations could be explained by an optically thick atmosphere with a low mean molecular weight, a surface pressure of several bars, and a strong eastward circulation, with night-side cloud formation a possible explanation for the difference between our model and the observations.

  3. Determination of 63Ni and 55Fe in nuclear waste samples using radiochemical separation and liquid scintillation counting

    DEFF Research Database (Denmark)

    Hou, Xiaolin; Frøsig Østergaard, L.; Nielsen, S.P.

    2005-01-01

    An analytical method for the determination of Ni-63 and Fe-55 in nuclear waste samples such as graphite, heavy concrete, aluminium and lead was developed. Different decomposition methods (i.e. ashing, acid digestion and alkali fusion) were investigated for the decomposition of the samples...... and for the separation of Fe and Ni from the matrix. Hydroxide precipitation was used to separate Fe-55 and Ni-63 from the matrix elements and ion exchange chromatography was used to separate Fe-55 and Ni-63 from the interfering radionuclides as well as from each other. The separated Ni-63 was further purified...... by extraction chromatography. The purified Ni-63 and Fe-55 was then measured by liquid scintillation counting. The chemical yields of the separation procedures for Fe-55 and Ni-63 are above 90% and the decontamination factors for all interfering radionuclides are more than 10(5). The detection limits...

  4. Determining the DUF55-domain structure of human thymocyte nuclear protein 1 from crystals partially twinned by tetartohedry

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Feng; Song, Aixin; Xu, Chunyan; Sun, Lihua; Li, Jian; Tang, Lin; Yu, Minmin; Yeates, Todd O.; Hu, Hongyu; He, Jianhua

    2009-06-06

    Human thymocyte nuclear protein 1 (hTHYN1) contains a unique DUF55 domain of 167 residues (55-221), but its cellular function is unclear. Crystals of DUF55 belong to the trigonal space group P3{sub 1}, but twinning causes the data to approach an apparent 622 symmetry. Two datasets to 2.3 {angstrom} resolution were collected. Statistical analysis confirmed that both datasets were partially twinned by tetartohedry. Tetartohedral twin fractions were estimated. After the structure was determined, only one twofold axis of rotational pseudosymmetry was found in the crystal structure. Using the DALI program, a YTH domain, which is a potential RNA binding domain from human YTH domain-containing protein 2, was identified to have the most similar three-dimensional fold to DUF55. It is implied that DUF55 might be a potential RNA-related domain.

  5. Immunohistochemical Expression and Prognostic Value of CD97 and Its Ligand CD55 in Primary Gallbladder Carcinoma

    Directory of Open Access Journals (Sweden)

    Jinsheng Wu

    2012-01-01

    Full Text Available Background. CD97 as a member of the EGF-TM7 family with adhesive properties plays an important role in tumor aggressiveness by binding its cellular ligand CD55, which is a complement regulatory protein expressed by cells to protect them from bystander complement attack. Previous studies have shown that CD97 and CD55 both play important roles in tumor dedifferentiation, migration, invasiveness, and metastasis. The aim of this study was to investigate CD97 and CD55 expression in primary gallbladder carcinoma (GBC and their prognostic significance. Methods. Immunohistochemistry was used to investigate the expression of CD97 and CD55 proteins in 138 patients with GBC. Results. CD97 and CD55 were absent or only weakly expressed in the normal epithelium of the gallbladder but in 69.6% (96/138 and 65.2% (90/138 of GBC, respectively, remarkably at the invasive front of the tumors. In addition, CD97 and CD55 expressions were both significantly associated with high histologic grade (both =0.009, advanced pathologic T stage (=0.01 and 0.009, resp. and clinical stage (both =0.009, and positive venous/lymphatic invasion (both =0.009. Multivariate analyses showed that CD97 (hazard ratio, 3.236; =0.02 and CD55 (hazard ratio, 3.209; =0.02 expressions and clinical stage (hazard ratio, 3.918; =0.01 were independent risk factor for overall survival. Conclusion. Our results provide convincing evidence for the first time that the expressions of CD97 and CD55 are both upregulated in human GBC. The expression levels of CD97 and CD55 in GBC were associated with the severity of the tumor. Furthermore, CD97 and CD55 expressions were independent poor prognostic factors for overall survival in patients with GBC.

  6. D120 and K152 within the PH Domain of T Cell Adapter SKAP55 Regulate Plasma Membrane Targeting of SKAP55 and LFA-1 Affinity Modulation in Human T Lymphocytes.

    Science.gov (United States)

    Witte, Amelie; Meineke, Bernhard; Sticht, Jana; Philipsen, Lars; Kuropka, Benno; Müller, Andreas J; Freund, Christian; Schraven, Burkhart; Kliche, Stefanie

    2017-04-01

    The β2-integrin lymphocyte function-associated antigen 1 (LFA-1) is needed for the T cell receptor (TCR)-induced activation of LFA-1 to promote T cell adhesion and interaction with antigen-presenting cells (APCs). LFA-1-mediated cell-cell interactions are critical for proper T cell differentiation and proliferation. The Src kinase-associated phosphoprotein of 55 kDa (SKAP55) is a key regulator of TCR-mediated LFA-1 signaling (inside-out/outside-in signaling). To gain an understanding of how SKAP55 controls TCR-mediated LFA-1 activation, we assessed the functional role of its pleckstrin homology (PH) domain. We identified two critical amino acid residues within the PH domain of SKAP55, aspartic acid 120 (D120) and lysine 152 (K152). D120 facilitates the retention of SKAP55 in the cytoplasm of nonstimulated T cells, while K152 promotes SKAP55 membrane recruitment via actin binding upon TCR triggering. Importantly, the K152-dependent interaction of the PH domain with actin promotes the binding of talin to LFA-1, thus facilitating LFA-1 activation. These data suggest that K152 and D120 within the PH domain of SKAP55 regulate plasma membrane targeting and TCR-mediated activation of LFA-1. Copyright © 2017 American Society for Microbiology.

  7. Identification of the adenovirus E4orf4 protein binding site on the B55α and Cdc55 regulatory subunits of PP2A: Implications for PP2A function, tumor cell killing and viral replication.

    Directory of Open Access Journals (Sweden)

    Melissa Z Mui

    Full Text Available Adenovirus E4orf4 protein induces the death of human cancer cells and Saccharomyces cerevisiae. Binding of E4orf4 to the B/B55/Cdc55 regulatory subunit of protein phosphatase 2A (PP2A is required, and such binding inhibits PP2A(B55 activity leading to dose-dependent cell death. We found that E4orf4 binds across the putative substrate binding groove predicted from the crystal structure of B55α such that the substrate p107 can no longer interact with PP2A(B55α. We propose that E4orf4 inhibits PP2A(B55 activity by preventing access of substrates and that at high E4orf4 levels this inhibition results in cell death through the failure to dephosphorylate substrates required for cell cycle progression. However, E4orf4 is expressed at much lower and less toxic levels during a normal adenovirus infection. We suggest that in this context E4orf4 largely serves to recruit novel substrates such as ASF/SF2/SRSF1 to PP2A(B55 to enhance adenovirus replication. Thus E4orf4 toxicity probably represents an artifact of overexpression and does not reflect the evolutionary function of this viral product.

  8. [Immunogenicity and safety of the influenza vaccine, in a population older than 55-years in Mexico].

    Science.gov (United States)

    Ayala-Montiel, Octavio; Mascareñas, César; García-Hernández, Delfino; Rendón-Muñiz, Jorge; López, Irma; Felipe Montaño, Luis; Zenteno, I; Franco-Paredes, C

    2005-01-01

    To confirm the immunogenicity and tolerance of the inactivated, fractionated, and purified influenza vaccine, in a Mexican adult population aged 55 and older, medically served at a Petróleos Mexicanos Hospital (Pemex, Mexican Oil Company). The study was conducted between November and December, 2000, among ninety adult subjects aged 55 years and older who were seen at the Hospital Central Sur Pemex. The primary endpoints regarding immunogenicity were the percentage of individuals with protective antibodies targeting hemagglutinins higher than or equal to 1:40, and the percentage of subjects who seroconverted as measured by a four-fold increase in protective antibody production. Secondary endpoints included the frequency of local and systemic reactions to the vaccine. An additional criterion that was evaluated included antigen-antibody affinity assays to measure the polyclonal antibody response to the vaccine and the specific generation of high-affinity antibodies to viral proteins, before and after vaccination. The antibody protection rate was 95.6% against the HINI strain, 98.9% against the H3N2 strain, and a 100% against the B/Yamanashi strain. Seroconversion to the HINI strain was elicited in 74.4% of subjects, to the H3N2 strain in 88.9%, and to the B/Yamanashi strain in 82.2%. Eighteen (20%) subjects developed local reactions; 17 (18.8%) developed a systemic reaction post vaccination at day 5 and nine subjects (10%) at day 28. Local reactions consisted of pain in 10 (11.1%) subjects, redness in 8 (8.8%), and induration in 6 (6.6%). General malaise, headache, and fever were identified in 10, 8.8, and 0% of subjects, respectively, at day 5, and in 4.4, 6.6, and 0%, respectively, at day 28. Influenza vaccine was highly immunogenic in a healthy Mexican adult population aged 55 years and older. The generation of high-affinity antibodies to the virus after vaccination was also demonstrated. Local and systemic adverse reactions to the vaccine identified in our study

  9. Definitive hypofractionated radiotherapy for early glottic carcinoma: experience of 55Gy in 20 fractions.

    Science.gov (United States)

    Ermiş, Ekin; Teo, Mark; Dyker, Karen E; Fosker, Chris; Sen, Mehmet; Prestwich, Robin Jd

    2015-09-23

    A wide variety of fractionation schedules have been employed for the treatment of early glottic cancer. The aim is to report our 10-year experience of using hypofractionated radiotherapy with 55Gy in 20 fractions at 2.75Gy per fraction. Patients treated between 2004 and 2013 with definitive radiotherapy to a dose of 55Gy in 20 fractions over 4 weeks for T1/2 N0 squamous cell carcinoma of the glottis were retrospectively identified. Patients with prior therapeutic minor surgery (eg. laser stripping, cordotomy) were included. The probabilities of local control, ultimate local control (including salvage surgery), regional control, cause specific survival (CSS) and overall survival (OS) were calculated. One hundred thirty-two patients were identified. Median age was 65 years (range 33-89). Median follow up was 72 months (range 7-124). 50 (38 %), 18 (14 %) and 64 (48 %) of patients had T1a, T1b and T2 disease respectively. Five year local control and ultimate local control rates were: overall - 85.6 % and 97.3 % respectively, T1a - 91.8 % and 100 %, T1b - 81.6 and 93.8 %, and T2 - 80.9 % and 95.8 %. Five year regional control, CSS and OS rates were 95.4 %, 95.7 % and 78.8 % respectively. There were no significant associations of covariates (e.g. T-stage, extent of laryngeal extension, histological grade) with local control on univariate analysis. Only increasing age and transglottic extension in T2 disease were significantly associated with overall survival (both p cancers developed in 17 % of patients. 13 (9.8 %) of patients required enteral tube feeding support during radiotherapy; no patients required long term enteral nutrition. One patient required a tracheostomy due to a non-functioning larynx on long term follow up. Hypofractionated radiation therapy with a dose of 55Gy in 20 fractions for early stage glottic cancer provides high rates of local control with acceptable toxicity.

  10. Chlamydiae has contributed at least 55 genes to Plantae with predominantly plastid functions.

    Directory of Open Access Journals (Sweden)

    Ahmed Moustafa

    2008-05-01

    Full Text Available The photosynthetic organelle (plastid originated via primary endosymbiosis in which a phagotrophic protist captured and harnessed a cyanobacterium. The plastid was inherited by the common ancestor of the red, green (including land plants, and glaucophyte algae (together, the Plantae. Despite the critical importance of primary plastid endosymbiosis, its ancient derivation has left behind very few "footprints" of early key events in organelle genesis.To gain insights into this process, we conducted an in-depth phylogenomic analysis of genomic data (nuclear proteins from 17 Plantae species to identify genes of a surprising provenance in these taxa, Chlamydiae bacteria. Previous studies show that Chlamydiae contributed many genes (at least 21 in one study to Plantae that primarily have plastid functions and were postulated to have played a fundamental role in organelle evolution. Using our comprehensive approach, we identify at least 55 Chlamydiae-derived genes in algae and plants, of which 67% (37/55 are putatively plastid targeted and at least 3 have mitochondrial functions. The remainder of the proteins does not contain a bioinformatically predicted organelle import signal although one has an N-terminal extension in comparison to the Chlamydiae homolog. Our data suggest that environmental Chlamydiae were significant contributors to early Plantae genomes that extend beyond plastid metabolism. The chlamydial gene distribution and protein tree topologies provide evidence for both endosymbiotic gene transfer and a horizontal gene transfer ratchet driven by recurrent endoparasitism as explanations for gene origin.Our findings paint a more complex picture of gene origin than can easily be explained by endosymbiotic gene transfer from an organelle-like point source. These data significantly extend the genomic impact of Chlamydiae on Plantae and show that about one-half (30/55 of the transferred genes are most closely related to sequences emanating from

  11. Preliminary Analysis of Stress in the Newberry EGS Well NWG 55-29

    Energy Technology Data Exchange (ETDEWEB)

    Davatzes, Nicholas C. [Temple Univ., Philadelphia, PA (United States); Hickman, Stephen H. [U.S. Geological Survey, Menlo Park, CA (United States)

    2011-10-23

    As part of the planning for stimulation of the Newberry Volcano Enhanced Geothermal Systems (EGS) Demonstration project in Oregon, a high-resolution borehole televiewer (BHTV) log was acquired using the ALT ABI85 BHTV tool in the slightly deviated NWG 55-29 well. The image log reveals an extensive network of fractures in a conjugate set striking approximately N-S and dipping 50° that are well oriented for normal slip and are consistent with surface-breaking regional normal faults in the vicinity. Similarly, breakouts indicate a consistent minimum horizontal stress, Shmin, azimuth of 092.3±17.3°. In conjunction with a suite of geophysical logs, a model of the stress magnitudes constrained by the width of breakouts at depth and a model of rock strength independently indicates a predominantly normal faulting stress regime.

  12. Frequency and factors associated with falls in adults aged 55 years or more.

    Science.gov (United States)

    Prato, Sabrina Canhada Ferrari; Andrade, Selma Maffei de; Cabrera, Marcos Aparecido Sarria; Dip, Renata Maciulis; Santos, Hellen Geremias Dos; Dellaroza, Mara Solange Gomes; Mesas, Arthur Eumann

    2017-04-27

    The objective of this study is to analyze the frequency and factors associated with falls in adults aged 55 years or more. This is a study inserted into another population-based study with representative sample of persons aged 40 years or more of the urban area in a medium-sized municipality of the State of Paraná, Brazil, in 2011. That study obtained demographic and socioeconomic data and characteristics related to life habits, health conditions, and functional capacity (n = 1,180). In 2012, we selected all persons aged 55 years or more (n = 501). We have estimated grip strength and the occurrence of a fall since the last interview in 80.6% of the adults. The crude and adjusted odds ratios (OR) have been calculated by logistic regression according to a hierarchical model. The rate of fall was 24.3%. After adjustments, we could observe higher chances of falls among women (OR = 3.10; 95%CI 1.79-5.38), among persons aged 65 years or more (OR = 2.39; 95%CI 1.45-3.95), with poor sleep quality (OR = 1.78; 95%CI 1.08-2.93), and with low grip strength (OR = 2.31; 95%CI 1.34-3.97). Poor sleep quality and low muscle strength can be indicators of increased risk of falls and need assessments and interventions aimed at preventing them. Analisar a frequência e fatores associados à ocorrência de quedas em adultos de 55 anos ou mais. Estudo inserido em outro de base populacional com amostra representativa de pessoas com 40 anos ou mais da área urbana de município de médio porte do Paraná em 2011. Foram obtidos dados demográficos e socioeconômicos, características referentes aos hábitos de vida, às condições de saúde e à capacidade funcional (n = 1.180). Em 2012, selecionaram-se todas as pessoas com idade igual ou superior a 55 anos (n = 501). Foram estimadas a força de preensão palmar e a ocorrência de queda desde a última entrevista em 80,6% delas. Foram calculadas odds ratios (OR) brutas e ajustadas por regressão logística segundo modelo hierarquizado. A

  13. Scrapie prion liposomes and rods exhibit target sizes of 55,000 Da

    Energy Technology Data Exchange (ETDEWEB)

    Bellinger-Kawahara, C.G.; Kempner, E.; Groth, D.; Gabizon, R.; Prusiner, S.B.

    1988-06-01

    Scrapie is a degenerative neurologic disease in sheep and goats which can be experimentally transmitted to laboratory rodents. Considerable evidence suggests that the scrapie agent is composed largely, if not entirely, of an abnormal isoform of the prion protein (PrPSc). Inactivation of scrapie prions by ionizing radiation exhibited single-hit kinetics and gave a target size of 55,000 +/- 9000 mol wt. The inactivation profile was independent of the form of the prion. Scrapie agent infectivity in brain homogenates, microsomal fractions, detergent-extracted microsomes, purified amyloid rods, and liposomes exhibited the same inactivation profile. Our data are consistent with the hypothesis that the infectious particle causing scrapie contains approximately 2 PrPSc molecules.

  14. Claustrophobia during magnetic resonance imaging: cohort study in over 55,000 patients.

    Science.gov (United States)

    Dewey, Marc; Schink, Tania; Dewey, Charles F

    2007-11-01

    To evaluate whether MR scanners with acoustic noise reduction and a short magnetic bore reduce the rate of claustrophobic reactions. We performed a cohort study in an outpatient setting, enrolling a total of 55,734 consecutive patients referred for MRI of any part of the body based on a clinical indication. Imaging was performed using a conventional MR scanner (42,998 patients) and a recently developed MR scanner (12,736 patients) with 97% acoustic noise reduction and a short bore. Multiple logistic regression analysis was used to adjust for the nonrandomized design. In addition to those undergoing head-first examinations, female and middle-aged patients were significantly more likely to develop claustrophobia in the logistic regression analysis (P claustrophobia may be reduced by a factor of 3 when recently-developed MR scanners are used.

  15. A 3.55 keV hint for decaying axion-like particle dark matter

    Energy Technology Data Exchange (ETDEWEB)

    Jaeckel, Joerg [Heidelberg Univ. (Germany). Inst. fuer Theoretische Physik; Redondo, Javier [Muenchen Univ. (Germany). Arnold Sommerfeld Center; Max-Planck-Institut fuer Physik, Muenchen (Germany); Ringwald, Andreas [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

    2014-02-15

    Recently, indications for an emission line at 3.55 keV have been found in the combined spectra of a large number of galaxy clusters and also in Andromeda. This line could not be identified with any known spectral line. It is tempting to speculate that it has its origin in the decay of a particle contributing all or part of the dark matter. In this note we want to point out that axion-like particles being all or part of the dark matter are an ideal candidate to produce such a feature. More importantly the parameter values necessary are quite feasible in extensions of the Standard Model based on string theory and could be linked up to a variety of other intriguing phenomena, which also potentially allow for new tests of this speculation.

  16. Failure prediction of ±55° glass/epoxy composite pipes using system identification modelling

    Science.gov (United States)

    Yi, A. J.; Majid, M. S. A.; Nor, A. M.; Ridzuan, M. J. M.; Yaacob, S.

    2017-10-01

    Black-box modelling using system identification method to predict the performance of glass fibre reinforced epoxy (GRE) composite pipe under multiaxial loading stress ratio is presented. In this study, both linear and nonlinear models were derived namely; linear time-invariant parametric model and artificial neural network model. The models derived are to approximate the pure hydrostatic loading performance using GRE pipes with winding angles of ±55°. Three different linear model structures were derived, and the best fit model achieved at 96.64% of best fit. On the other hand, the Artificial Neural Network (ANN) modelling showed better accuracy with the best fit of 99.82%. Finally, the point of failure at which first damage takes place predicted by the models derived was validated using experimental data.

  17. An overview of the TA-55, Building PF-4 ventilation system

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-02-22

    An overview of the TA-55, Building PF-4 ventilation system is provided in the following sections. Included are descriptions of the zone configurations, equipment-performance criteria, ventilation support systems, and the ventilation-system evaluation criteria. Section 4.2.1.1 provides a brief discussion of the ventilation system function. Section 4.2.1.2 provides details on the overall system configuration. Details of system interfaces and support systems are provided in Section 4.2.1.3. Section 4.2.1.4 describes instrumentation and control needed to operate the ventilation system. Finally, Sections 4.2.1.5 and 4.2.1.6 describe system surveillance/maintenance and Technical Safety Requirements (TSR) Limitations, respectively. Note that the numerical parameters included in this description are considered nominal; set points and other specifications actually fall within operational bands.

  18. A Compact 5.5 GHz Band-Rejected UWB Antenna Using Complementary Split Ring Resonators

    Directory of Open Access Journals (Sweden)

    M. M. Islam

    2014-01-01

    Full Text Available A band-removal property employing microwave frequencies using complementary split ring resonators (CSRRs is applied to design a compact UWB antenna wishing for the rejection of some frequency band, which is meanwhile exercised by the existing wireless applications. The reported antenna comprises optimization of a circular radiating patch, in which slotted complementary SRRs are implanted. It is printed on low dielectric FR4 substrate material fed by a partial ground plane and a microstrip line. Validated results exhibit that the reported antenna shows a wide bandwidth covering from 3.45 to more than 12 GHz, with a compact dimension of 22 × 26 mm2, and VSWR < 2, observing band elimination of 5.5 GHz WLAN band.

  19. A compact 5.5 GHz band-rejected UWB antenna using complementary split ring resonators.

    Science.gov (United States)

    Islam, M M; Faruque, M R I; Islam, M T

    2014-01-01

    A band-removal property employing microwave frequencies using complementary split ring resonators (CSRRs) is applied to design a compact UWB antenna wishing for the rejection of some frequency band, which is meanwhile exercised by the existing wireless applications. The reported antenna comprises optimization of a circular radiating patch, in which slotted complementary SRRs are implanted. It is printed on low dielectric FR4 substrate material fed by a partial ground plane and a microstrip line. Validated results exhibit that the reported antenna shows a wide bandwidth covering from 3.45 to more than 12 GHz, with a compact dimension of 22 × 26 mm(2), and VSWR < 2, observing band elimination of 5.5 GHz WLAN band.

  20. Minus 55 to plus 200 deg C 12 bit analog-to-digital converter

    Science.gov (United States)

    Smith, L. R.; Prazak, P. R.

    1981-01-01

    A 12 bit successive approximation analog to digital converter that offers moderately high speed precision data conversion at a reasonable level of cost and complexity is studied. The ADCH10HT extends this capability over a temperature range of -55 to +200 C. No missing-code performance is maintained over the entire temperature range. The converter is completely self-contained with internal clock and +10 volt reference. The CMOS devices offer low power dissipation, so that the internal temperature of the hybrid circuit does not rise as much from self heating. In CMOS circuits, pn junction leakage currents are returned to the supplies so that the logic keeps working at temperatures up to 250 C.

  1. Arbitrary birefringent metamaterials for holographic optics at λ = 1.55 μm.

    Science.gov (United States)

    Tsai, Yu-Ju; Larouche, Stéphane; Tyler, Talmage; Llopis, Antonio; Royal, Matthew; Jokerst, Nan M; Smith, David R

    2013-11-04

    This paper presents an optical element capable of multiplexing two diffraction patterns for two orthogonal linear polarizations, based on the use of non-resonant metamaterial cross elements. The metamaterial cross elements provide unique building blocks for engineering arbitrary birefringence. As a proof-of-concept demonstration, we present the design and experimental characterization of a polarization multiplexed blazed diffraction grating and a polarization multiplexed computer-generated hologram, for the telecommunication wavelength of λ = 1.55 μm. A quantitative study of the polarization multiplexed grating reveals that this approach yields a very large polarization contrast ratio. The results show that metamaterials can form the basis for a versatile and compact platform useful in the design of multi-functional photonic devices.

  2. Adiabatic measurements of magneto-caloric effects in pulsed high magnetic fields up to 55 T

    Science.gov (United States)

    Kihara, T.; Kohama, Y.; Hashimoto, Y.; Katsumoto, S.; Tokunaga, M.

    2013-07-01

    Magneto-caloric effects (MCEs) measurement system in adiabatic condition is proposed to investigate the thermodynamic properties in pulsed magnetic fields up to 55 T. With taking the advantage of the fast field-sweep rate in pulsed field, adiabatic measurements of MCEs were carried out at various temperatures. To obtain the prompt response of the thermometer in the pulsed field, a thin film thermometer is grown directly on the sample surfaces. The validity of the present setup was demonstrated in the wide temperature range through the measurements on Gd at about room temperature and on Gd3Ga5O12 at low temperatures. The both results show reasonable agreement with the data reported earlier. By comparing the MCE data with the specific heat data, we could estimate the entropy as functions of magnetic field and temperature. The results demonstrate the possibility that our approach can trace the change in transition temperature caused by the external field.

  3. Solvent hold tank sample results for MCU-16-53-55. January 2016 Monthly sample

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F. F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-03-28

    Savannah River National Laboratory (SRNL) received one set of Solvent Hold Tank (SHT) samples (MCU-16-53-54-55), pulled on 01/25/2016 for analysis. The samples were combined and analyzed for composition. Analysis of the composite sample MCU-16-53-54-55 indicated the Isopar™L, and MaxCalix are at nominal levels. The modifier and TiDG concentrations are 3% and 23 % below their nominal concentrations. This analysis confirms the addition of TiDG, MaxCalix, and modifier to the solvent on November 28, 2015. Based on the current monthly sample, the levels of TiDG, Isopar™L, MaxCalix, and modifier are sufficient for continuing operation but are expected to decrease with time. Periodic characterization and trimming additions to the solvent are recommended. No impurities above the 1000 ppm level were found in this solvent by the Semi-Volatile Organic Analysis (SVOA). No impurities were observed in the Hydrogen Nuclear Magnetic Resonance (HNMR). However, the Fourier transform infra-red spectroscopy (FTIR) method detected trace levels (a few ppm) of amides (a possible degradation product of TiDG). In addition, up to 21 ± 4 micrograms of mercury per gram of solvent (or 17.5 μg/mL) was detected in this sample. There appears to be a possible correlation between the mercury level and the TiDG concentration in the solvent. The current gamma level (9.16 E4 dpm/mL) confirmed that the gamma concentration has returned to previous level where the process operated normally and as expected. The laboratory will continue to monitor the quality of the solvent in particular for any new impurities or degradation of the solvent components.

  4. Frequency and factors associated with falls in adults aged 55 years or more

    Directory of Open Access Journals (Sweden)

    Sabrina Canhada Ferrari Prato

    Full Text Available ABSTRACT OBJECTIVE The objective of this study is to analyze the frequency and factors associated with falls in adults aged 55 years or more. METHODS This is a study inserted into another population-based study with representative sample of persons aged 40 years or more of the urban area in a medium-sized municipality of the State of Paraná, Brazil, in 2011. That study obtained demographic and socioeconomic data and characteristics related to life habits, health conditions, and functional capacity (n = 1,180. In 2012, we selected all persons aged 55 years or more (n = 501. We have estimated grip strength and the occurrence of a fall since the last interview in 80.6% of the adults. The crude and adjusted odds ratios (OR have been calculated by logistic regression according to a hierarchical model. RESULTS The rate of fall was 24.3%. After adjustments, we could observe higher chances of falls among women (OR = 3.10; 95%CI 1.79–5.38, among persons aged 65 years or more (OR = 2.39; 95%CI 1.45–3.95, with poor sleep quality (OR = 1.78; 95%CI 1.08–2.93, and with low grip strength (OR = 2.31; 95%CI 1.34–3.97. CONCLUSIONS Poor sleep quality and low muscle strength can be indicators of increased risk of falls and need assessments and interventions aimed at preventing them.

  5. Biochemical characterization of an α1,2-colitosyltransferase from Escherichia coli O55:H7.

    Science.gov (United States)

    Wu, Zhigang; Zhao, Guohui; Li, Tiehai; Qu, Jingyao; Guan, Wanyi; Wang, Jiajia; Ma, Cheng; Li, Xu; Zhao, Wei; Wang, Peng G; Li, Lei

    2016-05-01

    Colitose, also known as 3,6-dideoxy-L-galactose or 3-deoxy-L-fucose, is one of only five naturally occurring 3,6-dideoxyhexoses. Colitose was found in lipopolysaccharide of a number of infectious bacteria, including Escherichia coli O55 & O111 and Vibrio cholera O22 & O139. To date, no colitosyltransferase (ColT) has been characterized, probably due to the inaccessibility of the sugar donor, GDP-colitose. In this study, starting with chemically prepared colitose, 94.6 mg of GDP-colitose was prepared via a facile and efficient one-pot two-enzyme system involving an L-fucokinase/GDP-L-Fuc pyrophosphorylase and an inorganic pyrophosphatase (EcPpA). WbgN, a putative ColT from E. coliO55:H5 was then cloned, overexpressed, purified and biochemically characterized by using GDP-colitose as a sugar donor. Activity assay and structural identification of the synthetic product clearly demonstrated that wbgN encodes an α1,2-ColT. Biophysical study showed that WbgN does not require metal ion, and is highly active at pH 7.5-9.0. In addition, acceptor specificity study indicated that WbgN exclusively recognizes lacto-N-biose (Galβ1,3-GlcNAc). Most interestingly, it was found that WbgN exhibits similar activity toward GDP-l-Fuc (kcat/Km= 9.2 min(-1)mM(-1)) as that toward GDP-colitose (kcat/Km= 12 min(-1)mM(-1)). Finally, taking advantage of this, type 1 H-antigen was successfully synthesized in preparative scale. © The Author 2015. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  6. [Clinical experience with clozapine in 55 cases of treatment-resistant schizophrenia].

    Science.gov (United States)

    Enomoto, Tetsuro; Ito, Toshihiko; Sekine, Keisuke; Yasui, Reiko; Ashizawa, Yuko; Uju, Yoriyasu; Hayakawa, Tatsuro; Tsukada, Kazumi

    2013-01-01

    Up until October 2012, Kohnodai Hospital had introduced clozapine treatment for 55 cases of treatment-resistant schizophrenia. In all cases, previous antipsychotic medication was discontinued the day before clozapine administration began. Of the 55 cases, 45(85%)are continuing clozapine administration, and 40 cases (73%) are receiving outpatient treatment. The average dose of clozapine was 373.1 mg/day (SD : 160.5). Clozapine was administered for a month or more in 51 cases (93%). BPRS scores improved 20% or more in a month's administration of clozapine in 18 of the cases (35%). The average clozapine dose in the improvement cases was 176 mg/day. The average BPRS score had significantly decreased from the baseline at months 1, 3, 6, and 12 after the start of clozapine administration. Of the 33 cases receiving clozapine treatment for 12 months or more, BPRS improved 20% or more in 27 (82%). BPRS improved 20% or more for the first time after clozapine administration within a month in 12 cases (44%), 3 months in 8 cases (30%), 6 months in 5 cases (19%), and 12 months in 2 cases (7%). These results suggest that clozapine should be administered continuously for over 6 months at the least and 12 months if possible to evaluate the efficacy of clozapine treatment. Of the 43 cases receiving outpatient clozapine therapy, the average GAF score improved significantly from the time of ward admission to discharge (20.6 and 42.0, respectively). Clozapine had to be discontinued in 2 cases of leukopenia, 2 cases of neutropenia, 1 case of reduced left ventricular ejection due to pericardial effusion, 1 case of drug eruption, and 1 case of marked hunger. When introducing clozapine for treatment-resistant schizophrenia, it is important to administer it as a monotherapy, slowly increase the dosage to reduce side effects, and achieve a treatment effect at the minimum required dosage.

  7. An acute gastroenteritis outbreak of Vibrio parahaemolyticus O4:K55 in Nursing College, Thailand.

    Science.gov (United States)

    Jatapai, A; Moungthong, B; Thunyaharn, S; Huttayananont, S; Rangsin, R

    2010-08-01

    A cluster of acute gastroenteritis among nursing students was noticed on 13th September 2005. Between 13th and 17th September 2005, a retrospective cohort study was then conducted to identify the most likely cause of gastroenteritis at a nursing college in Bangkok, Thailand. Self-administered questionnaires, interviews, environmental investigations, and rectal swabs from all participants were carried out. In the investigation, 98.9% female nursing students were investigated and had completed the questionnaire, 49.4% of the participants were diagnosed to have acute gastroenteritis. The predominant symptoms were watery diarrhoea (90.8%) and abdominal cramps (71.3%). Of 28.9% of rectal swab isolates were identified as Vibrio parahaemolyticus O4:K55 (40.4%), Salmonella spp. (19.2%), Vibrio cholerae non O1/non O139/non O141 (11.5%), Aeromonas trota (3.9%), Vibrio alginolyticus (1.9%) and other co-infections (23.1%). The tdh gene was identified from all V. parahaemolyticus using multiplex PCR. The implicated food risk factor for gastroenteritis was boiled egg (adjusted prevalence rate ratio; PR=1.9, 95% CI, 1.04-3.79). However the bitter melon soup was not significantly associated for gastroenteritis (adjusted PR=1.3, 95% CI, 0.98-1.82). The population attributable fraction analysis indicated that boiled eggs item was an implicated food risk for this outbreak (PAF=45.8%). Vibrio parahaemolyticus O4:K55 was identified as a major causative agent for gastroenteritis in which the contaminated boiled eggs was a vehicle in this outbreak. Cross-contamination control should be emphasized in food operation plans among institutes.

  8. A theoretical investigation of the structural and electronic properties of 55-atom nanoclusters: The examples of Y–Tc and Pt

    Energy Technology Data Exchange (ETDEWEB)

    Batista, Krys E. A.; Piotrowski, Maurício J., E-mail: mauriciomjp@gmail.com [Department of Physics, Federal University of Pelotas, P.O. Box 354, 96010 − 900, Pelotas, RS (Brazil); Chaves, Anderson S.; Da Silva, Juarez L. F., E-mail: juarez-dasilva@iqsc.usp.br [São Carlos Institute of Chemistry, University of São Paulo, P.O. Box 780, 13560 − 970, São Carlos, SP (Brazil)

    2016-02-07

    Several studies have found that the Pt{sub 55} nanocluster adopts a distorted reduced core structure, DRC{sub 55}, in which there are 8–11 atoms in the core and 47–44 atoms in the surface, instead of the compact and high-symmetry icosahedron structure, ICO{sub 55}, with 13 and 42 atoms in the core and surface, respectively. The DRC structure has also been obtained as the putative global minimum configuration (GMC) for the Zn{sub 55} (3d), Cd{sub 55} (4d), and Au{sub 55} (5d) systems. Thus, the DRC{sub 55} structure has been reported only for systems with a large occupation of the d-states, where the effects of the occupation of the valence anti-bonding d-states might play an important role. Can we observe the DRC structure for 55-atom transition-metal systems with non-occupation of the anti-bonding d-states? To address this question, we performed a theoretical investigation of the Y {sub 55}, Zr{sub 55}, Nb{sub 55}, Mo{sub 55}, Tc{sub 55}, and Pt{sub 55} nanoclusters, employing density functional theory calculations. For the putative GMCs, we found that the Y {sub 55} adopts the ICO{sub 55} structure, while Nb{sub 55} and Mo{sub 55} adopt a bulk-like fragment based on the hexagonal close-packed structure and Tc{sub 55} adopts a face-centered cubic fragment; however, Zr{sub 55} adopts a DRC{sub 55} structure, like Zn{sub 55}, Cd{sub 55}, Pt{sub 55}, and Au{sub 55}. Thus we can conclude that the preference for DRC{sub 55} structure is not related to the occupation of the anti-bonding d-states, but to a different effect, in fact, a combination of structural and electronic effects. Furthermore, we obtained that the binding energy per atom follows the occupation of the bonding and anti-bonding model, i.e., the stability of the studied systems increases from Y to Tc with a small oscillation for Mo, which also explains the equilibrium bond lengths. We obtained a larger magnetic moment for Y {sub 55} (31 μ{sub B}) which can be explained by the localization of the d

  9. 26 CFR 55.6165-1 - Bonds where time to pay tax or deficiency has been extended.

    Science.gov (United States)

    2010-04-01

    ... TREASURY (CONTINUED) MISCELLANEOUS EXCISE TAXES (CONTINUED) EXCISE TAX ON REAL ESTATE INVESTMENT TRUSTS AND REGULATED INVESTMENT COMPANIES Procedure and Administration § 55.6165-1 Bonds where time to pay tax or...

  10. INTERSTOCK EFFECT ON THE GROWTH OF MANDARIN CV BATU 55, TANGERINE CV PONTIANAK AND LIME CV NIMAS PROPAGATED BY GRAFTING

    National Research Council Canada - National Science Library

    Sugiyatno A; Palupi N.E

    2017-01-01

    .... Batu 55, Tangerine cv. Pontianak and Lime cv. Nimas. This research was conducted in the screen house of Tlekung Experimental Field of Indonesian Citrus and Subtropical Fruits Research Institute (ICSFRI...

  11. Nuclear Criticality Safety Calculational Analysis for Fissile Mass Limits and Spacing Requirements for 55 - Gallon Waste Drums

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Thomas C. [Battelle; Hesse, David J. [Battelle; Tayloe, Jr., Robert W.

    1994-05-01

    A nuclear criticality safety analysis was performed to determine the fissile mass limits and spacing requirements for the storage of 55-gallon waste drums at the Portsmouth Gaseous Diffusion Plant (PORTS).

  12. 7 CFR 301.55-4 - Conditions governing the interstate movement of regulated articles from quarantined areas.

    Science.gov (United States)

    2010-01-01

    ... compliance agreement (see § 301.55-6(a)) to a commercial food warehouse or distribution center within the... cactus moth; and (4) With a tag or label bearing the number of the departmental permit issued for the...

  13. Flow cytometric analysis of CD55 and CD59 expression on blood cells in paroxysmal nocturnal haemoglobinuria

    Directory of Open Access Journals (Sweden)

    Anna Czyz

    2011-08-01

    Full Text Available PNH is a rare clonal disorder of hematopoietic stem cells, therefore all blood cells lineages are involved. The main feature is an increased sensitivity of erythrocytes to complement-mediated cell lysis due to deficiency of membrane-bound GPI (glycosylphosphatidylinositol-anchored proteins which normally function as inhibitors of reactive hemolysis. In the present study, we performed flow cytometric analysis using monoclonal antibodies against CD55 and CD59 for the detection of PNH-type clone in the blood of 50 patients (28 females and 22 males, age range 7-67 yrs. In one patient only we found a large population (95% of granulocytes with decreased expression of both CD55 and CD59 molecules (type I PNH and in two others with partial loss of CD55 expression (type II PNH. The expression was determined chiefly on granulocytes which in the control group showed reliable and high expression of CD55 and CD59.

  14. 78 FR 42994 - Waiver of 14 CFR 437.29 and 437.55(a) for Scaled Composites, LLC

    Science.gov (United States)

    2013-07-18

    ....55(a) for Scaled Composites, LLC AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of waiver. SUMMARY: This notice concerns a waiver to Scaled Composites, LLC (Scaled) from the...

  15. EPR and 55Mn cw-ENDOR study of an antiferrogmagnetically coupled dinuclear manganese (Mn III Mn IV) complex

    Science.gov (United States)

    Zweygart, W.; Bittl, R.; Wieghardt, K.; Lubitz, W.

    1996-10-01

    X- and Q-band EPR and 55Mn cw-ENDOR experiments are reported on a binuclear oxo-bridged dimanganese Mn III Mn IV complex. Consistent simulations of spectra from both frequency bands using one parameter set for the orthorhombic g tensor and Mn III and Mn IV hyperfine tensors are achieved. Information on the manganese hyperfine couplings is independently obtained from 55Mn cw-ENDOR spectroscopy performed on both ions.

  16. ALOHA 1.55μm Implementation on the CHARA Telescope Array: On-Sky Sensitivity Tests

    Science.gov (United States)

    Baudoin, R.; Darré, P.; Gomes, J.-T.; Fabert, M.; Grossard, L.; Delage, L.; Reynaud, F.; Scott, N. J.; Sturmann, J.; Ten Brummelaar, T. A.; Coudé Du Foresto, V.

    2016-04-01

    We intend to implement the ALOHA at 1.55μm up-conversion interferometer on the CHARA Array. After a full laboratory investigation, a sensitivity evaluation is conducted on several stars using a single interferometric arm in a photometric mode. The on-sky photometric results allows us to calibrate a numerical simulation of the interferometric configuration, and to predict the future performance of ALOHA at 1.55μm as a function of the seeing conditions.

  17. DRα1-MOG-35-55 treatment reduces lesion volumes and improves neurological deficits after traumatic brain injury.

    Science.gov (United States)

    Yang, Liu; Liu, Zhijia; Ren, Honglei; Zhang, Lei; Gao, Siman; Ren, Li; Chai, Zhi; Meza-Romero, Roberto; Benedek, Gil; Vandenbark, Arthur A; Offner, Halina; Li, Minshu

    2017-10-01

    Traumatic brain injury (TBI) results in severe neurological impairments without effective treatments. Inflammation appears to be an important contributor to key pathogenic events such as secondary brain injury following TBI and therefore serves as a promising target for novel therapies. We have recently demonstrated the ability of a molecular construct comprised of the human leukocyte antigen (HLA)-DRα1 domain linked covalently to mouse (m)MOG-35-55 peptide (DRα1-MOG-35-55 construct) to reduce CNS inflammation and tissue injury in animal models of multiple sclerosis and ischemic stroke. The aim of the current study was to determine if DRα1-MOG-35-55 treatment of a fluid percussion injury (FPI) mouse model of TBI could reduce the lesion size and improve disease outcome measures. Neurodeficits, lesion size, and immune responses were determined to evaluate the therapeutic potential and mechanisms of neuroprotection induced by DRα1-MOG-35-55 treatment. The results demonstrated that daily injections of DRα1-MOG-35-55 given after FPI significantly reduced numbers of infiltrating CD74(+) and CD86(+) macrophages and increased numbers of CD206(+) microglia in the brain concomitant with smaller lesion sizes and improvement in neurodeficits. Conversely, DRα1-MOG-35-55 treatment of TBI increased numbers of circulating CD11b(+) monocytes and their expression of CD74 but had no detectable effect on cell numbers or marker expression in the spleen. These results demonstrate that DRα1-MOG-35-55 therapy can reduce CNS inflammation and significantly improve histological and clinical outcomes after TBI. Future studies will further examine the potential of DRα1-MOG-35-55 for treatment of TBI.

  18. Early and extensive CD55 loss from red blood cells supports a causal role in malarial anaemia

    Directory of Open Access Journals (Sweden)

    Gwamaka Moses

    2011-12-01

    Full Text Available Abstract Background Levels of complement regulatory proteins (CrP on the surface of red blood cells (RBC decrease during severe malarial anaemia and as part of cell ageing process. It remains unclear whether CrP changes seen during malaria contribute to the development of anaemia, or result from an altered RBC age distribution due to suppressive effects of malaria on erythropoiesis. Methods A cross sectional study was conducted in the north-east coast of Tanzania to investigate whether the changes in glycosylphosphatidylinositol (GPI-anchored complement regulatory proteins (CD55 and CD59 contributes to malaria anaemia. Blood samples were collected from a cohort of children under intensive surveillance for Plasmodium falciparum parasitaemia and illness. Levels of CD55 and CD59 were measured by flow cytometer and compared between anaemic (8.08 g/dl and non- anaemic children (11.42 g/dl. Results Levels of CD55 and CD59 decreased with increased RBC age. CD55 levels were lower in anaemic children and the difference was seen in RBC of all ages. Levels of CD59 were lower in anaemic children, but these differences were not significant. CD55, but not CD59, levels correlated positively with the level of haemoglobin in anaemic children. Conclusion The extent of CD55 loss from RBC of all ages early in the course of malarial anaemia and the correlation of CD55 with haemoglobin levels support the hypothesis that CD55 may play a causal role in this disorder.

  19. CT dose equilibration and energy absorption in polyethylene cylinders with diameters from 6 to 55 cm.

    Science.gov (United States)

    Li, Xinhua; Zhang, Da; Liu, Bob

    2015-06-01

    ICRU Report No. 87 Committee and AAPM Task Group 200 designed a three-sectional polyethylene phantom of 30 cm in diameter and 60 cm in length for evaluating the midpoint dose DL(0) and its rise-to-the-equilibrium curve H(L) = DL(0)/D(eq) from computed tomography (CT) scanning, where D(eq) is the equilibrium dose. To aid the use of the phantom in radiation dose assessment and to gain an understanding of dose equilibration and energy absorption in polyethylene, the authors evaluated the short (20 cm) to long (60 cm) phantom dose ratio with a polyethylene diameter of 30 cm, assessed H(L) in polyethylene cylinders of 6-55 cm in diameters, and examined energy absorption in these cylinders. A GEANT4-based Monte Carlo program was used to simulate the single axial scans of polyethylene cylinders (diameters 6-55 cm and length 90 cm, as well as diameter 30 cm and lengths 20 and 60 cm) on a clinical CT scanner (Somatom Definition dual source CT, Siemens Healthcare). Axial dose distributions were computed on the phantom central and peripheral axes. An average dose over the central 23 or 100 mm region was evaluated for modeling dose measurement using a 0.6 cm(3) thimble chamber or a 10 cm long pencil ion chamber, respectively. The short (20 cm) to long (90 cm) phantom dose ratios were calculated for the 30 cm diameter polyethylene phantoms scanned at four tube voltages (80-140 kV) and a range of beam apertures (1-25 cm). H(L) was evaluated using the dose integrals computed with the 90 cm long phantoms. The resultant H(L) data were subsequently used to compute the fraction of the total energy absorbed inside or outside the scan range (E(in)/E or E(out)/E) on the phantom central and peripheral axes, where E = LD(eq) was the total energy absorbed along the z axis. The midpoint dose in the 60 cm long polyethylene phantom was equal to that in the 90 cm long polyethylene phantom. The short-to-long phantom dose ratios changed with beam aperture and phantom axis but were insensitive to

  20. Laboratorium Study of Asphalt Starbit E-55 Polymer Modified Application on Asphalt Concrete Wearing Course (Ac-Wc

    Directory of Open Access Journals (Sweden)

    Damianus Kans Pangaraya

    2015-09-01

    Full Text Available The conventional asphalt road has almost been considered fail to serve the transportation needs. It is indicated by the occurrence of premature damage which is caused by vehicle load and climate. Starbit E-55, the polymer modified bitumen, is formulated to meet the requirement of transport development. Considering those needs, it is important to investigate the feasibility level of that modified bitumen as alternate asphalt instead of the conventional one. This research began with the measurement of the properties of hard layered AC-WC Starbit E-55, then comparing the result to 60/70 penetration of Pertamina asphalt. The next step is then, to determine the converted value so as to be close to that of Pertamina (60/70 penetration. This step is conducted by applying durability and ITS tests on the mixture. Result of the tests showed that hard layered AC-WC Starbit E-55 has better characteristic at 5.7% optimum level asphalt and 6.4% of Pertamina asphalt (60/70 penetration. Starbit E-55 converted level within hard-layered ACWC is 5.6%. The performance test result on immersion with variance of 1, 3, 5, 7 and 14 days shows that durability value of Starbit E-55 AC-WC has better performance. During the process, Starbit E-55 required 15.38% higher energy consumption.

  1. 55S {sup trademark} Bioglass stimulates in vitro osteoblast differentiation and creates a favorable template for bone tissue formation

    Energy Technology Data Exchange (ETDEWEB)

    Loty, S.; Sautier, J.M.; Loty, C.; Forest, N. [Paris-7 Univ. (France). Lab. Biologie-Odontologie; Tan, M.T.; Greenspan, D. [US Biomaterials Corp., Alachua, FL (United States)

    2001-07-01

    In this study, we have investigated the behavior of fetal rat osteoblasts cultured on bioactive glasses with 55wt% silica content (55S) and on a bioinert glass (60S). When rat bone cells were cultured on both substrata, they formed multi-layered nodular structures by day 10 in culture. In addition, the specific activity of AP determined biochemically was significantly higher in 55S cultures than in the controls. SEM observations of the material surfaces after scraping-off the cell layers showed that mineralized bone nodules remained attached on 55S surfaces but not on 60S. The 55S/bone interfaces were also analyzed on transverse sections. The interfacial analysis showed a firm bone bonding to the 55S surface through an intervening apatite layer, confirmed by the X-ray mappings. All these results indicated the importance of the surface composition in supporting differentiation of osteogenic cells and the subsequent apposition of bone matrix allowing a strong bond of the bioactive materials to bone. (orig.)

  2. Mobilization and engraftment of peripheral blood stem cells in healthy related donors >55 years old.

    Science.gov (United States)

    Motlló, Cristina; Sancho, Juan-Manuel; Grífols, Joan-Ramon; Juncà, Jordi; Morgades, Mireia; Ester, Anna; Rodríguez, Inés; Vives, Susana; Batlle, Montserrat; Guardia, Ramon; Ferrà, Christelle; Gallardo, David; Millá, Fuensanta; Feliu, Evarist; Ribera, Josep-Maria

    2014-03-01

    The increasing scarcity of young related donors has led to the use of older donors for related allogeneic hematopoietic stem cell transplantation (HSCT). This study analyzed the influence of age on the results of mobilization of peripheral blood stem cells (PBSCs) in healthy donors as well as on the engraftment and outcome of HSCT. A retrospective analysis from a single center was performed comparing the results of PBSC mobilization from related healthy donors according to their age. The study included 133 consecutive related donors. The median age was 50 years (range, 4-77 years); 70 (53%) donors were males, and 44 (33%) were >55 years old. All donors were mobilized with granulocyte colony-stimulating factor for 5 days. The peak CD34(+) cell count in peripheral blood was higher in younger than in older donors (median, 90.5 CD34(+) cells/μL [range, 18-240 CD34(+) cells/μL] versus 72 CD34(+) cells/μL [range, 20-172.5 CD34(+) cells/μL], P = 0.008). The volume processed was lower in younger than in older donors (16,131 mL [range, 4424-36,906 mL] versus 18,653 mL [range, 10,003-26,261 mL], P = 0.002) with similar CD34(+) cells collected (579.3 × 10(6) cells [range, 135.14 × 10(6)-1557.24 × 10(6) cells] versus 513.69 × 10(6) cells [range, 149.81 × 10(6)-1290 × 10(6) cells], P = 0.844). There were no differences in time to recovery of neutrophils and platelets or in the incidences of acute and chronic graft-versus-host disease, overall survival, non-relapse mortality and relapse incidence. Donors >55 years old mobilized fewer CD34(+) cells and required a greater volume to collect a similar number of CD34(+) cells. The outcome of HSCT was not influenced by donor age. Donor age should not be a limitation for related allogeneic HSCT. Copyright © 2014 International Society for Cellular Therapy. Published by Elsevier Inc. All rights reserved.

  3. Water Solubility of Plutonium and Uranium Compounds and Residues at TA-55

    Energy Technology Data Exchange (ETDEWEB)

    Reilly, Sean Douglas [Los Alamos National Lab. (LANL), Los Alamos, NM (United States; Smith, Paul Herrick [Los Alamos National Lab. (LANL), Los Alamos, NM (United States; Jarvinen, Gordon D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States; Prochnow, David Adrian [Los Alamos National Lab. (LANL), Los Alamos, NM (United States; Schulte, Louis D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States; DeBurgomaster, Paul Christopher [Los Alamos National Lab. (LANL), Los Alamos, NM (United States; Fife, Keith William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States; Rubin, Jim [Los Alamos National Lab. (LANL), Los Alamos, NM (United States; Worl, Laura Ann [Los Alamos National Lab. (LANL), Los Alamos, NM (United States

    2016-06-13

    Understanding the water solubility of plutonium and uranium compounds and residues at TA-55 is necessary to provide a technical basis for appropriate criticality safety, safety basis and accountability controls. Individual compound solubility was determined using published solubility data and solution thermodynamic modeling. Residue solubility was estimated using a combination of published technical reports and process knowledge of constituent compounds. The scope of materials considered includes all compounds and residues at TA-55 as of March 2016 that contain Pu-239 or U-235 where any single item in the facility has more than 500 g of nuclear material. This analysis indicates that the following materials are not appreciably soluble in water: plutonium dioxide (IDC=C21), plutonium phosphate (IDC=C66), plutonium tetrafluoride (IDC=C80), plutonium filter residue (IDC=R26), plutonium hydroxide precipitate (IDC=R41), plutonium DOR salt (IDC=R42), plutonium incinerator ash (IDC=R47), uranium carbide (IDC=C13), uranium dioxide (IDC=C21), U3O8 (IDC=C88), and uranium filter residue (IDC=R26). This analysis also indicates that the following materials are soluble in water: plutonium chloride (IDC=C19) and uranium nitrate (IDC=C52). Equilibrium calculations suggest that PuOCl is water soluble under certain conditions, but some plutonium processing reports indicate that it is insoluble when present in electrorefining residues (R65). Plutonium molten salt extraction residues (IDC=R83) contain significant quantities of PuCl3, and are expected to be soluble in water. The solubility of the following plutonium residues is indeterminate due to conflicting reports, insufficient process knowledge or process-dependent composition: calcium salt (IDC=R09), electrorefining salt (IDC=R65), salt (IDC=R71), silica (IDC=R73) and sweepings/screenings (IDC=R78). Solution thermodynamic modeling also indicates that fire suppression water buffered with a

  4. Nasogastric tube feeding in cats with suspected acute pancreatitis: 55 cases (2001-2006).

    Science.gov (United States)

    Klaus, Jennifer A; Rudloff, Elke; Kirby, Rebecca

    2009-08-01

    To evaluate the complications and outcome associated with different nasogastric tube (NGT) feeding techniques in cats with suspected acute pancreatitis. Descriptive retrospective case series. Small animal emergency and referral hospital. The patient database (2001-2006) was searched for cats with suspected acute pancreatitis that received NGT liquid enteral feeding within 72 hours of admission and ≥12 hours during hospitalization. Signalment, history, clinical signs, laboratory data and abdominal ultrasonographic examinations were used for suspected diagnosis. Cats were grouped based upon whether they received bolus feeding or continuous rate infusion (CRI) of a liquid diet via the NGT, and whether or not administration of an intravenous amino acid and carbohydrate solution occurred prior to NGT feeding (AAS and non-AAS group, respectively). Fifty-five cats were included. For all cats, NGT feeding was initiated at a mean of 33.5 ± 15.0 hours and the target caloric intake (1.2 X {(30 X BW [kg]) +70}) was reached at 58.0 ± 28.4 hours from presentation. There was a significantly longer time from admission to the initiation of NGT feeding in the 34/55 cats in the AAS group vs. the 21/55 cats in the non-AAS group (P = 0.009). The 8 bolus-fed cats took longer to reach target caloric intake vs. the 47 CRI-fed cats (P = 0.002). Complications associated with NGT feeding for all cats included: mechanical problems (13%), diarrhea (25%), vomiting following NGT placement (20%) and vomiting following NGT feeding (13%). Mean time to discharge for all cats occurred after 78.6 ± 29.5 hours with an overall weight gain of 0.08 ± 0.52 kg. Fifty cats survived 28 days post-discharge. NGT feeding in this group of cats with suspected acute pancreatitis was well tolerated, and associated with a low incidence of diarrhea, vomiting, and mechanical complications. © Veterinary Emergency and Critical Care Society 2009.

  5. Shrinkage Porosity Criterion and Its Application to A 5.5 Ton Steel Ingot

    Directory of Open Access Journals (Sweden)

    Zhang C.

    2016-06-01

    Full Text Available In order to predict the distribution of shrinkage porosity in steel ingot efficiently and accurately, a criterion R√L and a method to obtain its threshold value were proposed. The criterion R√L was derived based on the solidification characteristics of steel ingot and pressure gradient in the mushy zone, in which the physical properties, the thermal parameters, the structure of the mushy zone and the secondary dendrite arm spacing were all taken into consideration. The threshold value of the criterion R√L was obtained with combination of numerical simulation of ingot solidification and total solidification shrinkage rate. Prediction of the shrinkage porosity in a 5.5 ton ingot of 2Cr13 steel with criterion R√L>0.21 m · °C1/2 · s−3/2 agreed well with the results of experimental sectioning. Based on this criterion, optimization of the ingot was carried out by decreasing the height-to-diameter ratio and increasing the taper, which successfully eliminated the centreline porosity and further proved the applicability of this criterion.

  6. Unusual molecular-ionic complex of tetrabutylammonium 5,5'-dibromo-2,2'-biphenolate

    Science.gov (United States)

    Wojciechowski, G.; Katrusiak, A.; Brzezinski, B.

    2002-02-01

    Very unusual coexistence of neutral and ionic forms of identical molecules have been found in the molecular ionic crystal of one neutral 5,5'-dibromo-2,2'-biphenol molecule, its two anions and two tetrabutylammonium cations [C 12H 8O 2Br 2(C 12H 7O 2Br 2-) 2(C 16H 36N +) 2, 1:2:2 complex]. This exceptional structure is stabilised by intramolecular and intermolecular O-H⋯O hydrogen bonds. The FTIR spectrum of the complex in the solid shows intense bands of the hydrogen-bonded motif as well as the continuous absorption indicating fluctuation of the proton in the OH +⋯O - intramolecular hydrogen bond. In chloroform and acetonitrile solutions the structure of the complex is completely different from the solid: fast fluctuations of the protons in circular hydrogen-bonded arrangement is proposed and these hydrogen bonds show large proton polarisability indicated by intense continuous absorption in the FTIR spectrum below 2000 cm -1.

  7. LAFD: TA-55 RLUOB/CUB Facility Familiarization Tour, OJT #55265

    Energy Technology Data Exchange (ETDEWEB)

    Rutherford, Victor Stephen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-09-14

    Los Alamos National Laboratory (LANL) conducts familiarization tours for personnel of the Los Alamos County Fire Department (LAFD) at the RLUOB/CUB, technical area (TA)-55, 400/440, facility, Radiological Laboratory Utility Office Building (RLUOB)/Central Utility Building (CUB). These familiarization tours are official LANL business; the purpose of these tours is to orient LAFD firefighters to the facility so that they can respond efficiently and quickly to a variety of emergency situations. This orientation includes, among other topics, the ingress and egress of the area and buildings, layout and organization of the facility, evacuation procedures and assembly points, and areas of concern within the various buildings at the facility. LAFD firefighters have the skills and abilities to perform firefighting operations and other emergency response tasks that cannot be provided by other LANL personnel who have the required clearance level. This handout provides details of the information, along with maps and diagrams, to be presented during the familiarization tours. The handout is distributed to the trainees at the time of the tour; a corresponding checklist is also used as guidance during the familiarization tours to ensure that all required information is presented to LAFD personnel.

  8. Los Alamos County Fire Department LAFD: TA-55 PF-4 Facility Familiarization Tour, OJT 55260

    Energy Technology Data Exchange (ETDEWEB)

    Rutherford, Victor Stephen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-07-13

    Los Alamos National Laboratory (LANL) will conduct familiarization tours for Los Alamos County Fire Department (LAFD) personnel at the Plutonium Facility (PF-4) at Technical Area (TA)-55. These familiarization tours are official LANL business; the purpose of these tours is to orient the firefighters to the facility so that they can respond efficiently and quickly to a variety of emergency situations. This orientation includes the ingress and egress of the area and buildings, layout and organization of the facility, evacuation procedures and assembly points, and areas of concern within the various buildings at the facility. LAFD firefighters have the skills and abilities to perform firefighting operations and other emergency response tasks that cannot be provided by other LANL personnel who have the required clearance level. This handout provides details of the information, along with maps and diagrams, to be presented during the familiarization tours. The handout will be distributed to the trainees at the time of the tour. A corresponding checklist will also be used as guidance during the familiarization tours to ensure that all required information is presented to LAFD personnel.

  9. A 50-year precipitation analysis over Europe at 5.5km within the UERRA project

    Science.gov (United States)

    Bazile, Eric; Abida, Rachid; Soci, Cornel; Verrelle, Antoine; Szczypta, Camille; Le Moigne, Patrick

    2017-04-01

    The UERRA project is a 4-year project (2014-2017) financed by the European Union under its 7th Framework Programme SPACE. One of its main objectives is to provide a 50-year reanalysis dataset of surface essential climate variables (ECV) at 5.5km grid at European scale, together with, as much as possible, uncertainty estimates. One of the ECV is the precipitation and this variable is of essential interest in weather forecasting, climate study and to "drive" hydrological model for water management, or agrometeorology. After a brief description of the method used for the precipitation analysis (Soci et al. 2016)during this project, the preliminary results will be presented. The estimation of uncertainties will be also discussed associated with the problem of the evolution of the observation density network and its impact on the long term series. Additional information about the UERRA project can be found at http://www.uerra.eu The research leading to these results has received funding from the European Union, Seventh Framework Programme (FP7-SPACE-2013-1) under grant agreement no 607193.

  10. XMM - Newton observations of the Seyfert 1 galaxy ESO 141-G55

    Energy Technology Data Exchange (ETDEWEB)

    Gondoin, P

    2004-06-01

    We report on an observation of the Seyfert 1 galaxy ESO 141-G55 performed in October 2001 with the EPIC MOS cameras and Reflection Grating Spectrometers (RGS) on board the XMM - Newton observatory. We find the hard (3-10 keV) continuum slope, including reflection, to be somewhat flatter ({gamma}=1.72{+-}0.06) than that of a typical broad-line Seyfert 1 galaxy. The spectrum shows a weak emission line at 6.45 {+-} 0.04 keV with a measured equivalent width of {approx} 40 eV. A broad spectral feature is observed around 7 keV that can be fitted by an absorption edge at 7.6 {+-} 0.1 keV. The extrapolation of the primary power law continuum to energies lower than 2 keV indicates the presence of a soft excess component contributing 45{+-} 3% of the overall flux in the 0.3-2.0 keV energy range. This soft-excess cannot be explained solely by enhanced reflection from a highly ionized disk.

  11. Effect of oral contraceptive use on lipid profile in Korean women aged 35-55 years.

    Science.gov (United States)

    Kim, Kisok; Park, Hyejin

    2012-11-01

    Although oral contraceptives (OCs) are widely used, their effects on lipid profile need monitoring according to current usage in different populations. A cross-sectional study was conducted using data from 1541 participants aged 35-55 years collected by the 2005-2009 Korea National Health and Nutrition Examination Surveys. OC use, demographic characteristics and dietary intake were obtained from the participants by questionnaire, and lipid levels were determined by analysis of blood samples. Longer duration of OC use was positively associated with increasing levels of high-density lipoprotein cholesterol (HDL-C) and decreasing levels of low-density lipoprotein cholesterol (LDL-C). After adjusting for demographic and dietary factors, the odds ratio (OR) of low HDL-C (50 mg/dL) was significantly decreased in the longer-term (>12 months) OC users (OR=0.36, 95% confidence interval 0.24-0.52) compared with those who never used OCs. However, use of OCs was not associated with a risk of high total cholesterol (≥ 240 mg/dL), high LDL-C (≥ 130 mg/dL), high triglycerides (≥ 150 mg/dL) or high ratio of triglycerides to HDL-C (>3.8). These data suggest that the use of OCs may reduce the risk of dyslipidemia, mainly due to the decreased risk of low HDL-C, in Korean women. Copyright © 2012 Elsevier Inc. All rights reserved.

  12. The aftershock sequence of the 5 August 2014 Orkney earthquake (ML 5.5), South Africa

    Science.gov (United States)

    Manzunzu, B.; Midzi, V.; Mangongolo, A.; Essrich, F.

    2017-11-01

    More than 1000 aftershocks were recorded within a month after the occurrence of the ML 5.5, 5 August 2014 Orkney earthquake. The events were relocated using the double difference method as part of an effort to identify the fault which might be the source of the events. A north-south trend of seismicity was revealed by the relocated events, with a diffuse cluster to the north of the main event. A depth profile shows these two clusters: one at a depth of about 2 km to the north of the main event and the other at depth between 3 and 6 km south of the main event. Focal mechanism solutions of 18 aftershocks were determined using first motion polarities from seismic stations of the Council for Geoscience cluster networks. Stress inversion analysis results from the focal mechanism solutions show a dominant extensional stress field in the region; the main event had a strike-slip fault plane solution. This is consistent with the regional stress field which is predominantly related to the East African rift system. It is possible that the occurrence of the main event triggered seismicity on shallower faults within the mining horizons oriented in a different direction to the fault on which the main event occurred. The area has a complex heterogeneous faulting structure as indicated by the observed low p values and complex focal mechanism solutions.

  13. Comparison of Penetrating Neck Injury Management in Combat Versus Civilian Trauma: A Review of 55 Cases.

    Science.gov (United States)

    de Régloix, Stanislas Ballivet; Baumont, Leslie; Daniel, Yann; Maurin, Olga; Crambert, Anna; Pons, Yoann

    2016-08-01

    The objective was to describe a case series of penetrating neck injuries (PNIs) and compare their management in combat versus civilian trauma. From 2012 to 2014, all soldiers and civilians referred to Percy Military Training Hospital for PNI were analyzed. The mechanism of injury, type and site of the lesion, and initial emergency management were noted. Among the 55 patients, 26 were wounded in action, and 29 were civilians. PNIs were commonly stab wounds resulting from an assault. Anatomical zone II, as well as the central neck compartment, was the most affected area. The most affected organ was the larynx. 74% of patients underwent computed tomography angiography (CTA), surgical exploration was performed for 42% of patients, and 33% of patients required intensive care unit monitoring. The differences between the two groups in terms of management were not statistically significant. The current management is based on clinical examination and CTA and is similar between soldiers and civilians. Surgical exploration is less commonly used than CTA, which is a fast and accurate method to evaluate PNI for stable patients. The classification by compartment seems more relevant than the classification by anatomical zone, particularly in absence of medical imaging. Reprint & Copyright © 2016 Association of Military Surgeons of the U.S.

  14. Mortality in two radom samples of women aged 55-64 followed up for 20 years.

    Science.gov (United States)

    Cochrane, A L; Moore, F; Baker, I A; Haley, T J

    1980-01-01

    Two random samples of women aged 55-64 living in the Vale of Glamorgan and the Rhondda Fach were followed up for 20 years. In each sample heights, weights, serum cholesterol concentrations, and specific causes of death were noted and the Quetelet index (weight/height2) calculated. The two samples were combined for analysis of total mortality. In the combined sample there was a strong positive association between Quetlet index and both total mortality and mortality from ischaemic heart disease. Multiple logistic regression analysis showed that both of these associations were significant, as was the strong positive association between Quetelet index and mortailty from ischaemic heart disease in the samples considered separately. There was no significant association between cholesterol concentration and mortality from ischaemic heart disease in each sample. There was a small negative association between cholesterol concentration and both total mortaility in the combined sample and ischaemic heart disease in the Rhondda Fach sample. These results suggest that the Quetelet index is important for prognosis, whereas the serum cholesterol concentration is not. PMID:7427109

  15. A report of the anesthesia in posterior fossa operations in the sitting position in 55 patients

    Directory of Open Access Journals (Sweden)

    Jahanguiri B

    1994-04-01

    Full Text Available In this survey, 55 patients were studied in a period of six years for having the anesthesia in the sitting position. In this position, the surgeon will had a better access to the location, whose damages have been sustained, so less damages would be given to the healthy tissues. For the patients, due to their critical general conditions, one week prior to giving anesthesia to the posterior fossa, operation in the sitting position the right ventriculoatiral shunt was placed. For preventing the fall of blood pressure, a bandage was placed in the lower limbs after inducing anesthesia and changing supine position to sitting position. Before the induction, central venous pressure was measured for treating the air embolism. The head of catheter was placed inside the right atrial. Premedications such as atropine, pethidine, and inductive agents like thiopenton, and muscle relaxants, maintained with halothane and nitrous oxide. All of the patients endured this condition without the fall of blood pressure and air embolism

  16. An inductorless multi-mode RF front end for GNSS receiver in 55 nm CMOS

    Science.gov (United States)

    Yanbin, Luo; Chengyan, Ma; Yebing, Gan; Min, Qian; Tianchun, Ye

    2015-10-01

    An inductorless multi-mode RF front end for a global navigation satellite system (GNSS) receiver is presented. Unlike the traditional topology of a low noise amplifier (LNA), the inductorless current-mode noise-canceling LNA is applied in this design. The high-impedance-input radio frequency amplifier (RFA) further amplifies the GNSS signals and changes the single-end signal path into fully differential. The passive mixer down-converts the signals to the intermediate frequency (IF) band and conveys the signals to the analogue blocks. The local oscillator (LO) buffer divides the output frequency of the voltage controlled oscillator (VCO) and generates 25%-duty-cycle quadrature square waves to drive the mixer. Our measurement results display that the implemented RF front end achieves good overall performance while consuming only 6.7 mA from 1.2 V supply. The input return loss is better than -26 dB and the ultra low noise figure of 1.43 dB leads to high sensitivity of the GNSS receiver. The input 1 dB compression point is -43 dBm at the high gain of 48 dB. The designed circuit is fabricated in 55 nm CMOS technology and the die area, which is much smaller than traditional circuit, is around 220 × 280 μm2.

  17. MRI of infections and neoplasms of the spine and spinal cord in 55 patients with AIDS

    Energy Technology Data Exchange (ETDEWEB)

    Thurnher, M.M. [Neuroradiology Section, Department of Radiology, University Hospital Vienna (Austria); Post, M.J.D. [Department of Radiology, Neuroradiology Section, University of Miami School of Medicine, Miami, FL (United States); Jinkins, J.R. [Neuroimaging Research, Department of Radiology, Nebraska Medical Center, Omaha, NE (United States)

    2000-08-01

    Our purpose was to describe the range of MRI findings in infectious and neoplastic involvement of the spine and spinal cord in symptomatic patients with the acquired immunodeficiency syndrome (AIDS). MRI studies in 55 patients with AIDS and neurological signs and symptoms thought to be related to the spine or spinal cord were reviewed. We categorized the findings according to the spinal compartment involved. There were 29 patients with extradural, 11 with intradural-extramedullary and 9 with intramedullary disease. In 6 patients more than one compartment was involved simultaneously, and patients presented with multiple lesions in the same compartment. The most common causes of extradural disease were bone lesions (28); an epidural mass was seen in 14 and spondylodiscitis in 4 patients. Cytomegalovirus polyradiculitis was the most common cause of intradural-extramedullary disease (in 10 cases); herpes radiculitis was seen in two, and tuberculous infection in another two. In three cases leptomeningeal contrast enhancement was due to lymphoma. Human immunodeficiency virus (HIV) myelitis was seen in two patients, presumed vacuolar myelopathy in two, toxoplasma myelitis in four, intramedullary lymphoma in one, and herpes myelitis in one. Familiarity with the various potential pathological entities that can affect the spine and spinal cord in the AIDS population and their imaging characteristics is crucial for initiation of further diagnostic tests and appropriate medical or surgical treatment. (orig.)

  18. Cotrel-Dubousset instrumentation and thoracolumbar spine trauma: a review of 55 cases.

    Science.gov (United States)

    Stambough, J L

    1994-12-01

    A series of 55 patients treated with posterior Cotrel-Dubousset instrumentation and osteosynthesis for unstable thoracolumbar spine fractures were reviewed. Follow-up averaged 48.3 months. The fractures were all unstable, with 27 classified as fracture-dislocations (FD) and 28 classified as flexion compression injuries or unstable burst fractures (FC/B). The study population was composed of 29 men and 26 women with an average age of 31 (range 20-45) years. Mechanisms of injuries included 35 motor vehicle accidents, 19 falls, and one blunt trauma. No case worsened as a result of surgery, and 31% of the cases improved an average of 0.5 Frankel grade (range 0-2). Sixty percent of patients were braced with a custom molded thoracolumbosacral orthosis (TLSO) fitted after surgical stabilization. Minor complications occurred in 45% of the cases (urinary tract infection most common). There was a singular deep wound infection and another iliac crest donor site infection. There were no instrument failures or pseudarthroses. Radiographic analysis showed the following improvements in fracture angle, vertebral body compression, and fracture displacement. The pattern of radiographic improvement in the FD and FC/B subgroups showed significant improvement in each parameter when comparing preoperative to immediate postoperative values. Of importance, the radiographic findings comparing 1 month to the final follow-up showed little to no deterioration. Cotrel-Dubousset instrumentation proved to be a highly effective device for immediate restabilization of unstable thoracolumbar injuries.

  19. Glyaderm(®) dermal substitute: clinical application and long-term results in 55 patients.

    Science.gov (United States)

    Pirayesh, Ali; Hoeksema, Henk; Richters, Cornelia; Verbelen, Jozef; Monstrey, Stan

    2015-02-01

    Glycerol preserved acellular dermis (Glyaderm(®)) consists of collagen and elastin fibers and is the first non-profit dermal substitute derived from glycerol-preserved, human allogeneic skin. It is indicated for bi-layered skin reconstruction of full thickness wounds. A protocol for clinical application and optimal interval before autografting with split thickness skin graft (STSG) was developed in a pilot study. A phase III randomized, controlled, paired, intra-individual study compared full thickness defects engrafted with Glyaderm(®) and STSG versus STSG alone. Outcome measures included percentage of Glyaderm(®) take, STSG take, and scar quality assessment. Pilot study (27 patients): Mean take rates equaled 91.55% for Glyaderm(®) and 96.67% for STSG. The optimal autografting interval was 6 days (±1 day). Randomized trial (28 patients): Mean Glyaderm(®) take rate was 88.17%. STSG take rates were comparable for both research groups (p=0.588). One year after wound closure, Glyaderm(®)+STSG was significantly more elastic (p=0.003) than STSG alone. Blinded observers scored Glyaderm(®) treated wounds better in terms of scar quality. The efficacy of Glyaderm(®) as a suitable dermal substitute for full thickness wounds is attested. Currently a procedure for simultaneous application of Glyaderm(®) and STSG is adopted, allowing for further widespread use of Glyaderm(®). Copyright © 2014 Elsevier Ltd and ISBI. All rights reserved.

  20. Evocative allusions in Matthew: Matthew 5:5 as a test case

    Directory of Open Access Journals (Sweden)

    Robert L. Brawley

    2003-11-01

    Full Text Available Combining theories of intertextuality and abductive reasoning, this article demonstrates the figurative nature of scriptural allusions in Matthew. Allusions form figurations that open new perspectives for readers inasmuch as the source text and the new text stand in a tensive relationship in which each modifies the other and in which together they evoke meaning beyond the mere sum of the two independent texts. Allusions also form figurations inasmuch as arguments that are analogous to logic. Surprising, original, uncanny correlations between the source text and the new text involve what Charles Peirce called abductive reasoning which also challenges constructs of reality. This article interprets Matthew 5:5 as an allusion to the Abrahamic promise of the inheritance of the land and the blessing of all the families of the earth mediated through Psalm 36 (LXX and describes the figurative nature of the allusion using Harold Bloom’s revisionary ratios. Another version of the article will also be published in Kim, P & Ringe, S (eds, Literary encounters with the reign of God: Essays in honor of Robert C Tannehill, Harrisburg, PA: Trinity Press International (Forthcoming.

  1. Equilibrium and Kinetics of Sin Nombre Hantavirus Binding at DAF/CD55 Functionalized Bead Surfaces

    Directory of Open Access Journals (Sweden)

    Tione Buranda

    2014-03-01

    Full Text Available Decay accelerating factor (DAF/CD55 is targeted by many pathogens for cell entry. It has been implicated as a co-receptor for hantaviruses. To examine the binding of hantaviruses to DAF, we describe the use of Protein G beads for binding human IgG Fc domain-functionalized DAF ((DAF2-Fc. When mixed with Protein G beads the resulting DAF beads can be used as a generalizable platform for measuring kinetic and equilibrium binding constants of DAF binding targets. The hantavirus interaction has high affinity (24–30 nM; kon ~ 105 M−1s−1, koff ~ 0.0045 s−1. The bivalent (DAF2-Fc/SNV data agree with hantavirus binding to DAF expressed on Tanoue B cells (Kd = 14.0 nM. Monovalent affinity interaction between SNV and recombinant DAF of 58.0 nM is determined from competition binding. This study serves a dual purpose of presenting a convenient and quantitative approach of measuring binding affinities between DAF and the many cognate viral and bacterial ligands and providing new data on the binding constant of DAF and Sin Nombre hantavirus. Knowledge of the equilibrium binding constant allows for the determination of the relative fractions of bound and free virus particles in cell entry assays. This is important for drug discovery assays for cell entry inhibitors.

  2. Da Vinci robot-assisted system for thymectomy: experience of 55 patients in China.

    Science.gov (United States)

    Jun, Yi; Hao, Li; Demin, Li; Guohua, Dong; Hua, Jing; Yi, Shen

    2014-09-01

    Da Vinci robot-assisted thymectomy has been used in the past several years in China, however, practical experience in performing this approach in China remains limited. Thus, the study aimed to evaluate the experience of da Vinci robot-assisted thymectomy in China. From June 2010 to December 2012, 55 patients with diseases of the thymus underwent thymectomy using the da Vinci surgical HD robotic system. The clinical data of the da Vinci robot-assisted thymectomies were compared with the data of video-assisted thoracoscopic thymectomies in the same period. All da Vinci robot operations were successful. This is a retrospective analysis which demonstrated that compared with video-assisted thoracoscopic thymectomy in the same period, the clinical outcomes of da Vinci robot-assisted thymectomy were not significantly different. The da Vinci robot-assisted thymectomy is a safe, minimally invasive, and convenient operation, and shows promise for general thoracic surgery in China. Copyright © 2014 John Wiley & Sons, Ltd.

  3. Plasma-enhanced regenerable 5,5-dimethylhydantoin (DMH) antibacterial finishing for cotton fabric

    Science.gov (United States)

    Zhou, Chang-E.; Kan, Chi-Wai

    2015-02-01

    In this study, atmospheric pressure nitrogen plasma treatment was applied to cotton fabrics in the coating process of cotton fabric coated with 5,5-dimethylhydantoin (DMH) with the aim to enhance the adhesion of DMH and antibacterial property. Then chlorine was introduced into nitrogen-containing groups on the coated cotton fabrics in order to make it antibacterial by chlorination with sodium hypochlorite. The antibacterial property, rechargeability and stability of the coated cotton fabrics were investigated. FTIR, UV and SEM were used to evaluate the surface properties, including the existence of DMH on cotton fabrics, the content of DMH on cotton fabrics and the surface topography of cotton fabrics after modification. The results showed that nitrogen plasma treatment introduces nitrogen-containing groups into cotton fabrics and enhances the adhesion of DMH on the fabrics, and introduction of chlorine on the coated fabrics inhibits bacteria, Staphylococcus aureus (S. aureus), effectively and the antibacterial property is regenerable. Therefore, the antibacterial finishing of cotton fabrics coated with DMH with the aid of nitrogen plasma treatment achieves good effect.

  4. 1.55-μm VCSEL with polarization-independent HCG mirror on SOI.

    Science.gov (United States)

    Tsunemi, Yoshihiro; Yokota, Nobuhide; Majima, Shota; Ikeda, Kazuhiro; Katayama, Takeo; Kawaguchi, Hitoshi

    2013-11-18

    We designed and fabricated a vertical-cavity surface-emitting laser (VCSEL) incorporating a polarization-independent high-index-contrast subwavelength grating (HCG) mirror on silicon-on-insulator (SOI) for a novel polarization-bistable device on a silicon substrate. The VCSEL consists of the HCG mirror, an active layer with InGaAsP quantum wells having optical gain around 1.55 μm, and an Al0.9Ga0.1As/Al0.16Ga0.84As DBR. We used direct wafer bonding for the bonding between the active layer and the AlGaAs DBR, and benzocyclobutene (BCB) bonding for the bonding between the active layer and the polarization-independent HCG mirror. The reflectivity of the HCG embedded with BCB was measured, resulting in a 200-nm-high reflectivity band with reflectivity higher than 99% and a small polarization dependence of ± 1%. We achieved lasing of the fabricated HCG-VCSEL at 1527 nm under an optical short pulse excitation with an average power of 50 mW (~0.2 mJ/cm2) at 240 K.

  5. Purification and characterization of manganese-dependent alkaline serine protease from Bacillus pumilus TMS55.

    Science.gov (United States)

    Ibrahim, Kalibulla Syed; Muniyandi, Jeyaraj; Karutha Pandian, Shunmugiah

    2011-01-01

    The purification and characterization of a Mn2+-dependent alkaline serine protease produced by Bacillus pumilus TMS55 were investigated. The enzyme was purified in three steps: concentrating the crude enzyme using ammonium sulfate precipitation, followed by gel filtration and cation-exchange chromatography. The purified protease had a molecular mass of approximately 35 kDa, was highly active over a broad pH range of 7.0 to 12.0, and remained stable over a pH range of 7.5 to 11.5. The optimum temperature for the enzyme activity was found to be 60 degreesC. PMSF and AEBSF (1 mM) significantly inhibited the protease activity, indicating that the protease is a serine protease. Mn2+ ions enhanced the activity and stability of the enzyme. In addition, the purified protease remained stable with oxidants (H2O2, 2%) and organic solvents (25%), such as benzene, hexane, and toluene. Therefore, these characteristics of the protease and its dehairing ability indicate its potential for a wide range of commercial applications.

  6. Clinical intervention to reduce central obesity and menopausal symptoms in women aged 35 to 55 years.

    Science.gov (United States)

    Bitner, Diana L; Wild, Robert A

    2014-09-01

    Central obesity is a risk factor for cardiovascular disease and diabetes. Women commonly increase central fat deposition during the menopausal transition. The purpose of this demonstration project was to determine whether a personalized sex-specific intervention, WAIPointes (WAI stands for Who Am I), could reduce central obesity in women undergoing perimenopausal transition. Eighty-three of 103 women aged 35 to 55 years and experiencing symptoms of the menopausal transition completed a 6-month WAIPointes demonstration project; 75 consented to data review.Sex-specific history was obtained on visit 1; directed physical examination for body mass index, body fat percentage, waist circumference, and blood pressure were performed at each of four or five subsequent monthly visits. Other tests were ordered as necessary to determine risk stratification.Participants were assessed for menopause status, and they reported activity and menopausal symptoms at each visit. Personalized strategies for health improvement were developed in partnership. Women served as their own controls. Data from visit 2 were compared with data from visit 4. The intervention reduced waist circumference and diastolic blood pressure and improved self-reported menopausal symptoms and physical activity levels. Although further study is needed, findings suggest that the WAIPointes program offers potential as an effective office-based clinical intervention to reduce cardiovascular risk factors and symptoms of menopause in women during the menopausal transition.

  7. [Colon cancer risk in persons at familial or hereditary risk aged < 55 years].

    Science.gov (United States)

    Waldmann, A; Raspe, H; Katalinic, A

    2009-10-01

    The question whether persons at familial or hereditary risk differ in terms of absolute, relative, or cumulative risk for colorectal cancer or not is of importance for the estimation of the potential of early detection of colorectal cancer in persons with familial or hereditary risks. Based on the results of a systematic literature search on absolute, relative, and cumulative risks of familial and hereditary disposition for colorectal cancer as well as actual German tumour incidence data, projections were conducted. The absolute risk for colorectal cancer in familial risk persons identified by means of a questionnaire is increased by a factor of 2 - 4 depending on the age at questioning, the age of the family member at cancer diagnosis and number of family members with colorectal cancer. Their absolute colorectal cancer risk equals that of persons without this risk who are 10 to 15 years older. Persons with hereditary risk show an increase in risk by a factor of 8 - 80. Persons aged 40 to 45 years with a familial risk constellation show a risk for colorectal cancer that equals the risk of 55- to 59-year-old persons from the general population. Therefore, the legal right for screening colonoscopy should be extended to the persons at risk aged 40 to 45 years. Persons suspected for hereditary risk should have a genetic counselling and, in case of germ mutation, a colonoscopic surveillance according to the actual guidelines. Copyright Georg Thieme Verlag KG Stuttgart . New York.

  8. Tipología de compradores online mayores de 55 años

    Directory of Open Access Journals (Sweden)

    Ángel F. Villarejo-Ramos

    2015-12-01

    Full Text Available La edad se considera una de las variables determinantes del riesgo de exclusión social de la población, especialmente con relación al uso de las nuevas tecnologías en general y de Internet en particular. Esto ha incidido en una creciente preocupación por el estudio del colectivo de mayores de 55 años y sus peculiaridades en lo relativo al acceso, uso y aprovechamiento de las TIC (Tecnologías de la Información y la Comunicación. Sin embargo, los esfuerzos se han centrado, mayoritariamente, en el análisis del grupo de mayores como algo homogéneo, lo que ha llevado a establecer sus perfiles de comportamiento en comparación con el de otros grupos de edad. En esta investigación, con una muestra útil de 595 mayores, partimos de la consideración del colectivo como grupo heterogéneo, con distintas características y condiciones de uso de Internet, y proponemos un modelo de clases latentes que nos permite establecer tres perfiles de mayores internautas en función de la utilización de un servicio avanzado de Internet, la compra online.

  9. Influence of the cooling method on the structure of 55AlZn coatings

    Energy Technology Data Exchange (ETDEWEB)

    Mendala, J, E-mail: jacek.mendala@polsl.pl [Department of Materials Technology, Silesian University of Technology, Krasinskiego 8, 40-019 Katowice (Poland)

    2011-05-15

    In metallization processes, metals or metal alloys are used which have a low melting point and good anticorrosion properties. Moreover, they must form durable intermetallic compounds with iron or its alloys. The most common hot-dip metallization technology involves galvanizing, however, molten multi-component metal alloys are used as well. An addition of aluminium to the zinc bath causes an increase in corrosion resistance of the obtained coatings. The article presents results of tests of obtaining coatings by the batch hot-dip method in an 55AlZn bath. Kinetics of the coating growth in the tested alloys were determined in the changeable conditions of bath temperature, dip time and type of cooling. The structure of coatings and their phase composition were revealed. As a result of the tests performed, it has been found that an increase in total thickness of the coatings as a function of the dipping time at a constant temperature is almost of a parabolic nature, whereas an increase in the transient layer is of a linear nature. The structure was identified by the XRD analysis and the morphology of the coatings was tested by means of SEM. It has been found that the cooling process with the use of higher rates of cooling causes a size reduction of the structure in the outer layer and a reduction of thickness of both the intermediate diffusion layer and the whole coating by ca. 25 %.

  10. Ion irradiation induced nanocrystal formation in amorphous Zr 55Cu 30Al 10Ni 5 alloy

    Science.gov (United States)

    Carter, Jesse; Fu, E. G.; Martin, Michael; Xie, Guoqiang; Zhang, X.; Wang, Y. Q.; Wijesundera, D.; Wang, X. M.; Chu, Wei-Kan; McDeavitt, Sean M.; Shao, Lin

    2009-09-01

    Ion irradiation can be used to induce partial crystallization in metallic glasses to improve their surface properties. We investigated the microstructural changes in ribbon Zr 55Cu 30Al 10Ni 5 metallic glass after 1 MeV Cu-ion irradiation at room temperature, to a fluence of 1.0 × 10 16 cm -2. In contrast to a recent report by others that there was no irradiation induced crystallization in the same alloy [S. Nagata, S. Higashi, B. Tsuchiya, K. Toh, T. Shikama, K. Takahiro, K. Ozaki, K. Kawatusra, S. Yamamoto, A. Inouye, Nucl. Instr. and Meth. B 257 (2007) 420], we have observed nanocrystals in the as-irradiated samples. Two groups of nanocrystals, one with diameters of 5-10 nm and another with diameters of 50-100 nm are observed by using high resolution transmission electron microscopy. Experimentally measured planar spacings ( d-values) agree with the expectations for Cu 10Zr 7, NiZr 2 and CuZr 2 phases. We further discussed the possibility to form a substitutional intermetallic (Ni xCu 1-x)Zr 2 phase.

  11. [Continence disorders in hereditary spinocerebellar degeneration. Comparison of clinical and urodynamic findings in 55 cases].

    Science.gov (United States)

    Chami, I; Miladi, N; Ben Hamida, M; Zmerli, S

    1984-01-01

    Urodynamic exploration with cystometry was performed at random on 55 of the 195 patients suffering from hereditary spinocerebellar degeneration (Friedreich's disease 43 cases, Pierre-Marie hereditary ataxia nine cases, Strumpell-Lorrain disease three cases). The authors observed disturbances in continence without urinary disorders, even when the bladder was atonic. In the case of Friedreich's disease, among the 18 patients with urgent urination or with urinary leakage, the bladder was found to be normal in only two cases. Although 25 patients evidenced no urinary disturbances, a through study revealed nine abnormal bladders. In the case of Pierre-Marie disease, six normal bladders and three pathological bladders were found. A single abnormal bladder was found in Strumpell-Lorrain disease. Two types of pathological bladder were observed: the atonic bladder was compared with the traumatic bladder, and was found primarily in conjunction with peripheral sensory disturbances. The hypertonic bladder appears when sensory involvement is not evident. The authors discuss the pathophysiology of these disturbances of continence.

  12. Microcavity Silicon Photodetectors at 1.55 μm

    Directory of Open Access Journals (Sweden)

    M. Casalino

    2011-01-01

    Full Text Available The design, the realization, and the characterization of silicon resonant cavity enhanced (RCE photodetectors, working at 1.55 μm, are reported. The photodetectors are constituted by a Fabry-Perot microcavity incorporating a Schottky diode. The working principle is based on the internal photoemission effect. We investigated two types of structures: top and back-illuminated. Concerning the top-illuminated photodetectors, a theoretical and numerical analysis has been provided and the device quantum efficiency has been calculated. Moreover, a comparison among three different photodetectors, having as Schottky metal: gold, silver, or copper, was proposed. Concerning the back-illuminated devices, two kinds of Cu/p-Si RCE photodetectors, having various bottom-mirror reflectivities, were realized and characterized. Device performances in terms of responsivity, free spectral range, and finesse were theoretically and experimentally calculated in order to prove an enhancement in efficiency due to the cavity effect. The back-illuminated device fabrication process is completely compatible with the standard silicon technology.

  13. Flexibility of Older Adults Aged 55–86 Years and the Influence of Physical Activity

    Directory of Open Access Journals (Sweden)

    Liza Stathokostas

    2013-01-01

    Full Text Available Cross-sectional age-related differences in flexibility of older adults aged 55–86 years of varying activity levels were examined. Shoulder abduction and hip flexion flexibility measurements were obtained from 436 individuals (205 men, 71±9 years; 231 women, 72±8 years. Total physical activity was assessed using the Minnesota Leisure-Time Physical Activity Questionnaire. Shoulder abduction showed a significant decline averaging 5 degrees/decade in men and 6 degrees/decade in women. Piecewise linear regression showed an accelerated decline in men starting at the age of 71 years of 0.80 degrees/year, whereas in women the onset of decline (0.74 degrees/year was 63 years. Men and women showed a significant decline in hip flexion (men: 6 degrees/decade; women: 7 degrees/decade. Piecewise linear regression revealed a rate of decline of 1.16 degrees/year beginning at 71 years in men and in women a single linear decline of 0.66 degrees/year. Multiple regression analysis showed that age and physical activity accounted for only 9% of the variance in hip flexion in women and 10% in men, with age but not physical activity remaining significant. Similarly for shoulder abduction, age was significant but not physical activity, in a model that described 8% of the variance for both sexes.

  14. Experimental demonstration of 55-fs spin canting in photoexcited iron nanoarrays

    Science.gov (United States)

    Ren, Yuhang; Lai, Wei; Cevher, Zehra; Gong, Yu; Zhang, G. P.

    2017-02-01

    As magnetic storage density approaches 1TB/in2, a grand challenge is looming as how to read/write such a huge amount of data within a reasonable time. The ultrafast optical manipulation of magnetization offers a solution, but little is known about the intrinsic speed limit of quantum spin switching. Here, we report that low-energy 50-fs laser pulses can induce spin canting in Fe nanoparticles within 55 fs, breaking the previous record by at least one order of magnitude. Both linearly and circularly polarized light can be used to tilt spins. In our model, the incident laser field first excites the orbital angular momentum, and through spin-orbit coupling, the spin cants out-of-plane and results in a distinctive diamond hysteresis loop. The spin canting time decreases with spin angular momentum. This spin canting is not limited to Fe nanoparticles and is also observed in Fe/Pt and Fe3O4 nanoparticles. Our results demonstrate the potential of magnetic nanostructures as a viable magnetic medium for high density and fast-switching magnetic storage devices.

  15. Development of a 5.5 m diameter vertical axis wind turbine, phase 3

    Science.gov (United States)

    Dekitsch, A.; Etzler, C. C.; Fritzsche, A.; Lorch, G.; Mueller, W.; Rogalla, K.; Schmelzle, J.; Schuhwerk, W.; Vollan, A.; Welte, D.

    1982-06-01

    In continuation of development of a 5.5 m diameter vertical axis windmill that consists in conception, building, and wind tunnel testing, a Darrieus rotor windpowered generator feeding an isolated network under different wind velocity conditions and with optimal energy conversion efficiency was designed built, and field tested. The three-bladed Darrieus rotor tested in the wind tunnel was equiped with two variable pitch Savonius rotors 2 m in diameter. By means of separate measures of the aerodynamic factors and the energy consumption, effect of revisions and optimizations on different elements was assessed. Pitch adjustement of the Savonius blades, lubrication of speed reducer, rotor speed at cut-in of generator field excitation, time constant of field excitation, stability conditions, switch points of ohmic resistors which combined with a small electric battery simulated a larger isolated network connected with a large storage battery, were investigated. Fundamentals for the economic series production of windpowered generators with Darrieus rotors for the control and the electric conversion system are presented.

  16. Deleting exon 55 from the nebulin gene induces severe muscle weakness in a mouse model for nemaline myopathy.

    Science.gov (United States)

    Ottenheijm, Coen A C; Buck, Danielle; de Winter, Josine M; Ferrara, Claudia; Piroddi, Nicoletta; Tesi, Chiara; Jasper, Jeffrey R; Malik, Fady I; Meng, Hui; Stienen, Ger J M; Beggs, Alan H; Labeit, Siegfried; Poggesi, Corrado; Lawlor, Michael W; Granzier, Henk

    2013-06-01

    Nebulin--a giant sarcomeric protein--plays a pivotal role in skeletal muscle contractility by specifying thin filament length and function. Although mutations in the gene encoding nebulin (NEB) are a frequent cause of nemaline myopathy, the most common non-dystrophic congenital myopathy, the mechanisms by which mutations in NEB cause muscle weakness remain largely unknown. To better understand these mechanisms, we have generated a mouse model in which Neb exon 55 is deleted (Neb(ΔExon55)) to replicate a founder mutation seen frequently in patients with nemaline myopathy with Ashkenazi Jewish heritage. Neb(ΔExon55) mice are born close to Mendelian ratios, but show growth retardation after birth. Electron microscopy studies show nemaline bodies--a hallmark feature of nemaline myopathy--in muscle fibres from Neb(ΔExon55) mice. Western blotting studies with nebulin-specific antibodies reveal reduced nebulin levels in muscle from Neb(ΔExon55) mice, and immunofluorescence confocal microscopy studies with tropomodulin antibodies and phalloidin reveal that thin filament length is significantly reduced. In line with reduced thin filament length, the maximal force generating capacity of permeabilized muscle fibres and single myofibrils is reduced in Neb(ΔExon55) mice with a more pronounced reduction at longer sarcomere lengths. Finally, in Neb(ΔExon55) mice the regulation of contraction is impaired, as evidenced by marked changes in crossbridge cycling kinetics and by a reduction of the calcium sensitivity of force generation. A novel drug that facilitates calcium binding to the thin filament significantly augmented the calcium sensitivity of submaximal force to levels that exceed those observed in untreated control muscle. In conclusion, we have characterized the first nebulin-based nemaline myopathy model, which recapitulates important features of the phenotype observed in patients harbouring this particular mutation, and which has severe muscle weakness caused by

  17. [125I]RTI-55 binding to cocaine-sensitive dopaminergic and serotonergic uptake sites in the human brain.

    Science.gov (United States)

    Little, K Y; Kirkman, J A; Carroll, F I; Breese, G R; Duncan, G E

    1993-12-01

    [125I]RTI-55 is a newly synthesized cocaine congener that may offer advantages over other ligands previously used to examine cocaine binding sites. However, the in vitro pharmacological and anatomical characterization of [125I]RTI-55 binding sites has not been previously performed in human brain. To determine the specificity, stability, and feasibility of [125I]RTI-55 for use in radioligand binding assays in postmortem human tissue, a series of experiments were performed characterizing [125I]RTI-55 binding sites in human brain using homogenized membrane preparations and quantitative autoradiography. Analysis of the association, dissociation, and saturation data favored two-phase processes. A curve-fitting analysis of the data derived in saturation experiments found a high-affinity site with KD = 66 +/- 35 pM and Bmax = 13.2 +/- 10.1 pmol/g of tissue and a low-affinity site with KD = 1.52 +/- 0.55 nM and Bmax of 47.5 +/- 11.2 pmol/g of tissue. Competition by ligands known to bind to the dopamine transporter showed a rank order of RTI-55 > GBR-12909 > maxindol > WIN 35428 > = methylphenidate > (-)-cocaine > buproprion > (+)-amphetamine. Binding to serotonergic sites was evaluated in the midbrain. Results of the saturation experiment performed autoradiographically in the midbrain showed a single site with KD = 370 +/- 84 pM. It appears that [125I]RTI-55 should be useful in further studies of the regulation of cocaine binding sites using postmortem human specimens.

  18. Children's television exposure and behavioral and social outcomes at 5.5 years: does timing of exposure matter?

    Science.gov (United States)

    Mistry, Kamila B; Minkovitz, Cynthia S; Strobino, Donna M; Borzekowski, Dina L G

    2007-10-01

    The American Academy of Pediatrics recommends children > or = 2 years of age limit daily media exposure to media exposure influences children's health. Our goal was to examine relations among children's early, concurrent, and sustained television exposure and behavioral and social skills outcomes at 5.5 years. We analyzed data collected prospectively from the Healthy Steps for Young Children national evaluation. Television exposure was defined as > 2 hours of daily use (at 30-33 months and 5.5 years) and television in child's bedroom (at 5.5 years). At 5.5 years, outcomes were assessed by using the Child Behavior Checklist and social skills using the Social Skills Rating System. Linear regression was used to estimate the effect of television exposure on behavioral and social skills outcomes. Sixteen percent of parents reported that their child watched > 2 hours of television daily at 30 to 33 months only, 15% reported > 2 hours of television daily at 5.5 years only, and 20% reported > 2 hours of television daily at both times. Forty-one percent of the children had televisions in their bedrooms at 5.5 years. In adjusted analyses, sustained television viewing was associated with behavioral outcomes. Concurrent television exposure was associated with fewer social skills. For children with heavy television viewing only in early childhood, there was no consistent relation with behavioral or social skills outcomes. Having a television in the bedroom was associated with sleep problems and less emotional reactivity at 5.5 years but was not associated with social skills. Sustained exposure is a risk factor for behavioral problems, whereas early exposure that is subsequently reduced presents no additional risk. For social skills, concurrent exposure was more important than sustained or early exposure. Considering the timing of media exposure is vital for understanding the consequences of early experiences and informing prevention strategies.

  19. Successional pattern of phytoplankton (>55μm in Lekki lagoon, Nigeria

    Directory of Open Access Journals (Sweden)

    Taofikat Abosede Adesalu

    2012-03-01

    Full Text Available Lagoons are dominant features along large stretches of the West Africa coast. These freshwater environments are very valuable areas where phytoplankton constitute the basis of aquatic food webs. In order to know the effects of environmental variables on phytoplankton, a study of the successional pattern of phytoplankton in Lekki lagoon was carried out monthly for two years (June 2003-May 2005. Phytoplankton samples were collected from 12 stations using a plankton net of 55μm mesh, and samples preserved in 4% unbuffered formalin. Besides, surface water samples were taken for physico-chemical analysis. For each year, the seasonal distribution and succession of dominant phytoplankton followed different patterns. Phytoplankton abundance was higher during the dry season (November-April for the two annual cycles. The diatoms (Aulacoseira granulate and A. granulata var angustissima and blue green algaes, Microcystis aeruginosa, Merismopedia tennuissima and Trichodesmium lacustre showed this trend by being the abundant species in some of these months. For the rainy season, the green alga Mougeotia sp. dominated. The replacement of one form by another throughout seasonal cycles was probably controlled by the changes in environmental variables such as rainfall, nitratenitrogen and phosphate-phosphorus.La costa oeste de África se caracteriza por la dominancia de lagunas, como ambientes de agua dulce tienen un gran valor, en donde el fitoplancton constituye la base de las cadenas tróficas acuáticas. Con el objetivo de conocer el efecto de las variables ambientales en el fitoplancton, se llevó a cabo un estudio sucesional mensual del fitoplancton, en la laguna Lekki, durante dos años (junio 2003-mayo 2005. En 12 estaciones, se obtuvieron muestras de fitoplancton mediante una red de plancton que tiene una malla de 55μm, que posteriormente fueron preservadas en formalina al 4%. Además, se tomaron muestras de agua superficial, para análisis f

  20. Completion Report for Model Evaluation Well ER-5-5: Corrective Action Unit 98: Frenchman Flat

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Underground Test Area and Boreholes Programs and Operations

    2013-01-18

    Model Evaluation Well ER-5-5 was drilled for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office in support of Nevada Environmental Management Operations at the Nevada National Security Site (formerly known as the Nevada Test Site). The well was drilled in July and August 2012 as part of a model evaluation well program in the Frenchman Flat area of Nye County, Nevada. The primary purpose of the well was to provide detailed geologic, hydrogeologic, chemical, and radiological data that can be used to test and build confidence in the applicability of the Frenchman Flat Corrective Action Unit flow and transport models for their intended purpose. In particular, this well was designed to obtain data to evaluate the uncertainty in model forecasts of contaminant migration from the upgradient underground nuclear test MILK SHAKE, conducted in Emplacement Hole U-5k in 1968, which were considered to be uncertain due to the unknown extent of a basalt lava-flow aquifer present in this area. Well ER-5-5 is expected to provide information to refine the Phase II Frenchman Flat hydrostratigraphic framework model, if necessary, as well as to support future groundwater flow and transport modeling. The 31.1-centimeter (cm) diameter hole was drilled to a total depth of 331.3 meters (m). The completion string, set at the depth of 317.2 m, consists of 16.8-cm stainless-steel casing hanging from 19.4-cm carbon-steel casing. The 16.8-cm stainless-steel casing has one slotted interval open to the basalt lava-flow aquifer and limited intervals of the overlying and underlying alluvial aquifer. A piezometer string was also installed in the annulus between the completion string and the borehole wall. The piezometer is composed of 7.3-cm stainless-steel tubing suspended from 6.0-cm carbon-steel tubing. The piezometer string was landed at 319.2 m, to monitor the basalt lava-flow aquifer. Data collected during and shortly after hole construction include