WorldWideScience

Sample records for scandium 39

  1. Scandium recovery from slags after oxidized nickel ore processing

    Science.gov (United States)

    Smyshlyaev, Denis; Botalov, Maxim; Bunkov, Grigory; Rychkov, Vladimir; Kirillov, Evgeny; Kirillov, Sergey; Semenishchev, Vladimir

    2017-09-01

    One of the possible sources of scandium production - waste (slags) from processing of oxidized nickel ores, has been considered in present research work. The hydrometallurgical method has been selected as the primary for scandium extraction. Different reagents for leaching of scandium, such as sulfuric acid, various carbonate salts and fluorides, have been tested. Sulfuric acid has been recognized as an optimal leaching reagent. Sulfuric acid concentration of 100 g L-1 allowed recovering up to 97 % of scandium.

  2. Influence of scandium concentration on power generation figure of merit of scandium aluminum nitride thin films

    Energy Technology Data Exchange (ETDEWEB)

    Akiyama, Morito; Nagase, Toshimi [Measurement Solution Research Center, National Institute of Advanced Industrials Science and Technology, Tosu, Saga 841-0052 (Japan); Umeda, Keiichi; Honda, Atsushi [Murata Manufacturing Co., Ltd., Nagaokakyo, Kyoto 617-8555 (Japan)

    2013-01-14

    The authors have investigated the influence of scandium concentration on the power generation figure of merit (FOM) of scandium aluminum nitride (Sc{sub x}Al{sub 1-x}N) films prepared by cosputtering. The power generation FOM strongly depends on the scandium concentration. The FOM of Sc{sub 0.41}Al{sub 0.59}N film was 67 GPa, indicating that the FOM is five times larger than that of AlN. The FOM of Sc{sub 0.41}Al{sub 0.59}N film is higher than those of lead zirconate titanate and Pb(Mg{sub 1/3}Nb{sub 2/3})O{sub 3}-PbTiO{sub 3} films, which is the highest reported for any piezoelectric thin films. The high FOM of Sc{sub 0.41}Al{sub 0.59}N film is due to the high d{sub 31} and the low relative permittivity.

  3. Lifetime measurements and oscillator strengths in singly ionized scandium and the solar abundance of scandium

    Science.gov (United States)

    Pehlivan Rhodin, A.; Belmonte, M. T.; Engström, L.; Lundberg, H.; Nilsson, H.; Hartman, H.; Pickering, J. C.; Clear, C.; Quinet, P.; Fivet, V.; Palmeri, P.

    2017-12-01

    The lifetimes of 17 even-parity levels (3d5s, 3d4d, 3d6s and 4p2) in the region 57 743-77 837 cm-1 of singly ionized scandium (Sc II) were measured by two-step time-resolved laser induced fluorescence spectroscopy. Oscillator strengths of 57 lines from these highly excited upper levels were derived using a hollow cathode discharge lamp and a Fourier transform spectrometer. In addition, Hartree-Fock calculations where both the main relativistic and core-polarization effects were taken into account were carried out for both low- and high-excitation levels. There is a good agreement for most of the lines between our calculated branching fractions and the measurements of Lawler & Dakin in the region 9000-45 000 cm-1 for low excitation levels and with our measurements for high excitation levels in the region 23 500-63 100 cm-1. This, in turn, allowed us to combine the calculated branching fractions with the available experimental lifetimes to determine semi-empirical oscillator strengths for a set of 380 E1 transitions in Sc II. These oscillator strengths include the weak lines that were used previously to derive the solar abundance of scandium. The solar abundance of scandium is now estimated to logε⊙ = 3.04 ± 0.13 using these semi-empirical oscillator strengths to shift the values determined by Scott et al. The new estimated abundance value is in agreement with the meteoritic value (logεmet = 3.05 ± 0.02) of Lodders, Palme & Gail.

  4. Smelting of Scandium by Microwave Irradiation.

    Science.gov (United States)

    Fujii, Satoshi; Tsubaki, Shuntaro; Inazu, Naomi; Suzuki, Eiichi; Wada, Yuji

    2017-09-27

    Scandium is being explored as an alloying element for aluminum alloys, which are gaining importance as high-performance lightweight structural alloys in the transportation industry. A few years ago, Sc was also found to be suitable for use in electrical devices. High-Sc-content ScAlN thin films have attracted significant attention because of their strong piezoelectricity. The piezoelectric response of ScAlN suggests that ScAlN thin films formed on a hard substrate would be suitable surface acoustic wave wideband filters for next-generation wireless communication systems. However, it is often difficult to use ScAlN thin films in MEMS devices-including acoustic ones-because of the extremely high price of metallic Sc, given the difficulty associated with smelting it. Here, we propose a novel process for smelting Sc metal by microwave irradiation. Sc metal was able to be obtained successfully from ScF₃ through a microwave-irradiation-based carbon reduction reaction. The reaction temperature for this reduction process was approximately 880°C, which is half of that for the conventional smelting process involving reduction with Ca. Thus, the proposed microwave irradiation process has significant potential for use in the smelting of Sc metal.

  5. Smelting of Scandium by Microwave Irradiation

    Directory of Open Access Journals (Sweden)

    Satoshi Fujii

    2017-09-01

    Full Text Available Scandium is being explored as an alloying element for aluminum alloys, which are gaining importance as high-performance lightweight structural alloys in the transportation industry. A few years ago, Sc was also found to be suitable for use in electrical devices. High-Sc-content ScAlN thin films have attracted significant attention because of their strong piezoelectricity. The piezoelectric response of ScAlN suggests that ScAlN thin films formed on a hard substrate would be suitable surface acoustic wave wideband filters for next-generation wireless communication systems. However, it is often difficult to use ScAlN thin films in MEMS devices—including acoustic ones—because of the extremely high price of metallic Sc, given the difficulty associated with smelting it. Here, we propose a novel process for smelting Sc metal by microwave irradiation. Sc metal was able to be obtained successfully from ScF3 through a microwave-irradiation-based carbon reduction reaction. The reaction temperature for this reduction process was approximately 880°C, which is half of that for the conventional smelting process involving reduction with Ca. Thus, the proposed microwave irradiation process has significant potential for use in the smelting of Sc metal.

  6. Hydrometallurgical methods of recovery of scandium from the wastes of various technologies

    Science.gov (United States)

    Molchanova, T. V.; Akimova, I. D.; Smirnov, K. M.; Krylova, O. K.; Zharova, E. V.

    2017-03-01

    The recovery of scandium from the wastes of the production of uranium, titanium, iron-vanadium, and alumina is studied. The applied acid schemes of scandium transfer to a solution followed by ion-exchange recovery and extraction concentration of scandium ensure the precipitation of crude scandium oxides containing up to 5% Sc2O3. Scandium oxides of 99.96-99.99% purity are formed after additional refining of these crude oxides according to an extraction technology using a mixture 15% multiradical phosphine oxide or Cyanex-925 + 15% tributyl phosphate in kerosene.

  7. Synthesis and Reactivity of a Scandium Terminal Hydride: H2  Activation by a Scandium Terminal Imido Complex.

    Science.gov (United States)

    Han, Xianghao; Xiang, Li; Lamsfus, Carlos A; Mao, Weiqing; Lu, Erli; Maron, Laurent; Leng, Xuebing; Chen, Yaofeng

    2017-10-20

    Dihydrogen is easily activated by a scandium terminal imido complex containing the weakly coordinated THF. The reaction proceeds through a 1,2-addition mechanism, which is distinct from the σ-bond metathesis mechanism reported to date for rare-earth metal-mediated H2 activation. This reaction yields a scandium terminal hydride, which is structurally well-characterized, being the first one to date. The reactivity of this hydride is reported with unsaturated substrates, further shedding light on the existence of the terminal hydride complex. Interestingly, the H2 activation can be reversible. DFT investigations further eludciate the mechanistic aspects of the reactivity of the scandium anilido-terminal hydride complex with PhNCS but also on the reversible H2 activation process. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Thermoelectric material comprising scandium doped zinc cadmium oxide

    DEFF Research Database (Denmark)

    2016-01-01

    There is presented a composition of scandium doped Zinc Cadmium Oxide with the general formula ZnzCdxScyO which the inventors have prepared, and for which material the inventors have made the insight that it is particularly advantageous as an n-type oxide material, such as particularly advantageous...

  9. Scandium/carbon filters for soft x rays

    NARCIS (Netherlands)

    Artioukov, IA; Kasyanov, YS; Kopylets, IA; Pershin, YP; Romanova, SA

    2003-01-01

    This Note deals with thin-film soft x-ray filters for operation at the wavelengths near carbon K edge (similar to4.5 nm). The filters were fabricated by magnetron sputtering deposition of thin layers of scandium (total thickness 0.1-0.2 mum) onto films of polypropylene (thickness 1.5 mum) and

  10. Solvent extraction of scandium from lateritic nickel- cobalt ores using different organic reagents

    OpenAIRE

    Ferizoğlu Ece; Kaya Şerif; Topkaya Yavuz A.

    2016-01-01

    Scandium is the most important and strategic metal that can be recovered as a by-product from lateritic nickel-cobalt ores. In this research, different extractants were investigated in order to extract scandium from a sulfate medium by a using a solvent extraction method. Generally, the organic extractants are classified as acidic, neutral and basic organophosphorus compounds. However, in solvent extraction of scandium, the acidic and neutral organophosphorus compounds are preferred due to th...

  11. BASIC RESEARCH ON THE SEPARATION OF SCANDIUM YTTRIUM, AND THE RARE EARTHS BY SOLVENT EXTRACTION.

    Science.gov (United States)

    RARE EARTH ELEMENTS, * SOLVENT EXTRACTION ), (*CHELATE COMPOUNDS, RARE EARTH ELEMENTS), PURIFICATION, ATOMIC SPECTROSCOPY, SCANDIUM, YTTRIUM, PRASEODYMIUM, SAMARIUM, EUROPIUM, GADOLINIUM, TERBIUM, FLUORINE COMPOUNDS, KETONES

  12. Determination of scandium concentrate composition by WD-XRF and ICP-MS methods

    Science.gov (United States)

    Sarkisova, A. S.; Shibitko, A. O.; Abramov, A. V.; Rebrin, O. I.; Bunkov, G. M.; Lisienko, D. G.

    2017-09-01

    WD-XRF spectroscopy was applied for determining composition of scandium concentrate (ScC) containing 70 % scandium fluoride. Determination of ScC composition was performed using 6 glass beads reference materials produced by fusing synthesized mixture of analyte compounds with the lithium-borate flux in the ratio of 1:10. ScC powder with the known composition was then used as a powder pellet reference material to analyze scandium concentrate from technological line by external standard method. ICP-MS method was employed to control the ScC composition. The statistical data processing and metrological parameters evaluation of the analytical technique developed were carried out.

  13. Tin etching from metallic and oxidized scandium thin films

    Science.gov (United States)

    Pachecka, M.; Lee, C. J.; Sturm, J. M.; Bijkerk, F.

    2017-08-01

    The role of oxide on Sn adhesion to Sc surfaces was studied with in-situ ellipsometry, X-ray photoelectron spectroscopy and secondary electron microscopy. Sn etching with hydrogen radicals was performed on metallic Sc, metallic Sc with a native oxide, and a fully oxidized Sc layer. The results show that Sn adsorbs rather weakly to a non-oxidized Sc surface, and is etched relatively easily by atomic hydrogen. In contrast, the presence of native oxide on Sc allows Sn to adsorb more strongly to the surface, slowing the etching. Furthermore, thinner layers of scandium oxide result in weaker Sn adsorption, indicating that the layer beneath the oxide plays a significant role in determining the adsorption strength. Unexpectedly, for Sn on Sc2O3, and, to a lesser extent, for Sn on Sc, the etch rate shows a variation over time, which is explained by surface restructuring, temperature change, and hydrogen adsorption saturation.

  14. Tin etching from metallic and oxidized scandium thin films

    Directory of Open Access Journals (Sweden)

    M. Pachecka

    2017-08-01

    Full Text Available The role of oxide on Sn adhesion to Sc surfaces was studied with in-situ ellipsometry, X-ray photoelectron spectroscopy and secondary electron microscopy. Sn etching with hydrogen radicals was performed on metallic Sc, metallic Sc with a native oxide, and a fully oxidized Sc layer. The results show that Sn adsorbs rather weakly to a non-oxidized Sc surface, and is etched relatively easily by atomic hydrogen. In contrast, the presence of native oxide on Sc allows Sn to adsorb more strongly to the surface, slowing the etching. Furthermore, thinner layers of scandium oxide result in weaker Sn adsorption, indicating that the layer beneath the oxide plays a significant role in determining the adsorption strength. Unexpectedly, for Sn on Sc2O3, and, to a lesser extent, for Sn on Sc, the etch rate shows a variation over time, which is explained by surface restructuring, temperature change, and hydrogen adsorption saturation.

  15. Extraction of scandium by liquid di-2-ethylhexylphosphoric acid in fusible diluents

    Directory of Open Access Journals (Sweden)

    Ainur Isatayeva

    2015-03-01

    Full Text Available Currently widespread distribution of extraction methods using fusible reagents can be explained by a number of advantages, such as high kinetic characteristics of the process, the ease separation of two phases, high selectivity of many extractants, relatively complete regeneration. For the extraction of scandium in technological order, neutral and cation exchange extractants can be used. Several extraction reagents melt easily at high temperatures, and such melts can be used for extraction. Efficiency of the extraction of metal by cation reagents depends on many factors. Extraction of scandium by melt mixtures of di-2-ethylhexylphosphoric acid - higher carboxylic acid - paraffin and the effect of acidity of the aqueous phase, the concentration of scandium and the aqueous extractant in the organic phase, the volume ratio of organic and aqueous phases on the extraction of metal were studied. It was found that the extraction of scandium proceeds through the cation exchange mechanism. Scandium was extracted quantitatively (> 99.0% from acid solutions. The optimal concentration of di-2-ethylhexylphosphoric acid in the extractant was 0,250 M, quantitative extraction of scandium was observed in the range of its concentrations of 10-3-10-6 M and the volume ratio of organic phases to aqueous phases of 1:5 - 1:20.

  16. Scandium functionalized carbon aerogel: Synthesis of nanoparticles and structure of a new ScOCl and properties of NaAlH{sub 4} as a function of pore size

    Energy Technology Data Exchange (ETDEWEB)

    Javadian, Payam; Nielsen, Thomas K. [Center for Energy Materials, Interdisciplinary Nanoscience Center (iNANO), and Department of Chemistry, Aarhus University, DK-8000 Aarhus (Denmark); Ravnsbæk, Dorthe B. [Department of Material Science and Engineering, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge 02142, MA (United States); Jepsen, Lars H. [Center for Energy Materials, Interdisciplinary Nanoscience Center (iNANO), and Department of Chemistry, Aarhus University, DK-8000 Aarhus (Denmark); Polanski, Marek [Faculty of Advanced Technology and Chemistry, Military University of Technology, 2 Kaliskiego Str., 00-908 Warsaw (Poland); Plocinski, Tomasz [Faculty of Material Science and Engineering, Warsaw University of Technology, 144 Woloska Str., 02-507 Warsaw (Poland); Kunce, Izabela [Faculty of Advanced Technology and Chemistry, Military University of Technology, 2 Kaliskiego Str., 00-908 Warsaw (Poland); Besenbacher, Flemming [Interdisciplinary Nanoscience Center (iNANO) and Department of Physics and Astronomy, Aarhus University, DK-8000 Aarhus C (Denmark); Bystrzycki, Jerzy [Faculty of Advanced Technology and Chemistry, Military University of Technology, 2 Kaliskiego Str., 00-908 Warsaw (Poland); Jensen, Torben R., E-mail: trj@chem.au.dk [Center for Energy Materials, Interdisciplinary Nanoscience Center (iNANO), and Department of Chemistry, Aarhus University, DK-8000 Aarhus (Denmark)

    2015-11-15

    A new method for scandium-functionalization of carbon aerogels forming nanoparticles of a new scandiumoxochloride, ScOCl is presented. Sodium aluminiumhydride, NaAlH{sub 4}, is successfully melt infiltrated into the nano porous scaffolds with pore sizes of D{sub max}=7, 10, 13, 21, 26 and 39 nm, containing scandium based nano particles (<2.9 wt%) confirmed by elemental analysis and scanning electron microscopy. A systematic study of hydrogen storage properties of the nano composite materials is presented. An aqueous solution of ScCl{sub 3} was initially infiltrated and formed nanoconfined [Sc(OH)(H{sub 2}O){sub 5}]{sub 2}Cl{sub 4}(H{sub 2}O){sub 2}, which transforms to nanoparticles of a new scandium oxochloride, ScOCl at 192 °C and to Sc{sub 2}O{sub 3} at 420 °C. ScOCl crystallizes in an orthorhombic unit cell a=3.4409(8), b=3.9613(6) and c=8.178(2) Å, space group Pmmn, and is built from layers of [ScO{sub 4}Cl{sub 2}] octahedra forming neutral ScOCl layers. Temperature programmed desorption mass spectroscopy shows slightly improved kinetics for release of hydrogen with decreasing pore size. Continuous cycling of hydrogen release and uptake measured by the Sieverts' method reveal a larger preserved hydrogen storage capacity for scandium-functionalized aerogel with the larger pores (39 nm). - Highlights: • New synthesis approach for nanoporous Sc-functionalization carbon aerogel (Sc-CA). • The new scandium oxochloride, ScOCl, structure is obtained. • NaAlH{sub 4} nanoconfined in Sc-CA with pores ranging between 7 nm39 nm. • Improved H{sub 2} release kinetics obtained with decreasing pore size. • Nanoconfinement (D{sub max}=39 nm) retains 71% of the H{sub 2} capacity after four cycles.

  17. Thermodynamic and kinetic study of scandium(III) complexes of DTPA and DOTA: a step toward scandium radiopharmaceuticals.

    Science.gov (United States)

    Pniok, Miroslav; Kubíček, Vojtěch; Havlíčková, Jana; Kotek, Jan; Sabatie-Gogová, Andrea; Plutnar, Jan; Huclier-Markai, Sandrine; Hermann, Petr

    2014-06-23

    Diethylenetriamine-N,N,N',N'',N''-pentaacetic acid (DTPA) and 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA) scandium(III) complexes were investigated in the solution and solid state. Three (45)Sc NMR spectroscopic references suitable for aqueous solutions were suggested: 0.1 M Sc(ClO4)3 in 1 M aq. HClO4 (δSc =0.0 ppm), 0.1 M ScCl3 in 1 M aq. HCl (δSc =1.75 ppm) and 0.01 M [Sc(ox)4](5-) (ox(2-) = oxalato) in 1 M aq. K2C2O4 (δSc =8.31 ppm). In solution, [Sc(dtpa)](2-) complex (δSc = 83 ppm, Δν = 770 Hz) has a rather symmetric ligand field unlike highly unsymmetrical donor atom arrangement in [Sc(dota)](-) anion (δSc = 100 ppm, Δν = 4300 Hz). The solid-state structure of K8[Sc2(ox)7]⋅13 H2O contains two [Sc(ox)3](3-) units bridged by twice "side-on" coordinated oxalate anion with Sc(3+) ion in a dodecahedral O8 arrangement. Structures of [Sc(dtpa)](2-) and [Sc(dota)](-) in [(Hguanidine)]2[Sc(dtpa)]⋅3 H2O and K[Sc(dota)][H6 dota]Cl2⋅4 H2O, respectively, are analogous to those of trivalent lanthanide complexes with the same ligands. The [Sc(dota)](-) unit exhibits twisted square-antiprismatic arrangement without an axial ligand (TSA' isomer) and [Sc(dota)](-) and (H6 dota)(2+) units are bridged by a K(+) cation. A surprisingly high value of the last DOTA dissociation constant (pKa =12.9) was determined by potentiometry and confirmed by using NMR spectroscopy. Stability constants of scandium(III) complexes (log KScL 27.43 and 30.79 for DTPA and DOTA, respectively) were determined from potentiometric and (45)Sc NMR spectroscopic data. Both complexes are fully formed even below pH 2. Complexation of DOTA with the Sc(3+) ion is much faster than with trivalent lanthanides. Proton-assisted decomplexation of the [Sc(dota)](-) complex (τ1/2 =45 h; 1 M aq. HCl, 25 °C) is much slower than that for [Ln(dota)](-) complexes. Therefore, DOTA and its derivatives seem to be very suitable ligands for scandium

  18. Effects of iron on intermetallic compound formation in scandium modified Al–Si–Mg Alloys

    Energy Technology Data Exchange (ETDEWEB)

    Patakham, Ussadawut [National Metal and Materials Technology Center, National Science and Technology Development Agency, 114 Thailand Science Park, Klong Nueng, Klong Luang, Pathumthani 12120 (Thailand); Limmaneevichitr, Chaowalit, E-mail: chaowalit.lim@mail.kmutt.ac.th [Production Engineering Department, Faculty of Engineering, King Mongkut’s University of Technology Thonburi, 126 Pracha-Utid Rd., Bangmod, Tungkhru, Bangkok 10140 (Thailand)

    2014-12-15

    Highlights: • Iron reduces the modification effects of scandium in Al–Si–Mg alloys. • Morphologies of Sc-rich intermetallic phases vary with Fe and Sc contents and the cooling rates. • Sc neutralizes effects of Fe by changing Fe-rich intermetallic phases from platelets to more cubic. - Abstract: In general, iron has a strong tendency to dissolve in molten aluminum. Iron has very low solid solubility in aluminum–silicon casting alloys, so it will form intermetallic compounds that cause detrimental effects on mechanical properties. In this work, the effects of iron on intermetallic compound formations in scandium modified Al–Si–Mg alloys were studied. There were two levels of iron addition (0.2 and 0.4 wt.%) and two levels of scandium addition (0.2 and 0.4 wt.%). We found that the effects of scandium modification decreased with increasing iron addition. The morphologies of the complex intermetallic compounds were characterized by scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS) and electron backscatter diffraction (EBSD) techniques. It was found that scandium changes the morphology of Fe-rich intermetallic compounds from β-phase (plate-like) to α-phase, which reduces the harmful effects of β-phase.

  19. Solvent extraction of scandium from lateritic nickel- cobalt ores using different organic reagents

    Directory of Open Access Journals (Sweden)

    Ferizoğlu Ece

    2016-01-01

    Full Text Available Scandium is the most important and strategic metal that can be recovered as a by-product from lateritic nickel-cobalt ores. In this research, different extractants were investigated in order to extract scandium from a sulfate medium by a using a solvent extraction method. Generally, the organic extractants are classified as acidic, neutral and basic organophosphorus compounds. However, in solvent extraction of scandium, the acidic and neutral organophosphorus compounds are preferred due to their higher extraction efficiencies. Thus, the aim of the present study was to compare the scandium extraction efficiencies of some acidic and neutral organic reagents. For this reason, Ionquest 290 (Bis(2,4,4-trimethylpenthyl phosphonic acid, DEHPA (Di(2-ethylhexyl phosphoric acid, Cyanex 272 ((Bis(2,4,4-trimethylpentyl phosphinic acid which are acidic organophosphorus compounds, and Cyanex 923 (Trialkylphosphine oxide, which is a neutral organophosphorus compound, were used. The extraction capacities of these organics were studied with respect to the extractant concentration at same pH and phase ratio. As a result of the study, DEHPA was found to have higher scandium extraction efficiency with lower iron extraction at pH = 0.55 at a phase ratio of 10:1 = A:O.

  20. Correlation between stoichiometry and properties of scandium oxide films prepared by reactive magnetron sputtering

    Science.gov (United States)

    Belosludtsev, Alexandr; Juškevičius, Kęstutis; Ceizaris, Lukas; Samuilovas, Romanas; Stanionytė, Sandra; Jasulaitienė, Vitalija; Kičas, Simonas

    2018-01-01

    Scandium oxide films were deposited on fused silica substrates by reactive pulsed DC magnetron sputtering. The use of feed-back optical emission monitoring enabled high-rate reactive deposition of films with tunable stoichiometry and properties. The under-stoichiometric, stoichiometric and over-stoichiometric scandium oxide films were prepared. The compressive stress in films was between 235 and 530 MPa. We showed that phase structure, density, surface roughness and optical properties of the scandium oxide are affected by the film stoichiometry and deposition conditions. Transparent scandium oxide films were slightly hydrophobic (94 ± 3°), homogeneous with a crystallite size of 20 ± 5 nm. The lowest extinction coefficient 0.7 × 10-3, the highest refractive index 2.08 (both quantities at the wavelength of 355 nm) and the highest density 4.1 ± 0.1 g cm-3 exhibited film prepared with the stoichiometric composition. Stoichiometric scandium oxide can be used in various optical applications as high refractive index and wide bandgap material. Transitions to under- or over-stoichiometry lead to a decrease of film density, refractive index and increase of the extinction coefficient.

  1. Mossbauer investigation of scandium oxide-hematite nanoparticles

    Science.gov (United States)

    Allwes, Mark; Sorescu, Monica

    Scandium oxide-doped hematite, xSc2O3*(1-x)alpha-Fe2O3 with molar concentration x =0.1, 0.3, and 0.5 was prepared by using ball milling, taking samples at times 0, 2, 4, 8, and 12 hours. The resulting Mossbauer spectra of the nanoparticles systems were parameterized using NORMOS-90. For each concentration, the spectra at 0 hours only consisted of 1 sextet, as the substitution of Sc2O3into Fe2O3 did not appear until after 2 hours of ball milling time (BMT). Concentration x =0.1 at BMT 2hours consisted of 2 sextets while x =0.3 and 0.5 were fit with 1 sextet and 1 quadrupole-split doublet. Concentration x =0.1 at BMT 4 and 8 hours consisted of 3 sextets, and at BMT 12 hours consisted of 4 sextets. For concentrations x =0.3 and 0.5 at BMT 4, 8, and 12 hours the spectra were fit with 3 sextets and 1 quadrupole-split doublet. With increasing initial concentration, the appearance of the quadrupole-split doublet became more pronounced, indicating the substitution of Fe into Sc2O3 occurred. But for x =0.1, the BMT did influence the number of sextets needed, causing an increase in substitution of Sc2O3 into Fe2O3.

  2. Association between toenail scandium levels and risk of acute myocardial infarction in European men: The EURAMIC and Heavy Metals Study

    NARCIS (Netherlands)

    Gómez-Aracena, J.; Martin-Moreno, J.M.; Riemersma, R.A.; Bode, P.; Gutiérrez-Bedmar, M.; Gorgojo, L.; Kark, J.D.; Garcia-Rodríguez, A.; Gomez-Gracia, E.; Kardinaal, A.F.M.; Aro, A.; Veer, P. van 't; Wedel, H.; Kok, F.J.; Fernández-Crehuet, J.

    2002-01-01

    The association between scandium status and risk of acute myocardial infarction (MI) was examined in a multicentre case control study in 10 centres from Europe and Israel. Scandium in toenails was assessed in 684 cases and 724 controls less than 70 years of age. Mean concentrations of toenail

  3. In-source laser spectroscopy developments at TRILIS-towards spectroscopy on actinium and scandium

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, Sebastian, E-mail: raeder@triumf.ca; Dombsky, Marik; Heggen, Henning; Lassen, Jens; Quenzel, Thomas [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Sjoedin, Marica [GANIL (France); Teigelhoefer, Andrea [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Wendt, Klaus [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik (Germany)

    2013-04-15

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm{sup - 1} which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  4. Process and Mechanical Properties: Applicability of a Scandium modified Al-alloy for Laser Additive Manufacturing

    Science.gov (United States)

    Schmidtke, K.; Palm, F.; Hawkins, A.; Emmelmann, C.

    The applicability of an aluminium alloy containing scandium for laser additive manufacturing (LAM) is considered. Modified aluminium alloys with a scandium content beyond the eutectic point offer great potential to become a high prioritized aerospace material. Depending on other alloying elements like magnesium or zirconium, strongly required weight reduction, corrosion resistance and improved strength properties of metallic light weight alloys can be achieved. The development, production and testing of parts built up by a laser powder bed process will be presented with regard to the qualification of the new material concept "ScalmalloyRP®" for laser additive manufacturing.

  5. Synthesis and structural characterization of scandium SALEN complexes.

    Science.gov (United States)

    Meermann, Christian; Sirsch, Peter; Törnroos, Karl W; Anwander, Reiner

    2006-02-28

    A series of heteroleptic scandium SALEN complexes, [(SALEN)Sc(mu-Cl)]2 and (SALEN)Sc[N(SiHMe2)2] is obtained via amine elimination reactions using [Sc(N(i)Pr2)2(mu-Cl)(THF)]2 and Sc[N(SiHMe2)2]3(THF) as metal precursors, respectively. H(2)SALEN ligand precursors comprising H2Salen [(1,2-ethandiyl)bis(nitrilomethylidyne)bis(2,4-di-tert-butyl)phenol], H2Salpren [(2,2-dimethylpropanediyl)bis(nitrilomethylidyne)bis(2,4-di-tert-butyl)phenol], H2Salcyc [(1R,2R)-(-)-1,2-cyclohexanediyl)bis(nitrilomethylidyne)bis(2,4-di-tert-butyl)phenol] and H2Salphen [((1S,2S)-(-)-1,2-diphenylethandiyl)bis(nitrilomethylidyne)bis(2,4-di-tert-butyl)phenol] are selected according to solubility and ligand backbone variation ("=N-(R)-N=" bite angle) criteria. Consideration is given to the feasibility of [Cl --> NR2] and [N(SiHMe2)2--> OSiR3] secondary ligand exchange reactions. X-ray crystal structure analyses of donor-free (Salpren)Sc(N(i)Pr2), (R,R)-(Salcyc)Sc[N(SiHMe2)2], (Salen)Sc(OSi(t)BuPh2) and (Salphen)Sc(OSiH(t)Bu2) reveal (i) a very short Sc-N bond distance of 2.000(3) A, (ii) weak beta(Si-H)(amido)-Sc agostic interactions and (iii) an exclusive intramolecularly tetradentate and intrinsically bent coordination mode of the SALEN ligands with angle(Ph,Ph) dihedral angles and Sc-[N(2)O(2)] distances in the 124.27(9)-127.7(3) degrees and 0.638(1)-0.688(1) A range, respectively.

  6. Scandium SALEN complexes bearing chloro, aryloxo, and hydroxo ligands.

    Science.gov (United States)

    Meermann, Christian; Törnroos, Karl W; Anwander, Reiner

    2009-03-16

    Heteroleptic amide complexes (SALEN)Sc[N(SiHMe(2))(2)] (SALEN = Salen(tBu,tBu), Salcyc(tBu,tBu), or Salpren(tBu,tBu) if not stated differently) were examined as synthesis precursors according to silylamine elimination reactions. Treatment of (SALEN)Sc[N(SiHMe(2))(2)] with H(2)O or phenols (HOAr(R,R); R = tBu, iPr) afforded complexes [(SALEN)Sc(mu-OH)](2) and (SALEN)Sc(OAr(R,R)), while chloro exchange products were formed from the respective reactions with NH(4)Cl or AlMe(2)Cl. Such complexes [(SALEN)Sc(mu-Cl)](2) and (SALEN)ScCl(thf) were also obtained by utilizing alternative synthesis protocols, allowing for controlled donor absence and presence. Heteroleptic amide precursors [Sc(NiPr(2))(2)(mu-Cl)(thf)](2) and [Sc[N(SiHMe(2))(2)](2)(mu-Cl)(thf)](2) readily undergo amine elimination reactions with H(2)SALEN derivatives to form the corresponding chloride complexes. Spectroscopic and X-ray structural data of the heteroleptic scandium complexes revealed an exclusive intramolecular tetradentate coordination mode of the SALEN ligands independent of the SALEN ligand bite angle and the nature of the "second" ligand (chloro, amido, aryloxo, hydroxo). The coordination of the SALEN ligands is rationalized on the basis of (a) the displacement d of the metal center from the [N(2)O(2)] least-squares plane, (b) the dihedral angle alpha between the phenyl rings of the salicylidene moieties, and (c) the angle beta = Ct-Ln-Ct (Ct = centroid of the phenyl rings) in the case of strongly twisted ligands.

  7. Vertical distribution of scandium in the north central Pacific

    Science.gov (United States)

    Amakawa, Hiroshi; Nomura, Miho; Sasaki, Kazunori; Oura, Yasuji; Ebihara, Mitsuru

    2007-06-01

    The concentrations of scandium (Sc) in seawater, which have remained unreported since the early 1970s, were determined together with those of yttrium (Y) and lanthanides (Ln) with samples from the north central Pacific Ocean (St. BO-3). The Sc concentration shows a so-called nutrient-like profile: it increases gradually from the surface (about 2 pmol/kg) to the ocean floor (about 20 pmol/kg). That pattern closely resembles those of Y and Ln (correlation coefficient (r) > 0.92). Some light-to-middle Ln (Pr-Tb) exhibit a closer correlation with Sc than do Y, La, or heavy Ln (Ho-Lu). In contrast, Y/Sc and Ln/Sc ratios (elemental abundance ratios) indicate that Sc is depleted compared to either Y or Ln in seawater more than in loess, which represents chemical compositions of crustal material. These observations offer a conflicting view of chemical reactivity related Y, Ln, and Sc: r values show that the chemical reactivity of Sc resembles those of Y and Ln, but differences of Y/Sc and Ln/Sc ratios in seawater and in loess suggest that the chemical reactivity of Sc differs from those of Y and Ln. More Sc data for seawater are necessary to clarify the chemical reactivity of Sc in the ocean. We also propose that comparative studies of vertical profiles of Sc and such elements as Fe, Ti, Zr, and Hf showing so-called nutrient-like profiles at the same oceanic stations would be helpful and effective for clarifying the behavior of Sc in the ocean.

  8. In situ observation of the reaction of scandium and carbon by neutron diffraction

    Energy Technology Data Exchange (ETDEWEB)

    Juarez-Arellano, Erick A., E-mail: eajuarez@unpa.edu.m [Institut fuer Geowissenschaften, Universitaet Frankfurt, Altenhoeferallee 1, 60438 Frankfurt a.M. (Germany); Universidad del Papaloapan, Circuito Central 200, Parque Industrial, Tuxtepec 68301 (Mexico); Winkler, Bjorn [Institut fuer Geowissenschaften, Universitaet Frankfurt, Altenhoeferallee 1, 60438 Frankfurt a.M. (Germany); Vogel, Sven C. [Los Alamos National Laboratory, Lujan Center. Mail Stop H805, Los Alamos, NM 87545 (United States); Senyshyn, Anatoliy [Forschungsneutronenquelle Heinz Maier-Leibnitz (FRM II), Technische Universitaet Muenchen, Lichtenbergstr. 1, D-85747 Garching (Germany); Materialwissenschaft, TU Darmstadt, Petersensstr. 23, D-64287 Darmstadt (Germany); Kammler, Daniel R. [Sandia National Laboratories, Albuquerque, NM 87185 (United States); Avalos-Borja, Miguel [CNyN, UNAM, A. Postal 2681, Ensenada, B.C. (Mexico)

    2011-01-05

    Research highlights: {yields} Exist two ScC cubic phases with B1-structure type differing in site occupancy of C. {yields} A new orthorhombic scandium carbide phase is formed at 1473(50) K. {yields} The recrystallization of alpha-Sc occurs between 1000 and 1223 K. - Abstract: The formation of scandium carbides by reaction of the elements has been investigated by in situ neutron diffraction up to 1823 K. On heating, the recrystallization of {alpha}-Sc occurs between 1000 and 1223 K. The formation of Sc{sub 2}C and ScC (NaCl-B1 type structure) phases has been detected at 1323 and 1373 K, respectively. The formation of a new orthorhombic scandium carbide phase was observed at 1473(50) K. Once the scandium carbides are formed they are stable upon heating or cooling. No other phases were detected in the present study, in which the system was always carbon saturated. The thermal expansion coefficients of all phases have been determined, they are constant throughout the temperature interval studied.

  9. The effects of aluminum or scandium on the toughness, density and ...

    African Journals Online (AJOL)

    The effects of the substitution of aluminum or scandium on the density, toughness as well as the stability of the phases formed by such an addition on platinum, iridium, rhodium and palladium metals were evaluated with the density functional quantum mechanical calculation methods. All the metals had four atoms per ...

  10. Effects of erbium‑and chromium‑doped yttrium scandium gallium ...

    African Journals Online (AJOL)

    2014-08-21

    Aug 21, 2014 ... surfaces because of its high power, and the ablation was deeper for these samples. High‑magnification SEM ... Key words: Erbium chromium‑doped yttrium scandium gallium garnet, diode laser, restorative dental materials, scanning electron ... garnet (Nd: YAG) and carbon dioxide (CO2) lasers on indirect ...

  11. Chemical and biological evaluation of scandium(III)-polyaminopolycarboxylate complexes as potential PET agents and radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Huclier-Markai, S.; Sabatie, A.; Ribet, S. [Univ. de Nantes (France). Lab. Subatech; Kubicek, V.; Hermann, P. [Charles Univ., Prague (Czech Republic). Dept. of Inorganic Chemistry; Paris, M. [Univ. de Nantes (France). Inst. des Materiaux; Vidaud, C. [CEA/DSV/iBEB/SBTN, Bagnols sur Ceze (France). Lab. d' Etude des Proteines Cibles; Cutler, C.S. [Univ. of Missouri, Columbia, MO (United States). Reserach Reactor Center

    2011-07-01

    Scandium isotopes ({sup 44}Sc, {sup 47}Sc) are more available and their properties are convenient for either PET imaging or radiotherapy. To use them in nuclear medicine, ligands forming complexes with a high stability are necessary. Available experimental data on stability constants for complexes of ligands such as EDTA, DTPA, DOTA, NOTA and TETA with various metal ions have been published. But scandium is the exception since scarce data is available in the literature. Values of stability constants of Sc(III) with the ligands were determined by free-ion selective radiotracer extraction, complemented by {sup 45}Sc NMR and potentiometry data. The thermodynamic stability of the Sc-complexes increases in the order TETA < NOTA < EDTA < DTPA < DOTA. The in vitro stability of the Sc(III) complexes was studied in the presence of hydroxyapatite and rat serum to estimate their in vivo stability. The most stable complex was shown to be Sc-DOTA.

  12. Precipitation behaviour and recrystallisation resistance in aluminum alloys with additions of hafnium, scandium and zirconium

    OpenAIRE

    Hallem, Håkon

    2005-01-01

    The overall objective of this work has been to develop aluminium alloys, which after hot and cold deformation are able to withstand high temperatures without recrystallising. This has been done by investigating aluminium alloys with various additions of hafnium, scandium and zirconium, with a main focus on Hf and to which extent it may partly substitute or replace Zr and/or Sc as a dispersoid forming elements in these alloys. What is the effect of hafnium, alone and in combination with Zr...

  13. Pilot-scale recovery of rare earths and scandium from phosphogypsum and uranium leachates

    Directory of Open Access Journals (Sweden)

    Mashkovtsev Maxim

    2016-01-01

    Full Text Available Ural Federal University (UrFU and VTT have performed joint research on development of industrial technologies for the extraction of REM and Scandium compounds from phosphogypsum and Uranium ISL leachate solutions. Leaching-absorption experiments at UrFU have been supported with multicomponent solution modelling by VTT. The simulations have been performed with VTT’s ChemSheet/Balas program and can be used for speciation calculations in the lixiviant solution. The experimental work combines solvent extraction with advanced ion exchange methodology in a pilot facility capable of treating 5 m3 solution per hour. Currently, the plant produces cerium carbonate, lanthanum oxide, neodymium oxide and concentrate of heavy rare earth metals. A batch of 45 t solids has been processed with the gain of 100 kg’s of REM concentrate. A mini-pilot plant with productivity above 50 liters per hour has been applied to recover scandium oxide and REE concentrates from the uranium ISL solution. As the preliminary product contains radioactivity (mainly strontium, an additional decontamination and cleaning of both concentrates by extraction has rendered a necessity. Finally a purified 99% concentrate of scandium oxide as well as 99% rare earth concentrate are received.

  14. Optimization of scandium oxide growth by high pressure sputtering on silicon

    Energy Technology Data Exchange (ETDEWEB)

    Feijoo, P.C., E-mail: pedronska@fis.ucm.es; Pampillon, M.A.; San Andres, E.; Lucia, M.L.

    2012-12-30

    This work demonstrates the viability of scandium oxide deposition on silicon by means of high pressure sputtering. Deposition pressure and radio frequency power are varied for optimization of the properties of the thin films and the ScO{sub x}/Si interface. The physical characterization was performed by ellipsometry, Fourier transform infrared spectroscopy, x-ray diffraction and transmission electron microscopy. Aluminum gate electrodes were evaporated for metal-insulator-semiconductor (MIS) fabrication. From the electrical characterization of the MIS devices, the density of interfacial defects is found to decrease with deposition pressure, showing a reduced plasma damage of the substrate surface for higher pressures. This is also supported by lower flatband voltage shifts in the capacitance versus voltage hysteresis curves. Sputtering at high pressures (above 100 Pa) reduces the interfacial SiO{sub x} formation, according to the infrared spectra. The growth rates decrease with deposition pressure, so a very accurate control of the layer thicknesses could be provided. - Highlights: Black-Right-Pointing-Pointer Scandium oxide is considered as a high permittivity dielectric. Black-Right-Pointing-Pointer Scandium oxide was deposited on Si by high pressure sputtering. Black-Right-Pointing-Pointer Characterization was performed for deposition condition optimization. Black-Right-Pointing-Pointer High deposition pressures showed higher film and interface quality.

  15. Recovery of Scandium from Leachate of Sulfation-Roasted Bayer Red Mud by Liquid-Liquid Extraction

    Science.gov (United States)

    Liu, Zhaobo; Li, Hongxu; Jing, Qiankun; Zhang, Mingming

    2017-11-01

    The leachate obtained from sulfation-roasted Bayer red mud is suitable for extraction of scandium by liquid-liquid solvent extraction because it contains trace amounts of Fe3+ and Si4+. In this study, a completely new metallurgical process for selective recovery of scandium from Bayer red mud was proposed. The extraction performances of Sc3+, Fe3+, Al3+, Si4+, Ca2+, and Na+ from synthetic leachate of sulfation-roasted red mud were first investigated using organophosphorus extractants (di-2-ethylhexyl phosphoric acid P204 and 2-ethylhexyl phosphoric acid mono-2-ethylhexyl ester P507) and carboxylic acid extractant (Versatic acid 10). It shows that P204 has an excellent extraction ability and that it can be applied to the scandium recovery. P507 and Versatic acid 10 are much poorer in performance for selective extraction of scandium. In the leachate of sulfation-roasted red mud, approximately 97% scandium can be recovered using a P204/sulfonated kerosene (1% v/v) extraction system under the condition of an organic-to-aqueous phase ratio of 10:1 and with an extraction temperature of 15°C.

  16. Scandium-doped zinc cadmium oxide as a new stable n-type oxide thermoelectric material

    DEFF Research Database (Denmark)

    Han, Li; Christensen, Dennis Valbjørn; Bhowmik, Arghya

    2016-01-01

    Scandium-doped zinc cadmium oxide (Sc-doped ZnCdO) is proposed as a new n-type oxide thermoelectric material. The material is sintered in air to maintain the oxygen stoichiometry and avoid instability issues. The successful alloying of CdO with ZnO at a molar ratio of 1 : 9 significantly reduced...... is a good candidate for improving the overall conversion efficiencies in oxide thermoelectric modules. Meanwhile, Sc-doped ZnCdO is robust in air at high temperatures, whereas other n-type materials, such as Al-doped ZnO, will experience rapid degradation of their electrical conductivity and ZT....

  17. Scandium and yttrium phosphasalen complexes as initiators for ring-opening polymerization of cyclic esters.

    Science.gov (United States)

    Bakewell, Clare; White, Andrew J P; Long, Nicholas J; Williams, Charlotte K

    2015-03-02

    The synthesis and characterization of novel scandium and yttrium phosphasalen complexes is reported, where phosphasalen refers to two different bis(iminophosphorane) derivatives of the more ubiquitous salen ligands. The activity of the complexes as initiators for the ring-opening polymerization of cyclic esters is presented. The scandium complexes are inactive for lactide polymerization but slow and controlled initiators for ε-caprolactone polymerization. The lack of activity toward lactide exhibited by these compounds is probed, and a rare example of single-monomer insertion product, unable to undergo further reactions with lactide, is identified. In contrast, the analogous yttrium phosphasalen complex is a very active initiator for the ring-opening polymerization of rac-lactide (kobs = 1.5 × 10(-3) s(-1) at 1:500 [yttrium initiator]:[rac-lactide], 1 M overall concentration of lactide in THF at 298 K). In addition to being a very fast initiator, the yttrium complex also maintains excellent levels of polymerization control and a high degree of isoselectivity, with the probability of isotactic enchainment being Pi = 0.78 at 298 K.

  18. Thermodynamic parameters of scandium trifluoride and triiodide in the condensed state

    Science.gov (United States)

    Aristova, N. M.; Belov, G. V.

    2015-06-01

    The thermodynamic properties of new classes of compounds, particularly scandium trihalides ScF3, ScCl3, ScBr3, and ScI3, are added to the IVTANTHERMO software package. A critical analysis and processing of the entire array of primary data available in the literature is performed. An equation approximating the temperature dependence of heat capacity in the temperature range 298.15- T m (K) is derived for each crystalline scandium trihalide. The resulting equations C {/p po}( T) for the solid state and the data for the liquid phase are used to calculate the thermodynamic functions of entropy, the reduced Gibbs free energies, and the enthalpy increments. Both the experimental data available in literature and the missing estimated thermodynamic data are used in calculations. The error of the recommended values is estimated in all cases. In the first part of this work, we describe the thermodynamic properties of ScF3 and ScI3 used as the reference data for calculating the thermodynamic functions of ScCl3 and ScBr3, for which experimental data are either very scarce or missing altogether. The resulting data are added to the database of the IVTANTHERMO software package.

  19. Recovery of Scandium(III) from Aqueous Solutions by Solvent Extraction with the Functionalized Ionic Liquid Betainium Bis(trifluoromethylsulfonyl)imide

    OpenAIRE

    Onghena, Bieke; Binnemans, Koen

    2015-01-01

    The ionic liquid betainium is(trifluoromethylsulfonyl)imide [Hbet][Tf2N] was used for the extraction of scandium from aqueous solutions. The influence of several extraction parameters on the extraction efficiency was investigated, including the initial metal concentration, phase ratio, and pH. The extraction kinetics was examined, and a comparison was made between conventional liquid−liquid extraction and homogeneous liquid−liquid extraction (HLLE). The stoichiometry of the extracted scandium...

  20. Modification mechanism of eutectic silicon in Al–6Si–0.3Mg alloy with scandium

    Energy Technology Data Exchange (ETDEWEB)

    Patakham, Ussadawut [Manufacturing and Systems Engineering Program, Department of Production Engineering, Faculty of Engineering, King Mongkut’s University of Technology Thonburi, 126 Pracha-Utid Rd., Bangmod, Tungkhru, Bangkok 10140 (Thailand); Kajornchaiyakul, Julathep [National Metal and Material Technology Center, National Science and Technology Development Agency, 114 Thailand Science Park, Klong Nueng, Klong Luang, Pathumthani 12120 (Thailand); Limmaneevichitr, Chaowalit, E-mail: chaowalit.lim@kmutt.ac.th [Manufacturing and Systems Engineering Program, Department of Production Engineering, Faculty of Engineering, King Mongkut’s University of Technology Thonburi, 126 Pracha-Utid Rd., Bangmod, Tungkhru, Bangkok 10140 (Thailand)

    2013-10-25

    Highlights: •Morphologies and growth of Sc and Sr-modified eutectic silicon resemble those of dendrites. •Crystal orientation of eutectic aluminum depends on growth characteristics of eutectic silicon. •We report strong evidence of the occurrence of an impurity-induced twinning mechanism. -- Abstract: The modification mechanism of eutectic silicon in Al–6Si–0.3Mg alloy with scandium was studied. The crystallographic orientation relationships between primary dendrites and the eutectic phase of unmodified and modified Al–6Si–0.3 Mg alloys were determined using electron backscatter diffraction (EBSD). The orientation of aluminum modified with scandium in the eutectic phase was different from that of the neighboring primary dendrites. This result implies that eutectic aluminum grows epitaxially from the surrounding primary aluminum dendrites in the unmodified alloy and that eutectic aluminum grows competitively from the surrounding primary aluminum dendrites in the modified alloy. The pole figure maps of eutectic Si in the [1 0 0], [1 1 0] and [1 1 1] axes of the unmodified and Sc-modified alloys were different, suggesting that the eutectic Al and Si crystals in modified alloy growth are more isotropic and cover a larger set of directions. The lattice fringes of Si of the alloys with and without Sc modification were different in the TEM results. The lattice fringes of Si in modified alloy were found to be multiple twins. However, this was not observed in the unmodified alloy. The growth characteristic of eutectic Si crystal in modified alloy suggests the occurrence of multiple twinning reactions and the formation of a high density of twins. This modification mechanism by Sc is explained by the results of scanning electron microscopy (SEM), electron backscatter diffraction (EBSD) and transmission electron microscopy (TEM) analysis, which provide strong evidence of the occurrence of the impurity-induced twinning (IIT) mechanism.

  1. Grain refinement mechanism in an Al-Si-Mg alloy with scandium

    Energy Technology Data Exchange (ETDEWEB)

    Patakham, Ussadawut [Department of Production Engineering, Faculty of Engineering, King Mongkut' s University of Technology Thonburi, 126 Pracha-Utid Rd., Bangmod, Tungkhru, Bangkok 10140 (Thailand); Kajornchaiyakul, Julathep [National Metal and Material Technology Center, National Science and Technology Development Agency, 114 Thailand Science Park, Klong Nueng, Klong Luang, Pathumthani 12120 (Thailand); Limmaneevichitr, Chaowalit, E-mail: chaowalit.lim@kmutt.ac.th [Department of Production Engineering, Faculty of Engineering, King Mongkut' s University of Technology Thonburi, 126 Pracha-Utid Rd., Bangmod, Tungkhru, Bangkok 10140 (Thailand)

    2012-11-25

    Highlights: Black-Right-Pointing-Pointer Scandium can be used to refine aluminum grains in an Al-Si-Mg aluminum alloy. Black-Right-Pointing-Pointer The effectiveness of Sc is lower than that of conventional Al-Ti grain refiners. Black-Right-Pointing-Pointer Al{sub 3}Sc particles can act as heterogeneous nuclei of aluminum phases. Black-Right-Pointing-Pointer Higher alloying elements cause more intermetallic compound phases. Black-Right-Pointing-Pointer Those phases cannot effectively act as heterogeneous nuclei compared with Al{sub 3}Sc particles. - Abstract: Grain refinement of the primary aluminum ({alpha}-Al) phase in a hypoeutectic Al-Si alloy using scandium (Sc) was studied to identify the grain refinement mechanism. Optical microscopy (OM), Scanning electron microscopy (SEM) with energy dispersive spectroscopy (EDS) and electron backscatter diffraction (EBSD) techniques were extensively used in this study. We found that Sc refined grains of primary aluminum. However, the grain refinement efficiency of Sc was considerably lower than that of titanium (Ti) in the Al-Si-Mg foundry alloy. It was evident that the precipitated Sc-containing phases acted as heterogeneous nucleation sites for the primary aluminum phase. The Sc-containing heterogeneous sites are irregular in shape with sizes between 3 and 5 {mu}m. At least three groups of nuclei based on their chemical composition were found, i.e., (i) Al and Sc, (ii) Al, Si, Mg, and Sc, and (iii) Al, Si, Mg, Sc, and Fe. Crystal orientation mapping showed primary aluminum dendrites with one orientation in each grain near Al{sub 3}Sc particles. The grain refinement mechanism of Sc for aluminum relies on heterogeneous nucleation of Al{sub 3}Sc particles, with less responsibly for grain growth restriction. Many intermetallic phases with Al, Si, Fe, Mg and Sc as their major components were found, and these phases could not effectively act as heterogeneous nuclei.

  2. Neutron and Charged-Particle Induced Cross Sections for Radiochemistry for Isotopes of Scandium, Titanium, Vanadium, Chromium, Manganese, and Iron

    Energy Technology Data Exchange (ETDEWEB)

    Kelley, K; Hoffman, R D; Dietrich, F S; Bauer, R; Mustafa, M

    2004-11-30

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Local systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron and proton induced nuclear reaction cross sections in the mass region of scandium, titanium, vanadium, chromium, manganese, and iron (21 {le} Z {le} 26, 20 {le} N {le} 32).

  3. A composite cathode based on scandium doped titanate with enhanced electrocatalytic activity towards direct carbon dioxide electrolysis.

    Science.gov (United States)

    Yang, Liming; Xie, Kui; Wu, Lan; Qin, Qingqing; Zhang, Jun; Zhang, Yong; Xie, Ting; Wu, Yucheng

    2014-10-21

    A composite cathode based on redox-stable La0.2Sr0.8TiO(3+δ) (LSTO) can perform direct carbon dioxide electrolysis; however, the insufficient electro-catalytic activity limits the electrode performances and current efficiencies. In this work, catalytically active scandium is doped into LSTO to enhance the electro-catalytic activity for CO2 electrolysis. The structures, electronic conductivities and ionic conductivities of La0.2Sr0.8Ti(1-x)Sc(x)O (LSTS(x)O) (x = 0, 0.05, 0.1, 0.15 and 0.2) are systematically studied and further correlated with electrode performances. The ionic conductivities of single-phase LSTS(x)O (x = 0, 0.05, 0.1 and 0.15) remarkably improve versus the scandium doping contents though the electrical conductivities gradually change in an adverse trend. Electrochemical measurements demonstrate promising electrode polarisation of LSTS(x)O electrodes and increasing scandium doping contents accordingly improve electrode performances. The Faradic efficiencies of carbon dioxide electrolysis are enhanced by 20% with LSTS0.15O in contrast to bare LSTO electrodes in a solid oxide electrolyser at 800 °C.

  4. Adsorption of hydrogen in Scandium/Titanium decorated nitrogen doped carbon nanotube

    Energy Technology Data Exchange (ETDEWEB)

    Mananghaya, Michael, E-mail: mikemananghaya@gmail.com [De La Salle University, 2401 Taft Ave, 0922, Manila (Philippines); DLSU STC Laguna Boulevard, LTI Spine Road Barangays Biñan and Malamig, Biñan City, Laguna (Philippines); DOST-ASTHRDP, PCIEERD, Gen. Santos Ave., Bicutan, Taguig City 1631 (Philippines); Belo, Lawrence Phoa; Beltran, Arnel [De La Salle University, 2401 Taft Ave, 0922, Manila (Philippines); DLSU STC Laguna Boulevard, LTI Spine Road Barangays Biñan and Malamig, Biñan City, Laguna (Philippines)

    2016-09-01

    Nitrogen doped Carbon Nanotube with divacancy (4ND-CN{sub x}NT) that is decorated with Scandium and Titanium as potential hydrogen storage medium using the pseudo potential density functional method was investigated. Highly localized states near the Fermi level, which are derived from the nitrogen defects, contribute to strong Sc and Ti bindings, which prevent metal aggregation and improve the material stability. A detailed Comparison of the Hydrogen adsorption capability with promising system-weight efficiency of Sc over Ti was elucidated when functionalized with 4ND-CN{sub x}NT. Finally, the (Sc/4ND){sub 10}-CN{sub x}CNT composite material has a thermodynamically favorable adsorption and consecutive adsorption energy for ideal reversible adsorption and desorption of hydrogen at room temperature such that it can hold at least 5.8 wt% hydrogen molecules at the LDA and GGA level. - Highlights: • Carbon Nanotube with divacancy (4ND-CN{sub x}NT) decorated with Sc and Ti. • Nitrogen defects, contribute to strong Sc and Ti bindings. • H{sub 2} and (Sc/4ND){sub 10}-CN{sub x}CNT has a favorable adsorption. • 5.8 wt% adsorption at the LDA and GGA level.

  5. Urinary monitoring of exposure to yttrium, scandium, and europium in male Wistar rats.

    Science.gov (United States)

    Kitamura, Yasuhiro; Usuda, Kan; Shimizu, Hiroyasu; Fujimoto, Keiichi; Kono, Rei; Fujita, Aiko; Kono, Koichi

    2012-12-01

    On the assumption that rare earth elements (REEs) are nontoxic, they are being utilized as replacements of toxic heavy metals in novel technological applications. However, REEs are not entirely innocuous, and their impact on health is still uncertain. In the past decade, our laboratory has studied the urinary excretion of REEs in male Wistar rats given chlorides of europium, scandium, and yttrium solutions by one-shot intraperitoneal injection or oral dose. The present paper describes three experiments for the suitability and appropriateness of a method to use urine for biological monitoring of exposure to these REEs. The concentrations of REEs were determined in cumulative urine samples taken at 0-24 h by inductively coupled plasma atomic emission spectroscopy, showing that the urinary excretion of REEs is <2 %. Rare earth elements form colloidal conjugates in the bloodstream, which make high REEs accumulation in the reticuloendothelial system and glomeruli and low urinary excretion. The high sensitivity of inductively coupled plasma-argon emission spectrometry analytical methods, with detection limits of <2 μg/L, makes urine a comprehensive assessment tool that reflects REE exposure. The analytical method and animal experimental model described in this study will be of great importance and encourage further discussion for future studies.

  6. Selective recovery of vanadium and scandium by ion exchange with D201 and solvent extraction using P507 from hydrochloric acid leaching solution of red mud.

    Science.gov (United States)

    Zhu, Xiaobo; Li, Wang; Tang, Sen; Zeng, Majian; Bai, Pengyuan; Chen, Lunjian

    2017-05-01

    D201 resin and P507 extractant diluted with sulfonated kerosene were used to respectively separate vanadium and scandium, and impurity ions from hydrochloric acid leaching solution of red mud. More than 99% of vanadium was selectively adsorbed from the hydrochloric acid leaching solution under the conditions of pH value of 1.8, volume ratio of leaching solution to resin of 10, and flow rate of 3.33 mL/min. Maximum extraction and separation of scandium was observed from the acid leaching solution at an aqueous pH value of 0.2. More than 99% of scandium can be selectively extracted using 15% P507, 5% TBP at the aqueous solution/organic phase (A/O) ratio of 10:1 for 6 min. The loaded organic phase was washed with 0.3 mol/L sulfuric acid, wherein most impurities were removed. After the process of desorption or stripping, precipitation, and roasting, high-purity V2O5 and Sc2O3 were obtained. Finally, a conceptual flow sheet was established to separate and recover vanadium and scandium from red mud hydrochloric acid leaching solution. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. isaiah 36–39

    African Journals Online (AJOL)

    2009-12-07

    Dec 7, 2009 ... ABSTRACT. Isaiah 36–39 is a coherent literary unity that both holds priority over II Kings 18–20 and reflects a historically reliable interpretation of the events surrounding Sennacherib's invasion. On a literary level, Isaiah 36–39 shows itself to be a vital piece of the overall literary structure of Proto-. Isaiah in ...

  8. Random-field Potts model for the polar domains of lead magnesium niobate and lead scandium tantalate

    Energy Technology Data Exchange (ETDEWEB)

    Qian, H.; Bursill, L.A

    1997-06-01

    A random filed Potts model is used to establish the spatial relationship between the nanoscale distribution of charges chemical defects and nanoscale polar domains for the perovskite-based relaxor materials lead magnesium niobate (PMN) and lead scandium tantalate (PST). The random fields are not set stochastically but are determined initially by the distribution of B-site cations (Mg, Nb) or (Sc, Ta) generated by Monte Carlo NNNI-model simulations for the chemical defects. An appropriate random field Potts model is derived and algorithms developed for a 2D lattice. It is shown that the local fields are strongly correlated with the chemical domain walls and that polar domains as a function of decreasing temperature is simulated for the two cases of PMN and PST. The dynamics of the polar clusters is also discussed. 33 refs., 9 figs.

  9. Innovation - Vol 39 (2009)

    African Journals Online (AJOL)

    New information seeking behaviours of academics in the Nelson R. Mandela School of Medicine at the University of KwaZulu- Natal · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Mitha. http://dx.doi.org/10.4314/innovation.v39i1.53472 ...

  10. Development of methods for the selective separation of scandium, zirconium and tin for radiopharmaceutical applications; Entwicklung von Methoden zur selektiven Trennung von Scandium, Zirkonium und Zinn fuer radiopharmazeutische Anwendungen

    Energy Technology Data Exchange (ETDEWEB)

    Dirks-Fandrei, Carina

    2014-07-01

    The subject of the present work is the development of fast and highly selective methods for the separation and purification of scandium, zirconium and tin radionuclides from potential target materials for use in nuclear medicine. A number of selected resins (TrisKem International) were first characterized with respect to their extraction behaviour towards a large number of cations. Characterization studies were performed in batch experiments by determination of weight distribution ratios D{sub w} and further the influence of interferences on the uptake of these elements was evaluated. Weight distribution ratios were determined in different acids and acid concentrations with main focus on scandium, tin or zirconium. The interference of macro amounts of Calcium and Ti on the Sc extraction was evaluated as well as the interference of macro amounts of Y on the Zr extraction. Best suited uptake conditions were found for Scandium on DGA were determined to be 2.5 M HNO{sub 3} for Ti-Targets and 0.1 M HNO{sub 3} for Calcium-Targets. Otherwise it is also possible to extract Sc with TRU Resin. High uptakes were obtained at 2.5 M HNO{sub 3} for simulated Ti- and Calcium-targets. Separation methods were developed using elution studies; employed conditions were chosen according to parameters evaluated in the batch-experiment. The developed methods allowed separating Sc very rapidly in high purity very rapidly from Ti- or Calcium-targets. For Zr a separation method based on UTEVA Resin has been developed. Following results of batch experiments simulated Y-target solution were loaded onto a UTEVA resin column from 6 M HNO{sub 3}; the elution of Zr could be performed in 0.01 M oxalic acid. Decontamination factors in the order of 10{sup 4}-10{sup 5} could be obtained applying the developed method; the method thus allowed separating Zr in a high purity. Initial testing of a method for the separation of Sn from Cd targets based on the use of TBP Resin showed that the TBP resin seems

  11. The impact of an erbium, chromium:yttrium-scandium-gallium-garnet laser with radial-firing tips on endodontic treatment.

    Science.gov (United States)

    Schoop, U; Barylyak, A; Goharkhay, K; Beer, F; Wernisch, J; Georgopoulos, A; Sperr, W; Moritz, A

    2009-01-01

    Radial-firing tips should allow a more homogeneous laser irradiation of root canal walls. The aim of the study was to assess the effects of erbium, chromium:yttrium-scandium-gallium-garnet (Er,Cr:YSGG) laser irradiation in conjunction with those newly designed tips. The investigation comprised bacteriology, morphological evaluations and temperature measurements. Root canals were inoculated with two test strains and laser irradiated with power settings of 0.6 W and 0.9 W and a repetition rate of 20 Hz. Subsequently, the samples were subjected to microbiological evaluation. The morphological changes of the canal walls were assessed by scanning electron microscopy. To reveal possible thermal side effects, we carried out temperature measurements. The bacteriological evaluation revealed a decisive disinfectant effect. Scanning electron microscopy showed the homogeneous removal of smear layer from the root canal walls. The temperature rise at the root surface during the irradiation was moderate, yielding 1.3 degrees C for the 0.6 W setting and 1.6 degrees C for the 0.9 W setting. The investigations indicated that the Er,Cr:YSGG laser, in conjunction with radial-firing tips, is a suitable tool for the elimination of bacteria in root canals and for the removal of smear layer.

  12. Effect of scandium addition on the microstructure, mechanical and wear properties of the spray formed hypereutectic aluminum–silicon alloys

    Energy Technology Data Exchange (ETDEWEB)

    Raghukiran, Nadimpalli; Kumar, Ravi, E-mail: nvrk@iitm.ac.in

    2015-08-12

    Hypereutectic Al–x%Si–0.8Sc alloys (x=13, 16, 19 and 22 wt%) were produced by spray forming. The microstructures of all the alloys exhibited very fine silicon phase with average size of about 5–10 µm irrespective of the silicon content of the alloy. Transmission electron microscopy revealed the presence of a nano-scale scandium rich phase, identified as AlSi{sub 2}Sc{sub 2} (V-phase) uniformly distributed in the alloy. The presence of V-phase resulted in higher matrix hardness (1.34 GPa) in contrast to 1.04 GPa observed in the case of binary Al–Si alloys by nanoindentation. Isothermal heat treatment at 375 °C revealed insignificant coarsening of silicon phase in both binary and ternary alloys. The Al–x%Si–0.8Sc alloys exhibited higher flow stress and tensile strength in contrast to their binary alloy counterparts which was attributed to the bi-modal size distribution of the strengthening phases in the form of nano-scale V-phase and sub-micron to 10 µm size silicon particles. The pin-on-disk wear tests exhibited appreciable improvement in the wear performance of the relatively low-silicon content ternary alloys over their binary counterparts while the high-silicon content binary and ternary alloys exhibited no much difference in the wear performance.

  13. Scandium and Titanium Containing Single-Walled Carbon Nanotubes for Hydrogen Storage: a Thermodynamic and First Principle Calculation.

    Science.gov (United States)

    Mananghaya, Michael; Yu, Dennis; Santos, Gil Nonato; Rodulfo, Emmanuel

    2016-06-15

    The generalized gradient approximation (GGA) to density functional theory (DFT) calculations indicate that the highly localized states derived from the defects of nitrogen doped carbon nanotube with divacancy (4ND-CNxNT) contribute to strong Sc and Ti bindings, which prevent metal aggregation. Comparison of the H2 adsorption capability of Sc over Ti-decorated 4ND-CNxNT shows that Ti cannot be used for reversible H2 storage due to its inherent high adsorption energy. The Sc/4ND-CNxNT possesses favorable adsorption and consecutive adsorption energy at the local-density approximation (LDA) and GGA level. Molecular dynamics (MD) study confirmed that the interaction between molecular hydrogen and 4ND-CNxNT decorated with scandium is indeed favorable. Simulations indicate that the total amount of adsorption is directly related to the operating temperature and pressure. The number of absorbed hydrogen molecules almost logarithmically increases as the pressure increases at a given temperature. The total excess adsorption of hydrogen on the (Sc/4ND)10-CNxNT arrays at 300 K is within the range set by the department of energy (DOE) with a value of at least 5.85 wt%.

  14. Effects of scandium addition on iron-bearing phases and tensile properties of Al–7Si–0.6Mg alloys

    Energy Technology Data Exchange (ETDEWEB)

    Tzeng, Yu-Chih [Department of Mechanical Engineering, National Central University, Jhongli, Taiwan (China); Wu, Chih-Ting [Department of Vehicle Engineering, Army Academy R.O.C., Jhongli, Taiwan (China); Bor, Hui-Yun; Horng, Jain-Long; Tsai, Mu-Lin [Department of Mechanical Engineering, National Central University, Jhongli, Taiwan (China); Institute of Materials Science and Engineering, National Central University, Jhongli, Taiwan (China); Lee, Sheng-Long, E-mail: shenglon@cc.ncu.edu.tw [Department of Mechanical Engineering, National Central University, Jhongli, Taiwan (China); Institute of Materials Science and Engineering, National Central University, Jhongli, Taiwan (China)

    2014-01-21

    Iron is the most deleterious impurity in aluminum alloys and can easily combine with aluminum to form an acicular β-Al{sub 5}FeSi phase that reduces ductility during the solidification of the molten metal. Adding scandium (Sc) to Al–7Si–0.6Mg alloys can transform the acicular β-Al{sub 5}FeSi phase into a comparatively harmless nodular Sc–Fe phase (Al{sub 12}Si{sub 6}Fe{sub 2}(Mg,Sc){sub 5}). This Sc–Fe phase has a lower hardness and elastic modulus than the β-Al{sub 5}FeSi phase; it is thus less likely to initiate cracks in the Al matrix. Moreover, the nodular Sc–Fe phase can improve the fluidity of Al during solidification, reducing interdendritic shrinkage. Tensile testing measurements showed that the elongation of Al–7Si–0.6Mg alloys with 0.04 and 0.12 wt% Sc can be respectively increased by 115% and 110% compared to Al–7Si–0.6Mg without Sc. The corresponding quality indices are increased by 17% and 19%, respectively, suggesting that the tensile properties of Al–7Si–0.6Mg alloys can be enhanced by adding scandium.

  15. Separation of (44)Ti from proton irradiated scandium by using solid-phase extraction chromatography and design of (44)Ti/(44)Sc generator system.

    Science.gov (United States)

    Radchenko, V; Meyer, C A L; Engle, J W; Naranjo, C M; Unc, G A; Mastren, T; Brugh, M; Birnbaum, E R; John, K D; Nortier, F M; Fassbender, M E

    2016-12-16

    Scandium-44g (half-life 3.97h [1]) shows promise for positron emission tomography (PET) imaging of longer biological processes than that of the current gold standard, (18)F, due to its favorable decay parameters. One source of (44g)Sc is the long-lived parent nuclide (44)Ti (half-life 60.0 a). A (44)Ti/(44g)Sc generator would have the ability to provide radionuclidically pure (44g)Sc on a daily basis. The production of (44)Ti via the (45)Sc(p,2n) reaction requires high proton beam currents and long irradiation times. Recovery and purification of no-carrier added (nca) (44)Ti from scandium metal targets involves complex separation chemistry. In this study, separation systems based on solid phase extraction chromatography were investigated, including branched diglycolamide (BDGA) resin and hydroxamate based ZR resin. Results indicate that ZR resin in HCl media represents an effective (44)Ti/(44g)Sc separation system. Copyright © 2016 Elsevier B.V. All rights reserved.

  16. ISS Expedition 39 Press Kit

    Data.gov (United States)

    National Aeronautics and Space Administration — Press kit for ISS mission Expedition 39 from 11/2013-05/2014. Press kits contain information about each mission overview, crew, mission timeline, benefits, and media...

  17. Gd-Sc-based mixed-metal nitride cluster fullerenes: mutual influence of the cage and cluster size and the role of scandium in the electronic structure.

    Science.gov (United States)

    Svitova, Anna L; Popov, Alexey A; Dunsch, Lothar

    2013-03-18

    The influence of the cage as well as of the cluster size has been studied in Gd-Sc nitride cluster fullerenes, which have been synthesized and isolated for these studies. A series of carbon cages ranging from C78 to C88 have been synthesized, isolated, and characterized in detail using absorption and vibrational spectroscopy as well as electrochemistry and density functional theory calculations. Gd-Sc mixed-metal cluster fullerenes in carbon cages different from C80 were described for the first time. A review of their structures, properties, and stability is given. The synthesis was performed with melamine as an effective solid source of nitrogen, providing high fullerene yield and suppressing empty fullerene formation. Substitution of gadolinium by scandium imposes a noticeable influence on the electronic structure of nitride cluster fullerenes as revealed by electrochemical, spectroscopic, and computational methods.

  18. Copper scandium zirconium phosphate

    DEFF Research Database (Denmark)

    Bond, Andrew David; Warner, Terence Edwin

    2013-01-01

    components. The [Sc(III)Zr(IV)(PO(4))(3)](2-) framework is composed of corner-sharing Sc/ZrO(6) octahedra and PO(4) tetrahedra. The Sc and Zr atoms are disordered on one atomic site on a crystallographic threefold axis. The P atom of the phosphate group lies on a crystallographic twofold axis. Nonframework...

  19. Synthesis and characterization of reduced scandium halide containing one- and two-dimensional metal bonded arrays. [Sc--ScCl3; Cs3Sc2Cl9; CsScCl3

    Energy Technology Data Exchange (ETDEWEB)

    Poeppelmeier, K.R.

    1978-08-01

    The stabilization effect of metal-metal bond formation on reduced scandium compounds was studied. The binary compounds Sc/sub 7/Cl/sub 12/, Sc/sub 5/Cl/sub 8/, Sc/sub 7/Cl/sub 10/ and ScCl were prepared by high temperature techniques and were characterized by single crystal x-ray diffraction. The respective metal arrays in these compounds can be viewed as fragments of scandium metal ranging from discrete six atom metal cluster species (Sc(Sc/sub 6/Cl/sub 12/)), through intermediate single and double infinite chain configurations ((ScCl/sub 2/)(Sc/sub 4/Cl/sub 6/)) and ((ScCl/sub 2/)(Sc/sub 6/Cl/sub 8/)) to double metal close-packed sheets (ScCl). The halogen atoms effectively isolate the clusters, chains and sheets by bonding face, edge or exo positions on the metal arrays. The common occurrence of isolated scandium (III) ions emphasizes that a minimum number of bonding electrons is required to stabilize what are formally anionic metal arrays. The distribution of the reduction electrons in these anisotropic materials was studied by magnetic susceptibility, EPR and uv-X photoelectron spectroscopy. The ternary compounds studied were Cs/sub 3/Sc/sub 2/Cl/sub 9/ and CsScCl/sub 3/. The anion-bridged metal chain of the hexagonal perovskite structure was found to stabilize scandium (II). CsScCl/sub 3/ was found to be grossly nonstoichiometric on the transition metal site and the effects of the mixed valence character were studied between the single valence extremes Cs/sub 3/Sc/sub 2 + x/Cl/sub 9/; 0< x < 1.0.

  20. 41 CFR 101-39.205 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services § 101-39.205 ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true 101-39.205 Section 101-39...

  1. The use of the erbium, chromium:yttrium-scandium-gallium-garnet laser in endodontic treatment: the results of an in vitro study.

    Science.gov (United States)

    Schoop, Ulrich; Goharkhay, Kawe; Klimscha, Johannes; Zagler, Manuela; Wernisch, Johann; Georgopoulos, Apostolos; Sperr, Wolfgang; Moritz, Andreas

    2007-07-01

    The use of the erbium, chromium:yttrium-scandium-gallium-garnet (Er,Cr:YSGG) laser has become accepted in the field of cavity preparation. The development of miniaturized and flexible fiber tips has allowed this device to be used in endodontics. The authors conducted an in vitro study to assess the effects of Er,Cr:YSGG laser irradiation on root canals. The authors inoculated root canals with two bacteria, laser irradiated them at two power settings and subjected them to a quantitative microbiological evaluation. They used scanning electron microscopy (SEM) to assess morphological changes in endodontically processed and laser-irradiated root canal walls. They measured temperature increases on the root surface to determine possible thermal side effects. The bacteriological evaluation revealed a disinfecting effect in the root dentin samples that was dependent on the output power but not specific for the bacterial species investigated. SEM showed the removal of the smear layer from the root canal walls and the exposure of dentinal tubules. The temperature rise during irradiation was moderate when standardized power settings were used. The Er,Cr:YSGG laser can be used to eliminate bacteria in root canals. It also effectively removes smear layer and debris from the canal wall. Practitioners can use the Er,Cr:YSGG laser to prepare root canals for endodontic therapy.

  2. Aluminum-Scandium Alloys: Material Characterization, Friction Stir Welding, and Compatibility With Hydrogen Peroxide (MSFC Center Director's Discretionary Fund Final Report, Proj. No. 04-14)

    Science.gov (United States)

    Lee, J. A.; Chen, P. S.

    2004-01-01

    This Technical Memorandum describes the development of several high-strength aluminum (Al) alloys that are compatible with hydrogen peroxide (H2O2) propellant for NASA Hypersonic-X (Hyper-X) vehicles fuel tanks and structures. The yield strengths for some of these Al-magnesium-based alloys are more than 3 times stronger than the conventional 5254-H112 Al alloy, while maintaining excellent H2O2 compatibility similar to class 1 5254 alloy. The alloy development strategy is to add scandium, zirconium, and other transitional metals with unique electrochemical properties, which will not act as catalysts, to decompose the highly concentrated 90 percent H2O2. Test coupons are machined from sheet metals for H2O2 long-term exposure testing and mechanical properties testing. In addition, the ability to weld the new alloys using friction stir welding has also been explored. The new high-strength alloys could represent an enabling material technology for Hyper-X vehicles, where flight weight reduction is a critical requirement.

  3. High-fluence and high-density treatment of perioral rhytides using a new, fractionated 2,790-nm ablative erbium-doped Yttrium Scandium Gallium Garnet Laser.

    Science.gov (United States)

    Ciocon, David H; Hussain, Mussarat; Goldberg, David J

    2011-06-01

    In this study, we evaluated the safety and efficacy of a novel 2,790-nm erbium-doped yttrium scandium gallium garnet (Er:YSGG) laser system for the treatment of facial photodamage and perioral wrinkles using a single-treatment, high-fluence, high-density protocol. Eleven female participants with Fitzpatrick skin types II to III and facial wrinkles underwent a single full-face fractional ablative treatment with a 2,790-nm Er:YSGG laser. Follow-up visits were completed at 1, 2, and 6 weeks 3 and 6 months. Quartile improvement scale (0-4) and Fitzpatrick wrinkle scores (1-9) were used for the assessments. Based on blinded photographic assessments, the mean difference in Fitzpatrick wrinkle scores for full face wrinkles was 1.5 ± 1.2 (a reduction from 6.6 to 5.1; paired t-test, p = .003). There was also a statistically significant mean reduction of 1.7 ± 1.3 in perioral wrinkle scores (from 6.7 to 5.0; p = .002). No serious adverse events were reported. A novel, fractionated, ablative 2,790-nm Er:YSGG laser can safely and effectively treat photodamage and perioral wrinkles in a single treatment using a high-fluence, high-density protocol. Cutera provided the equipment used in this study and funding to Dr. Goldberg. © 2011 by the American Society for Dermatologic Surgery, Inc.

  4. Impact of layer and substrate properties on the surface acoustic wave velocity in scandium doped aluminum nitride based SAW devices on sapphire

    Energy Technology Data Exchange (ETDEWEB)

    Gillinger, M., E-mail: manuel.gillinger@tuwien.ac.at; Knobloch, T.; Schneider, M.; Schmid, U. [Institute of Sensor and Actuator Systems, TU Wien, 1040 Vienna (Austria); Shaposhnikov, K.; Kaltenbacher, M. [Institute of Mechanics and Mechatronics, TU Wien, 1040 Vienna (Austria)

    2016-06-06

    This paper investigates the performance of surface acoustic wave (SAW) devices consisting of reactively sputter deposited scandium doped aluminum nitride (Sc{sub x}Al{sub 1-x}N) thin films as piezoelectric layers on sapphire substrates for wireless sensor or for RF-MEMS applications. To investigate the influence of piezoelectric film thickness on the device properties, samples with thickness ranging from 500 nm up to 3000 nm are fabricated. S{sub 21} measurements and simulations demonstrate that the phase velocity is predominantly influenced by the mass density of the electrode material rather than by the thickness of the piezoelectric film. Additionally, the wave propagation direction is varied by rotating the interdigital transducer structures with respect to the crystal orientation of the substrate. The phase velocity is about 2.5% higher for a-direction compared to m-direction of the sapphire substrate, which is in excellent agreement with the difference in the anisotropic Young's modulus of the substrate corresponding to these directions.

  5. 41 CFR 101-39.100 - General.

    Science.gov (United States)

    2010-07-01

    ... FEDERAL PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management... fleet management systems. (a) Based on these studies, the Administrator of General Services, with the...

  6. Structure and temperature effects on Nd3+ spectra in polycrystalline mixed scandium aluminum garnets Y3ScxAl5-xO12

    Science.gov (United States)

    Lupei, A.; Lupei, V.; Hau, S.; Gheorghe, C.; Voicu, F.

    2015-09-01

    New spectroscopic data obtained from high resolution low temperature absorption and emission spectra of Nd3+ in mixed scandium aluminum garnets Y3ScxAl5-xO12 - (x = 0-2) translucent ceramics revealed transition dependent composition effects: modification of the shapes (Lorentz at x = 0 and 2, quasi-Gauss at x = 1, x-dependent asymmetric for other x values, with obvious multicenter structure for low x), widths and shifts of the lines. Nd3+ electronic structure dependence on structural changes with composition is analyzed in terms of nephelauxetic effect and maximum splitting of manifolds: Sc3+ co-doping reduces the nephelauxetic effect, and the increase of 4F3/2 splitting from 85 cm-1 (x = 0) to 98 cm-1 (x = 2) denotes the lowering of local symmetry. The multicenter structure and inhomogeneous broadening of Nd3+ lines is attributed to crystal field distributions determined by the random occupancy of the octahedral sites by Sc3+ and Al3+. For low x (0.2) the resolved two satellites S1, S2 that accompany Nd:YAG lines are correlated to anisotropic crystal field perturbations produced by the n.n. Sc3+ by analogy to those determined by Y3+-antisites (excess of Y3+ ions that enter in octahedral sites of the melt-grown YAG crystals). The temperature evolution of the Nd3+ spectral characteristics (line intensity, shift, broadening) in the 10-300 K range is analyzed in terms of thermal population of the Stark levels, of the effect on electron-phonon interaction and on lattice expansion. The relevance of the spectroscopic properties on the laser emission characteristics in these systems is discussed.

  7. Dissolved scandium, yttrium, and lanthanum in the surface waters of the North Atlantic: Potential use as an indicator of scavenging intensity

    Science.gov (United States)

    Till, C. P.; Shelley, R. U.; Landing, W. M.; Bruland, K. W.

    2017-08-01

    Recent work has begun to elucidate the biogeochemical cycling of scandium (Sc) in the open ocean, but so far no surface distribution data have been reported of dissolved Sc, and no basin-scale surface distributions have been reported of yttrium (Y) or lanthanum (La). This work presents basin-wide surface Sc, Y, and La data in a section across the North Atlantic subtropical gyre (2011 GEOTRACES GA03) and investigates the potential utility of these distributions. This work uses dissolved and aerosol concentration data for La and Sc to estimate their surface ocean residence times in both the center of the oligotrophic gyre and near the African coastline. This work additionally shows that the surface distribution of Sc in the North Atlantic correlates with the shape of the gyre as inferred by isotherm depth, with lower Sc concentrations at the gyre boundaries. This pattern suggests that Sc could be drawn down by the elevated particle flux at the gyre boundaries. In this case, Sc removal could be used as an indicator of scavenging intensity. In order to account for variable input of Sc to the surface ocean, we propose normalizing the Sc distribution to that of Y or La, which are much less particle reactive and are input via dust to the surface North Atlantic in constant ratios with Sc. Such normalization improves the correlation with isotherm depth. We propose that the variations in dissolved Y/Sc and La/Sc ratios may be due to preferential Sc scavenging and could therefore indicate scavenging intensity.

  8. On new ternary equiatomic scandium transition metal aluminum compounds ScTAl with T = Cr, Ru, Ag, Re, Pt, and Au

    Energy Technology Data Exchange (ETDEWEB)

    Radzieowski, Mathis; Janka, Oliver [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Benndorf, Christopher [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Muenster Univ. (Germany). Inst. fuer Physikalische Chemie; Haverkamp, Sandra [Muenster Univ. (Germany). Inst. fuer Physikalische Chemie; Eckert, Hellmut [Muenster Univ. (Germany). Inst. fuer Physikalische Chemie; University of Sao Paulo, Sao Carlos, SP (Brazil). Inst. of Physics

    2016-08-01

    The new equiatomic scandium transition metal aluminides ScTAl for T = Cr, Ru, Ag, Re, Pt, and Au were obtained by arc-melting of the elements followed by subsequent annealing for crystal growth. The samples were studied by powder and single crystal X-ray diffraction. The structures of three compounds were refined from single crystal X-ray diffractometer data: ScCrAl, MgZn{sub 2} type, P6{sub 3}/mmc, a = 525.77(3), c = 858.68(5) pm, R{sub 1} = 0.0188, wR{sub 2} = 0.0485, 204 F{sup 2} values, 13 variables, ScPtAl, TiNiSi type, Pnma, a = 642.83(4), b = 428.96(2), c = 754.54(5) pm, R{sub 1} = 0.0326, wR{sub 2} = 0.0458, 448 F{sup 2} values, 20 variables and ScAuAl, HfRhSn type, P anti 62c, a = 722.88(4), c = 724.15(4) pm, R{sub 1} = 0.0316, wR{sub 2} = 0.0653, 512 F{sup 2} values, 18 variables. Phase pure samples of all compounds were furthermore investigated by magnetic susceptibility measurements, and Pauli-paramagnetism but no superconductivity was observed down to 2.1 K for all of them. The local structural features and disordering phenomena have been characterized by {sup 27}Al and {sup 45}Sc magic angle spinning (MAS) and static NMR spectroscopic investigations.

  9. Treatment of infraorbital dark circles in atopic dermatitis with a 2790-nm erbium: yttrium scandium gallium garnet laser: a pilot study.

    Science.gov (United States)

    Park, Kui Young; Oh, In Young; Moon, Nam Ju; Seo, Seong Jun

    2013-04-01

    Although many Asian atopic patients have orbital darkening symptom and the demand to treat this condition is increasing, little has been reported in the literature on the treatment of infraorbital dark circles in atopic dermatitis. To evaluate the clinical efficacy and safety of 2790-nm erbium:yttrium scandium gallium garnet (Er:YSGG) laser therapy for reducing infraorbital dark circles in atopic dermatitis patients. Ten Korean patients over 21 year with mild atopic dermatitis and infraorbital dark circles were enrolled in this study. Patients who need active atopic dermatitis treatments are excluded because of the possibility of aggravation after laser treatment. They were treated for dark circles using a 2790-nm Er:YSGG laser. The treatment parameters were 1.8-2.2 J/cm² fluence, 6-mm spot size, and 0.3-ms pulse width with 10% overlap over the infraorbital areas once with a 4-week interval between treatments. Efficacy was assessed with a quartile grading score ranging from 0 to 5 by a blinded investigator, and the patients also documented their degree of satisfaction with the same grading score. All possible side effects were evaluated. The clinical assessment showed 74.5% (2.7) and 72.5% (2.5) improvements, and the patient satisfaction scale scores improved an average of 74% (2.4) and 71.5% (2.3) at 2 months and 4 months after treatment, respectively. There were no severe side effects or aggravation of atopic dermatitis. Our study suggests that 2790-nm Er:YSGG laser therapy can be effectively and safely used in the treatment of infraorbital dark circles in atopic dermatitis patients.

  10. The influence of cation ordering, oxygen vacancy distribution and proton siting on observed properties in ceramic electrolytes: the case of scandium substituted barium titanate.

    Science.gov (United States)

    Torino, Nico; Henry, Paul F; Knee, Christopher S; Bjørheim, Tor Svendsen; Rahman, Seikh M H; Suard, Emma; Giacobbe, Carlotta; Eriksson, Sten G

    2017-07-04

    The origin of the 2-order of magnitude difference in the proton conductivity of the hydrated forms of hexagonal and cubic oxygen deficient BaScxTi1-xO3-δ (x = 0.2 and x = 0.7) was probed using a combination of neutron diffraction and density functional theory techniques to support published X-ray diffraction, conductivity, thermogravimetric and differential scanning calorimetry studies. Cation ordering is found in the 6H structure type (space group P63/mmc) adopted by BaSc0.2Ti0.8O3-δ with scandium preferentially substituting in the vertex sharing octahedra (2a crystallographic site) and avoiding the face-sharing octahedra (4f site). This is coupled with oxygen vacancy ordering in the central plane of the face-sharing octahedra (O1 site). In BaSc0.7Ti0.3O3-δ a simple cubic perovskite (space group Pm3[combining macron]m) best represents the average structure from Rietveld analysis with no evidence of either cation ordering or oxygen vacancy ordering. Significant diffuse scattering is observed, indicative of local order. Hydration in both cases leads to complete filling of the available oxygen vacancies and permits definition of the proton sites. We suggest that the more localised nature of the proton sites in the 6H structure is responsible for the significantly lower proton conduction observed in the literature. Within the 6H structure type final model, proton diffusion requires a 3-step process via higher energy proton sites that are unoccupied at room temperature and is also likely to be anisotropic whereas the highly disordered cubic perovskite proton position allows 3-dimensional diffusion by well-described modes. Finally, we propose how this knowledge can be used to further materials design for ceramic electrolytes for proton conducting fuel cells.

  11. 34 CFR 674.39 - Loan rehabilitation.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Loan rehabilitation. 674.39 Section 674.39 Education..., DEPARTMENT OF EDUCATION FEDERAL PERKINS LOAN PROGRAM Terms of Loans § 674.39 Loan rehabilitation. (a) Each institution must establish a loan rehabilitation program for all borrowers for the purpose of rehabilitating...

  12. 14 CFR 141.39 - Aircraft.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aircraft. 141.39 Section 141.39 Aeronautics... CERTIFICATED AGENCIES PILOT SCHOOLS Personnel, Aircraft, and Facilities Requirements § 141.39 Aircraft. (a... certificate or provisional pilot school certificate must show that each aircraft used by the school for flight...

  13. 34 CFR 104.39 - Private education.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Private education. 104.39 Section 104.39 Education Regulations of the Offices of the Department of Education OFFICE FOR CIVIL RIGHTS, DEPARTMENT OF EDUCATION... Preschool, Elementary, and Secondary Education § 104.39 Private education. (a) A recipient that provides...

  14. 45 CFR 84.39 - Private education.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Private education. 84.39 Section 84.39 Public... Secondary Education § 84.39 Private education. (a) A recipient that provides private elementary or secondary education may not, on the basis of handicap, exclude a qualified handicapped person if the person can, with...

  15. 45 CFR 605.39 - Private education.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Private education. 605.39 Section 605.39 Public..., Elementary, and Secondary Education § 605.39 Private education. (a) A recipient that provides private elementary or secondary education may not, on the basis of handicap, exclude a qualified handicapped person...

  16. 49 CFR 826.39 - Judicial review.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Judicial review. 826.39 Section 826.39 Transportation Other Regulations Relating to Transportation (Continued) NATIONAL TRANSPORTATION SAFETY BOARD....39 Judicial review. Judicial review of final Board decisions on awards may be sought as provided in 5...

  17. 48 CFR 39.105 - Privacy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Privacy. 39.105 Section 39... CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY General 39.105 Privacy. Agencies shall ensure that contracts for information technology address protection of privacy in accordance with the Privacy Act (5 U.S.C...

  18. 46 CFR 151.03-39 - Ocean.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Ocean. 151.03-39 Section 151.03-39 Shipping COAST GUARD... HAZARDOUS MATERIAL CARGOES Definitions § 151.03-39 Ocean. A designation for all vessels normally navigating the waters of any ocean or the Gulf of Mexico more than 20 nautical miles offshore. ...

  19. 7 CFR 1753.39 - Closeout documents.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Closeout documents. 1753.39 Section 1753.39... Central Office Equipment § 1753.39 Closeout documents. Closeout of RUS Contract Form 525, Central Office... closeout procedure. The documents required for the final closeout of the central office equipment contract...

  20. 14 CFR 63.39 - Skill requirements.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Skill requirements. 63.39 Section 63.39 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN CERTIFICATION: FLIGHT CREWMEMBERS OTHER THAN PILOTS Flight Engineers § 63.39 Skill requirements. (a) An...

  1. 38 CFR 39.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Purpose. 39.1 Section 39.1 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) AID TO STATES... Provisions § 39.1 Purpose. This part sets forth the mechanism for a State to obtain a grant to establish...

  2. 14 CFR 35.39 - Endurance test.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Endurance test. 35.39 Section 35.39... STANDARDS: PROPELLERS Tests and Inspections § 35.39 Endurance test. Endurance tests on the propeller system... propellers must be subjected to one of the following tests: (1) A 50-hour flight test in level flight or in...

  3. 41 CFR 109-39.300 - General.

    Science.gov (United States)

    2010-07-01

    ... 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.3-Use and Care of GSA Interagency Fleet Management System... passengers in GSA Interagency Fleet Management System (IFMS) motor vehicles are aware of the prohibition... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false General. 109-39.300...

  4. 41 CFR 101-39.300 - General.

    Science.gov (United States)

    2010-07-01

    ... FEDERAL PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.3-Use and Care of GSA Interagency Fleet Management System Vehicles § 101-39.300 General. (a) The objective of the General Services Administration (GSA) Interagency Fleet Management System...

  5. 41 CFR 101-39.302 - Rotation.

    Science.gov (United States)

    2010-07-01

    ... FEDERAL PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.3-Use and Care of GSA Interagency Fleet Management System Vehicles § 101-39.302 Rotation. GSA Interagency Fleet Management System (IFMS) vehicles on high mileage assignments may be...

  6. 41 CFR 101-39.002 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Applicability. 101-39.002 Section 101-39.002 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET...

  7. 41 CFR 101-39.305 - Storage.

    Science.gov (United States)

    2010-07-01

    ... FEDERAL PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.3-Use and Care of GSA Interagency Fleet Management System Vehicles § 101-39.305 Storage. (a) GSA Interagency Fleet Management System (IFMS) vehicles shall be stored and parked at locations...

  8. 37 CFR 2.39 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false 2.39 Section 2.39 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES The Written Application § 2.39 ...

  9. 10 CFR 39.71 - Security.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Security. 39.71 Section 39.71 Energy NUCLEAR REGULATORY COMMISSION LICENSES AND RADIATION SAFETY REQUIREMENTS FOR WELL LOGGING Security, Records, Notifications § 39.71 Security. (a) A logging supervisor must be physically present at a temporary jobsite whenever...

  10. 12 CFR 561.39 - Principal office.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Principal office. 561.39 Section 561.39 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY DEFINITIONS FOR REGULATIONS AFFECTING ALL SAVINGS ASSOCIATIONS § 561.39 Principal office. The term principal office means the home...

  11. 28 CFR 39.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Employment. 39.140 Section 39.140... PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE § 39.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or...

  12. 14 CFR 437.39 - Flight rules.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Flight rules. 437.39 Section 437.39 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... Documentation § 437.39 Flight rules. An applicant must provide flight rules as required by § 437.71. ...

  13. Effects of erbium-and chromium-doped yttrium scandium gallium garnet and diode lasers on the surfaces of restorative dental materials: a scanning electron microscope study.

    Science.gov (United States)

    Hatipoglu, M; Barutcigil, C

    2015-01-01

    The aim of this study is to evaluate the potential effects of laser irradiation, which is commonly performed in periodontal surgery, on the surfaces of restorative materials. Five different restorative dental materials were used in this study, as follows: (1) Resin composite, (2) poly acid-modified resin composite (compomer), (3) conventional glass ionomer cement (GIC), (4) resin-modified glass ionomer cement (RMGIC), and (5) amalgam. Four cylindrical samples (8 mm diameter, 2 mm height) were prepared for each restorative material. In addition, four freshly extracted, sound human incisors teeth were selected. Two different laser systems commonly used in periodontal surgery were examined in this study: A 810 nm diode laser at a setting of 1 W with continuous-phase laser irradiation for 10 s, and an erbium-and chromium-doped yttrium scandium gallium garnet (Er, Cr: YSGG) laser at settings of 2.5 W, 3.25 W, and 4 W with 25 Hz laser irradiation for 10 s. Scanning electron microscopy (SEM) analysis was performed to evaluate the morphology and surface deformation of the restorative materials and tooth surfaces. According to the SEM images, the Er, Cr: YSGG laser causes irradiation markings that appear as demineralized surfaces on tooth samples. The Er, Cr: YSGG laser also caused deep defects on composite, compomer, and RMGIC surfaces because of its high power, and the ablation was deeper for these samples. High-magnification SEM images of GIC samples showed the melting and combustion effects of the Er, Cr: YSGG laser, which increased as the laser power was increased. In amalgam samples, neither laser left significant harmful effects at the lowest power setting. The diode laser did cause irradiation markings, but they were insignificant compared with those left by the Er, Cr: YSGG laser on the surfaces of the different materials and teeth. Within the limitations of this study, it can be concluded that Er, Cr: YSGG laser irradiation could cause distortions of the surfaces

  14. 10 CFR 39.5 - Interpretations.

    Science.gov (United States)

    2010-01-01

    ... Interpretations. Except as specifically authorized by the Commission in writing, no interpretation of the meaning... 10 Energy 1 2010-01-01 2010-01-01 false Interpretations. 39.5 Section 39.5 Energy NUCLEAR... interpretation by the General Counsel, will be recognized to be binding upon the Commission. ...

  15. 34 CFR 300.39 - Special education.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Special education. 300.39 Section 300.39 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION ASSISTANCE TO STATES FOR THE EDUCATION OF CHILDREN WITH...

  16. 18 CFR 704.39 - Discount rate.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Discount rate. 704.39... STANDARDS AND PROCEDURES Standards for Plan Formulation and Evaluation § 704.39 Discount rate. (a) The interest rate to be used in plan formulation and evaluation for discounting future benefits and computing...

  17. 24 CFR 242.39 - Insurance endorsement.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 242.39... MORTGAGE INSURANCE FOR HOSPITALS Endorsement for Insurance § 242.39 Insurance endorsement. Initial endorsement of the mortgage note shall occur before any mortgage proceeds are insured, and the time of final...

  18. 18 CFR 35.39 - Affiliate restrictions.

    Science.gov (United States)

    2010-04-01

    ... with a market-regulated power sales affiliate if the sharing could be used to the detriment of captive... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Affiliate restrictions. 35.39 Section 35.39 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION...

  19. 7 CFR 1219.39 - Board procedure.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Board procedure. 1219.39 Section 1219.39 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE HASS AVOCADO PROMOTION, RESEARCH...

  20. 10 CFR 39.37 - Physical inventory.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Physical inventory. 39.37 Section 39.37 Energy NUCLEAR... inventory. Each licensee shall conduct a semi-annual physical inventory to account for all licensed material received and possessed under the license. The licensee shall retain records of the inventory for 3 years...

  1. 39 CFR 913.2 - Service.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Service. 913.2 Section 913.2 Postal Service UNITED STATES POSTAL SERVICE PROCEDURES PROCEDURES FOR THE ISSUANCE OF ADMINISTRATIVE SUBPOENAS UNDER 39 U.S.C. 3016 § 913.2 Service. (a) Service within the United States. A subpoena issued under this section may be...

  2. 21 CFR 26.39 - Equivalence assessment.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Equivalence assessment. 26.39 Section 26.39 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL MUTUAL RECOGNITION OF PHARMACEUTICAL GOOD MANUFACTURING PRACTICE REPORTS, MEDICAL DEVICE QUALITY SYSTEM AUDIT REPORTS, AND CERTAIN MEDICAL DEVICE PRODUCT...

  3. 41 CFR 101-39.400 - General.

    Science.gov (United States)

    2010-07-01

    ... FEDERAL PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET... responsible for the operation of General Services Administration (GSA) Interagency Fleet Management System... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true General. 101-39.400...

  4. 41 CFR 101-39.102 - Determinations.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.102 Determinations. Each determination to establish a fleet management system... name of the executive agency designated to be responsible for operating the fleet management system and...

  5. 10 CFR 39.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Definitions. 39.2 Section 39.2 Energy NUCLEAR REGULATORY.... Energy compensation source (ECS) means a small sealed source, with an activity not exceeding 3.7 MBq... of this part, means a geologic formation that is capable of yielding fresh water to a well or spring...

  6. 48 CFR 39.002 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... include a system that is to be used for routine administrative and business applications, such as payroll... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Definitions. 39.002 Section 39.002 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SPECIAL CATEGORIES OF...

  7. 41 CFR 101-39.200 - Scope.

    Science.gov (United States)

    2010-07-01

    ... participating agencies. These services may be furnished through commercial rental companies, private sector... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Scope. 101-39.200 Section 101-39.200 Public Contracts and Property Management Federal Property Management Regulations System...

  8. 7 CFR 1209.39 - Duties.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Duties. 1209.39 Section 1209.39 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... statements to be prepared in conformity with generally accepted accounting principles and to be audited by an...

  9. Influence of c-axis orientation and scandium concentration on infrared active modes of magnetron sputtered Sc{sub x}Al{sub 1−x}N thin films

    Energy Technology Data Exchange (ETDEWEB)

    Mayrhofer, P. M.; Bittner, A.; Schmid, U. [Institute of Sensor and Actuator Systems, Vienna University of Technology, Floragasse 7, 1040 Vienna (Austria); Eisenmenger-Sittner, C. [Institute of Solid State Physics, Vienna University of Technology, Wiedner Hauptstrasse 8, 1040 Vienna (Austria); Euchner, H. [Institute of Materials Science and Technology, Vienna University of Technology, Karlsplatz 13, 1040 Vienna (Austria)

    2013-12-16

    Doping of wurtzite aluminium nitride (AlN) with scandium (Sc) significantly enhances the piezoelectric properties of AlN. Sc{sub x}Al{sub 1−x}N thin films with different Sc concentrations (x = 0 to 0.15) were deposited by DC reactive magnetron sputtering. Infrared (IR) absorbance spectroscopy was applied to investigate the Sc concentration dependent shift of the IR active modes E{sub 1}(TO) and A{sub 1}(TO). These results are compared to ab initio simulations, being in excellent agreement with the experimental findings. In addition, IR spectroscopy is established as an economical and fast method to distinguish between thin films with a high degree of c-axis orientation and those exhibiting mixed orientations.

  10. GPR39 Zn2+-sensing receptor

    DEFF Research Database (Denmark)

    Młyniec, Katarzyna; Singewald, Nicolas; Holst, Birgitte

    2015-01-01

    exhibits an antidepressant-like profile, as demonstrated in both preclinical and clinical studies. Recent reports indicate that the GPR39 Zn2+-sensing receptor is an important target for zinc “transmission” (its activation modulates/induces diverse biochemical pathways involved in neuroprotection......). Preclinical studies provide evidence that zinc deficiency leads to depressive-like behavior related to down-regulation of the GPR39 Zn2+-sensing receptor. Zinc binds to the GPR39 and triggers signals, leading to CRE-dependent gene transcription, resulting in increases in proteins such as brain......-derived neurotrophic factor (BDNF), that plays a pivotal role in antidepressant action. Chronic administration of many antidepressants induces GPR39 up-regulation, which suggests that the Zn2+-sensing receptor may be considered as a new target for drug development in the field of depression....

  11. 27 CFR 11.39 - Seasonal dealers.

    Science.gov (United States)

    2010-04-01

    ... OF THE TREASURY LIQUORS CONSIGNMENT SALES Rules for the Return of Distilled Spirits, Wine, and Malt Beverages Exchanges and Returns for Ordinary and Usual Commercial Reasons § 11.39 Seasonal dealers. Industry...

  12. 39 CFR 2.4 - Seal.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Seal. 2.4 Section 2.4 Postal Service UNITED STATES... (ARTICLE II) § 2.4 Seal. (a) The Seal of the Postal Service is filed by the Board in the Office of the Secretary of State, and is required by 39 U.S.C. 207 to be judicially noticed. The Seal shall be in the...

  13. Feshbach resonances in ultracold {sup 39}K

    Energy Technology Data Exchange (ETDEWEB)

    D' Errico, Chiara [LENS and Dipartimento di Fisica, Universita di Firenze, Via Nello Carrara 1, 50019 Sesto Fiorentino (Italy); Zaccanti, Matteo [LENS and Dipartimento di Fisica, Universita di Firenze, Via Nello Carrara 1, 50019 Sesto Fiorentino (Italy); Fattori, Marco [Museo Storico della Fisica e Centro Studi e Ricerche ' Enrico Fermi' , Compendio del Viminale, 00184 Roma (Italy); Roati, Giacomo [LENS and Dipartimento di Fisica, Universita di Firenze, Via Nello Carrara 1, 50019 Sesto Fiorentino (Italy); Inguscio, Massimo [LENS and Dipartimento di Fisica, Universita di Firenze, Via Nello Carrara 1, 50019 Sesto Fiorentino (Italy); Modugno, Giovanni [LENS and Dipartimento di Fisica, Universita di Firenze, Via Nello Carrara 1, 50019 Sesto Fiorentino (Italy); Simoni, Andrea [Laboratoire de Physique des Atomes, Lasers, Molecules et Surfaces, UMR 6627 du CNRS and Universite de Rennes, 35042 Rennes Cedex (France)

    2007-07-15

    We discover several magnetic Feshbach resonances in collisions of ultracold {sup 39}K atoms, by studying atom losses and molecule formation. Accurate determination of the magnetic-field resonance locations allows us to optimize a quantum collision model for potassium isotopes. We employ the model to predict the magnetic-field dependence of scattering lengths and of near-threshold molecular levels. Our findings will be useful to plan future experiments on ultracold {sup 39}K atoms and molecules.

  14. 49 CFR 1242.30 - Dismantling retired road property and depreciation (accounts XX-17-39, XX-18-39, XX-19-39, 62-17...

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Dismantling retired road property and depreciation (accounts XX-17-39, XX-18-39, XX-19-39, 62-17-00, 62-18-00, and 62-19-00). 1242.30 Section 1242.30....30 Dismantling retired road property and depreciation (accounts XX-17-39, XX-18-39, XX-19-39, 62-17...

  15. 39 CFR 121.2 - Periodicals.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Periodicals. 121.2 Section 121.2 Postal Service... § 121.2 Periodicals. (a) End-to-End. (1) For all SCF turnaround Periodicals properly accepted before the... through 99591), 996, 997, 998, and 999. (2) The Periodicals service standard is the sum of the applicable...

  16. 39 CFR 551.6 - Pricing.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Pricing. 551.6 Section 551.6 Postal Service UNITED STATES POSTAL SERVICE POSTAGE PROGRAMS SEMIPOSTAL STAMP PROGRAM § 551.6 Pricing. (a) The Semipostal Authorization Act, as amended by Public Law 107-67, section 652, 115 Stat. 514 (2001), prescribes that the price...

  17. 39 CFR 501.19 - Intellectual property.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Intellectual property. 501.19 Section 501.19... POSTAGE EVIDENCING SYSTEMS § 501.19 Intellectual property. Providers submitting Postage Evidencing Systems to the Postal Service for approval are responsible for obtaining all intellectual property licenses...

  18. 21 CFR 814.39 - PMA supplements.

    Science.gov (United States)

    2010-04-01

    ... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES PREMARKET APPROVAL OF MEDICAL DEVICES Premarket Approval Application (PMA) § 814.39 PMA supplements. Link to... of the expiration date of the device based on data obtained under a new or revised stability or...

  19. 39 CFR 261.3 - Policy.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Policy. 261.3 Section 261.3 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION RECORDS AND INFORMATION MANAGEMENT § 261.3 Policy... absolute minimum the records holdings of the Postal Service by strict adherence to established records...

  20. 39 CFR 3002.3 - Official seal.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Official seal. 3002.3 Section 3002.3 Postal Service POSTAL REGULATORY COMMISSION PERSONNEL ORGANIZATION § 3002.3 Official seal. (a) Authority. The Seal described in this section is hereby established as the official seal of the Postal Rate Commission...

  1. 41 CFR 101-39.303 - Maintenance.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Maintenance. 101-39.303... Maintenance. In order to ensure uninterrupted operation of GSA Interagency Fleet Management System (IFMS) vehicles, safety and preventive maintenance inspections will be performed at regularly scheduled intervals...

  2. 39 CFR 262.3 - Information.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Information. 262.3 Section 262.3 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION RECORDS AND INFORMATION MANAGEMENT DEFINITIONS § 262.3 Information. Data combined with the knowledge of its context and having the potential to...

  3. 39 CFR 601.101 - Effective date.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Effective date. 601.101 Section 601.101 Postal... RIGHTS OTHER THAN PATENTS PURCHASING OF PROPERTY AND SERVICES § 601.101 Effective date. These regulations... that date will be governed by the regulations in effect at the time the solicitation was issued. ...

  4. 33 CFR 142.39 - Respiratory protection.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Respiratory protection. 142.39... Respiratory protection. (a) Personnel in an atmosphere specified under ANSI Z88.2, requiring the use of respiratory protection equipment shall wear the type of respiratory protection equipment specified in ANSI Z88...

  5. 39 CFR 3004.12 - Reading room.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Reading room. 3004.12 Section 3004.12 Postal... Reading room. (a) The Commission maintains a public reading room at its offices (901 New York Avenue, NW., Suite 200, Washington, DC 20268-0001) and an electronic reading room at http://www.prc.gov. The public...

  6. 39 CFR 3001.20 - Formal intervention.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Formal intervention. 3001.20 Section 3001.20... Applicability § 3001.20 Formal intervention. (a) Who may intervene. A notice of intervention will be entertained... interest of such nature that intervention is allowed by the Act, or appropriate to its administration. (b...

  7. 39 CFR 3020.92 - Public input.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Public input. 3020.92 Section 3020.92 Postal Service POSTAL REGULATORY COMMISSION PERSONNEL PRODUCT LISTS Requests Initiated by the Postal Service to Change the Mail Classification Schedule § 3020.92 Public input. The Commission shall publish Postal...

  8. Water SA - Vol 39, No 1 (2013)

    African Journals Online (AJOL)

    Pedological criteria for estimating the importance of subsurface lateral flow in E horizons in South African soils · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JJ van Tol, M Hensley, PAL Le Roux, 47-56. http://dx.doi.org/10.4314/wsa.v39i1.7 ...

  9. 39 CFR 960.21 - Judicial review.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Judicial review. 960.21 Section 960.21 Postal... JUSTICE ACT IN POSTAL SERVICE PROCEEDINGS Procedures for Considering Applications § 960.21 Judicial review..., appeal the determination to the court of the United States having jurisdiction to review the merits of...

  10. 39 CFR 3060.42 - Commission review.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Commission review. 3060.42 Section 3060.42 Postal... COMPETITIVE PRODUCTS ENTERPRISE § 3060.42 Commission review. (a) Interested persons shall be provided an... documentation. (b) The Commission will review the calculation of the assumed Federal income tax submitted...

  11. 39 CFR 3020.75 - Review.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Review. 3020.75 Section 3020.75 Postal Service POSTAL REGULATORY COMMISSION PERSONNEL PRODUCT LISTS Proposal of the Commission To Modify the Product Lists Described Within the Mail Classification Schedule § 3020.75 Review. The Commission shall review...

  12. 39 CFR 3020.55 - Review.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Review. 3020.55 Section 3020.55 Postal Service... the Product Lists Described Within the Mail Classification Schedule § 3020.55 Review. The Commission shall review the request, the Postal Service reply, and any public comment to determine whether the...

  13. 39 CFR 3020.34 - Review.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Review. 3020.34 Section 3020.34 Postal Service... the Product Lists Described Within the Mail Classification Schedule § 3020.34 Review. The Commission shall review the request and responsive comments. The Commission shall either: (a) Approve the request...

  14. 39 CFR 3020.52 - Supporting justification.

    Science.gov (United States)

    2010-07-01

    ... the Commission of the nature, scope, significance, and impact of the proposed modification. ... reserved to the Postal Service under 18 U.S.C. 1696 subject to the exceptions set forth in 39 U.S.C. 601; (f) Provide a description of the availability and nature of enterprises in the private sector engaged...

  15. 9 CFR 3.9 - Feeding.

    Science.gov (United States)

    2010-01-01

    ... condition. (b) Food receptacles must be used for dogs and cats, must be readily accessible to all dogs and... STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of Dogs and Cats 1 Animal Health and Husbandry Standards § 3.9 Feeding. (a) Dogs and cats must be fed at least once each day...

  16. 39 CFR 601.100 - Purchasing policy.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Purchasing policy. 601.100 Section 601.100 Postal Service UNITED STATES POSTAL SERVICE PROCUREMENT SYSTEM FOR THE U.S. POSTAL SERVICE: INTELLECTUAL PROPERTY RIGHTS OTHER THAN PATENTS PURCHASING OF PROPERTY AND SERVICES § 601.100 Purchasing policy. The Postal...

  17. 39 CFR 221.5 - Headquarters organization.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Headquarters organization. 221.5 Section 221.5 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION GENERAL ORGANIZATION § 221.5 Headquarters organization. (a) Postmaster General—(1) Appointment. The postmaster general (PMG), the chief...

  18. Africa Insight - Vol 39, No 4 (2010)

    African Journals Online (AJOL)

    Political expediency and the rule of law in Africa: A focus on selected cases · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. F Ikome, D Kode. http://dx.doi.org/10.4314/ai.v39i4.54655 ...

  19. 39 CFR 3030.11 - Service.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Service. 3030.11 Section 3030.11 Postal Service... Pleadings § 3030.11 Service. Any person filing a complaint must simultaneously serve a copy of the complaint on the Postal Service at the following address: [email protected] A complaint is not deemed...

  20. 39 CFR 952.8 - Service.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Service. 952.8 Section 952.8 Postal Service UNITED STATES POSTAL SERVICE PROCEDURES RULES OF PRACTICE IN PROCEEDINGS RELATIVE TO FALSE REPRESENTATION AND LOTTERY ORDERS § 952.8 Service. (a) Where the Respondent's mailing address is within the United States...

  1. 39 CFR 10.2 - Advisory service.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Advisory service. 10.2 Section 10.2 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE RULES OF CONDUCT FOR POSTAL SERVICE GOVERNORS (ARTICLE X) § 10.2 Advisory service. (a) The General Counsel is the Ethical...

  2. 39 CFR 3060.20 - Reports.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Reports. 3060.20 Section 3060.20 Postal Service... PRODUCTS ENTERPRISE § 3060.20 Reports. (a) Beginning with reports for FY 2009, the Postal Service shall file with the Commission each of the reports required by this part by no later than 90 days after the...

  3. 39 CFR 273.10 - Reports.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Reports. 273.10 Section 273.10 Postal Service... REMEDIES ACT § 273.10 Reports. (a) Not later than October 31 of each year, the Postmaster General shall prepare and transmit to the appropriate committees and subcommittees of the Congress an annual report...

  4. 39 CFR 259.2 - Red Cross.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Red Cross. 259.2 Section 259.2 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION SERVICES PERFORMED FOR OTHER AGENCIES § 259... relatives and friends concerning the whereabouts and welfare of the disaster victims, or to make contact...

  5. 39 CFR 955.28 - Suspension.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Suspension. 955.28 Section 955.28 Postal Service UNITED STATES POSTAL SERVICE PROCEDURES RULES OF PRACTICE BEFORE THE POSTAL SERVICE BOARD OF CONTRACT APPEALS § 955.28 Suspension. (a) Whenever at any time it appears that the parties are in agreement as to...

  6. 39 CFR 957.27 - Suspension.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Suspension. 957.27 Section 957.27 Postal Service... SUSPENSION FROM CONTRACTING § 957.27 Suspension. (a) Any firm or individual suspended under chapter 3, section 7 of the Postal Service Purchasing Manual who believes that the suspension has not been in...

  7. 9 CFR 311.39 - Biological residues.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Biological residues. 311.39 Section... Biological residues. Carcasses, organs, or other parts of carcasses of livestock shall be condemned if it is determined that they are adulterated because of the presence of any biological residues. ...

  8. 41 CFR 101-39.403 - Investigation.

    Science.gov (United States)

    2010-07-01

    ... FEDERAL PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET... Interagency Fleet Management System (IFMS) vehicle shall be investigated and a report furnished to the manager of the GSA IFMS fleet management center which issued the vehicle. (b) The agency employing the...

  9. 41 CFR 101-39.001 - Authority.

    Science.gov (United States)

    2010-07-01

    ... FEDERAL PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET... establishing fleet management systems to serve the needs of executive agencies; and (b) provide for the establishment, maintenance, and operation (including servicing and storage) of fleet management systems for...

  10. 41 CFR 101-39.003 - Financing.

    Science.gov (United States)

    2010-07-01

    ... FEDERAL PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET..., and operation of fleet management systems. (b) When an agency other than GSA operates an interagency fleet management system, the financing and accounting methods shall be developed by GSA in cooperation...

  11. Durability of coated CR-39 industrial lenses.

    Science.gov (United States)

    Chou, B Ralph; Hovis, Jeffery K

    2003-10-01

    To study the effect of coatings on the resistance of CR-39 industrial plano lenses to ballistic impacts and abrasion from fine particles. Twelve groups of CR-39 lenses with various scratch-resistant (SR) or combinations of scratch-resistant and antireflective (SR-AR) coatings were mounted in metal industrial spectacle frames. The ZEST protocol was used to determine the mean impact speed for breakage of each lens group using the Canadian Standards Association ballistic test protocol. One pair of lenses from each group was tested for abrasion resistance using the falling sand method. Abrasion resistance was ranked by the degree of haze observed by three independent observers. Uncoated lenses had the best impact resistance and worst abrasion resistance. SR-coated lenses showed mild to moderate reductions in impact resistance, with no correlation between impact and abrasion resistance. SR-AR-coated lenses had very good abrasion resistance, but severely reduced impact resistance. Most SR-coated CR-39 lenses have a high probability of meeting the high-velocity impact resistance requirement of industrial lenses, whereas CR-39 lenses with SR-AR coats are too fragile to be used in industrial spectacles. As a group, the SR-AR coating tended to be more resistant to abrasion by fine particles and less resistant to ballistic impacts, but the abrasion resistance of the SR-coated lenses was more variable, and, thus, overall there was no significant correlation between impact resistance and abrasion resistance.

  12. 39 CFR 601.105 - Business relationships.

    Science.gov (United States)

    2010-07-01

    ... valued customers of similar size and importance. The Postal Service reserves the right to decline to... reasonable business expectations or provide a high level of confidence regarding quality, prompt service, and... 39 Postal Service 1 2010-07-01 2010-07-01 false Business relationships. 601.105 Section 601.105...

  13. Ghana Journal of Science - Vol 39 (1999)

    African Journals Online (AJOL)

    Testing of induced mutants of winged bean (Psophocarpus tetragonolobus (L.) DC) for nodulation and phenotypic performance · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. GYP Klu, FK Kumaga, 55-62. http://dx.doi.org/10.4314/gjs.v39i1.15857 ...

  14. 39 CFR 263.4 - Records disposal.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Records disposal. 263.4 Section 263.4 Postal... § 263.4 Records disposal. All disposals of records containing sensitive information, i.e. transfers to... records regarding such disposal, must be accomplished in accordance with procedures issued by the Records...

  15. 39 CFR 447.61 - General.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false General. 447.61 Section 447.61 Postal Service UNITED STATES POSTAL SERVICE PERSONNEL RULES OF CONDUCT FOR POSTAL EMPLOYEES Bribery, Undue Influence, or... Service uses or attempts to use a bribe, undue influence, or coercion to induce or attempt to induce the...

  16. 39 CFR 3030.14 - Answer contents.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Answer contents. 3030.14 Section 3030.14 Postal... Initial Pleadings § 3030.14 Answer contents. (a) An answer must: (1) Contain a clear and concise statement... believes additional such steps would be inappropriate and the reasons for that belief. (b) The Commission...

  17. 48 CFR 39.101 - Policy.

    Science.gov (United States)

    2010-10-01

    ... OMB Circular A-127, Financial Management Systems, when acquiring financial management systems. Agencies may acquire only core financial management software certified by the Joint Financial Management... CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY General 39.101 Policy. (a) Division A, Section 101(h), Title...

  18. 39 CFR 775.10 - Environmental assessments.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Environmental assessments. 775.10 Section 775.10... PROCEDURES § 775.10 Environmental assessments. (a) An environmental assessment must contain: (1) A summary of... permits necessary to complete the proposed action. (b) Those preparing an environmental assessment must...

  19. 39 CFR 255.5 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Employment. 255.5 Section 255.5 Postal Service... Employment. No qualified individual with a disability shall, on the basis of disability, be subjected to discrimination in employment with the Postal Service. The definitions, requirements, and procedures of section...

  20. 41 CFR 101-39.402 - Recommendations for disciplinary action.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.4-Accidents and Claims § 101-39.402 Recommendations for... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Recommendations for disciplinary action. 101-39.402 Section 101-39.402 Public Contracts and Property Management Federal Property...

  1. Two scandium-biuret complexes: [Sc(C2H5N3O2)(H2O)5]Cl3 x H2O and [Sc(C2H5N3O2)4](NO3)3.

    Science.gov (United States)

    Harrison, William T A

    2008-05-01

    The scandium(III) cations in the structures of pentaaqua(biuret-kappa(2)O,O')scandium(III) trichloride monohydrate, [Sc(C(2)H(5)N(3)O(2))(H(2)O)(5)]Cl(3) x H(2)O, (I), and tetrakis(biuret-kappa(2)O,O')scandium(III) trinitrate, [Sc(C(2)H(5)N(3)O(2))(4)](NO(3))(3), (II), are found to adopt very different coordinations with the same biuret ligand. The roles of hydrogen bonding and the counter-ion in the establishment of the structures are described. In (I), the Sc(3+) cation adopts a fairly regular pentagonal bipyramidal coordination geometry arising from one O,O'-bidentate biuret molecule and five water molecules. A dense network of N-H...Cl, O-H...O and O-H...Cl hydrogen bonds help to establish the packing, resulting in dimeric associations of two cations and two water molecules. In (II), the Sc(3+) cation (site symmetry 2) adopts a slightly squashed square-antiprismatic geometry arising from four O,O'-bidentate biuret molecules. A network of N-H...O hydrogen bonds help to establish the packing, which features [010] chains of cations. One of the nitrate ions is disordered about an inversion centre. Both structures form three-dimensional hydrogen-bond networks.

  2. Struktuur en strekking van Job 38: 39-39: 30 | Bezuidenhout | HTS ...

    African Journals Online (AJOL)

    Such elements or motifs are identified. The motifs succeed each other according to a systematic pattern. This approach is applied to Job 38: 39-39: 30. The coherence of the text is attested. Aspects of the animal kingdom are used to draw the attention to God's providence. Yet God's actions cannot be forced into a system of ...

  3. 41 CFR 109-39.107 - Limited exemptions.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.107 Limited exemptions. The Director, Office of... exemptions from the fleet management system. ...

  4. Investigation of proton response of CR-39

    Energy Technology Data Exchange (ETDEWEB)

    Al-Jarallah, M.I. [King Fahd University of Petroleum and Minerals, Dhahran (Saudi Arabia). Dept. of Physics; Abu-Jarad, F.; Hallak, A.B.; Coban, A.; Islam, M. [King Fahd University of Petroleum and Minerals, Dhahran (Saudi Arabia). Energy Research Laboratory, Research Inst.

    1993-12-31

    CR-39 type super grade PM-355 samples have been irradiated at normal incidence with monoenergetic protons at selected energies in the range of 0.2 to 5 MeV. The sensitivity function and its variation with energy have been experimentally determined. A clear shift was observed in the maximum sensitivity towards higher proton energies with the increase in etching time. The critical angle for proton registration decreases rapidly between 0.2 MeV and 0.5 to 0.8 MeV depending on the etching time. For higher energies the critical angle increases gradually. The CR-39 detection efficiency for protons was fond to be about 100% within experimental accuracy for all energies in comparison with that of a surface barrier detector. (author).

  5. Investigation of proton response of CR-39

    Energy Technology Data Exchange (ETDEWEB)

    Al-Jarallah, M.I. (Dept. of Physics, King Fahd Univ. of Petroleum and Minerals, Dhahran (Saudi Arabia)); Abu-Jarad, F.; Hallak, A.B.; Coban, A.; Islam, M. (Energy Research Lab., Research Inst., King Fahd Univ. of Petroleum and Minerals, Dhahran (Saudi Arabia))

    1993-04-01

    CR-39 type super grade PM-355 samples have been irradiated at normal incidence with monoenergetic protons at selected energies in the range from 0.2 to 5 MeV. The sensitivity function and its variation with energy have been experimentally determined. A clear shift was observed in the maximum sensitivity towards higher proton energies with the increase in etching time. The critical angle for proton registration decreases rapidly between 0.2 MeV and 0.5 to 0.8 MeV depending on the etching time. For higher energies for critical angle increases gradually. The CR-39 detection efficiency for protons was found to be about 100% within the experimental accuracy for all energies in comparison with that of a surface barrier detector. (orig.).

  6. 39 CFR 262.5 - Systems (Privacy).

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Systems (Privacy). 262.5 Section 262.5 Postal... DEFINITIONS § 262.5 Systems (Privacy). (a) Privacy Act system of records. A Postal Service system containing... individual. (c) Computer matching program. A “matching program,” as defined in the Privacy Act, 5 U.S.C. 552a...

  7. 41 CFR 101-39.407 - Accident records.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.4-Accidents and Claims § 101-39.407 Accident records. If GSA's records... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Accident records. 101-39.407 Section 101-39.407 Public Contracts and Property Management Federal Property Management...

  8. 41 CFR 101-39.4900 - Scope of subpart.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.49-Forms § 101-39.4900 Scope of subpart. This subpart provides the... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Scope of subpart. 101-39.4900 Section 101-39.4900 Public Contracts and Property Management Federal Property Management...

  9. Analysis list: Suv39h1 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Suv39h1 Pluripotent stem cell + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Suv...39h1.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Suv39h1.5.tsv http://dbarchive.bi...osciencedbc.jp/kyushu-u/mm9/target/Suv39h1.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Suv39h

  10. Analysis list: Suv39h2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Suv39h2 Pluripotent stem cell + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Suv...39h2.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Suv39h2.5.tsv http://dbarchive.bi...osciencedbc.jp/kyushu-u/mm9/target/Suv39h2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Suv39h

  11. Catalytic pyrolysis using UZM-39 aluminosilicate zeolite

    Science.gov (United States)

    Nicholas, Christpher P; Boldingh, Edwin P

    2013-12-17

    A new family of coherently grown composites of TUN and IMF zeotypes has been synthesized and show to be effective catalysts for catalytic pyrolysis of biomass. These zeolites are represented by the empirical formula. Na.sub.nM.sub.m.sup.n+R.sub.rQ.sub.qAl.sub1-xE.sub.xSi.sub.yO.s- ub.z where M represents zinc or a metal or metals from Group 1, Group 2, Group 3 or the lanthanide series of the periodic table, R is an A,.OMEGA.-dihalosubstituted paraffin such as 1,4-dibromobutane, Q is a neutral amine containing 5 or fewer carbon atoms such as 1-methylpyrrolidine and E is a framework element such as gallium. The process involves contacting a carbonaceous biomass feedstock with UZM-39 at pyrolysis conditions to produce pyrolysis gases comprising hydrocarbons. The catalyst catalyzes a deoxygenation reaction converting oxygenated hyrdocarbons into hydrocarbons removing the oxygen as carbon oxides and water. A portion of the pyrolysis gases is condensed to produce low oxygen biomass-derived pyrolysis oil.

  12. 42 CFR 60.39 - Death and disability claims.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Death and disability claims. 60.39 Section 60.39 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS HEALTH EDUCATION ASSISTANCE LOAN PROGRAM The Lender and Holder § 60.39 Death and disability claims. (a) Death. The Secretary...

  13. 25 CFR 39.405 - How will verifications be conducted?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How will verifications be conducted? 39.405 Section 39... EQUALIZATION PROGRAM Accountability § 39.405 How will verifications be conducted? The eligibility of every student shall be verified. The ELO will take a random sampling of five days with a minimum of one day per...

  14. 38 CFR 39.20 - Site planning standards.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Site planning standards. 39.20 Section 39.20 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED...-10) Standards and Requirements for Project § 39.20 Site planning standards. (a) Site selection—(1...

  15. 10 CFR 39.69 - Radioactive contamination control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Radioactive contamination control. 39.69 Section 39.69... Radiation Safety Requirements § 39.69 Radioactive contamination control. (a) If the licensee detects evidence that a sealed source has ruptured or licensed materials have caused contamination, the licensee...

  16. 10 CFR 1.39 - Office of Human Resources.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Office of Human Resources. 1.39 Section 1.39 Energy... § 1.39 Office of Human Resources. The Office of Human Resources— (a) Plans and implements NRC policies... agency's human resources; (b) Provides labor relations and personnel policy guidance and supporting...

  17. 25 CFR 226.39 - Measurement of gas.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Measurement of gas. 226.39 Section 226.39 Indians BUREAU... FOR OIL AND GAS MINING Requirements of Lessees § 226.39 Measurement of gas. All gas, required to be... the Superintendent. All gas meters must be approved by the Superintendent and installed at the expense...

  18. 14 CFR 120.39 - Testing for alcohol.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Testing for alcohol. 120.39 Section 120.39... AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS DRUG AND ALCOHOL TESTING PROGRAM... Under § 91.147 of This Chapter and Safety-Sensitive Employees § 120.39 Testing for alcohol. (a) Each...

  19. 29 CFR 101.39 - Initiation of advisory opinion case.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Initiation of advisory opinion case. 101.39 Section 101.39... Opinions and Declaratory Orders Regarding Board Jurisdiction § 101.39 Initiation of advisory opinion case... advisory opinion determining whether it would or would not assert jurisdiction on the basis of the facts...

  20. 34 CFR 668.39 - Study abroad programs.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Study abroad programs. 668.39 Section 668.39 Education..., DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Student Eligibility § 668.39 Study abroad programs. A student enrolled in a program of study abroad is eligible to receive title IV, HEA program...

  1. 10 CFR 39.13 - Specific licenses for well logging.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Specific licenses for well logging. 39.13 Section 39.13 Energy NUCLEAR REGULATORY COMMISSION LICENSES AND RADIATION SAFETY REQUIREMENTS FOR WELL LOGGING Specific Licensing Requirements § 39.13 Specific licenses for well logging. The Commission will approve an...

  2. 10 CFR 39.33 - Radiation detection instruments.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Radiation detection instruments. 39.33 Section 39.33... Equipment § 39.33 Radiation detection instruments. (a) The licensee shall keep a calibrated and operable radiation survey instrument capable of detecting beta and gamma radiation at each field station and...

  3. 10 CFR 39.53 - Energy compensation source.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Energy compensation source. 39.53 Section 39.53 Energy NUCLEAR REGULATORY COMMISSION LICENSES AND RADIATION SAFETY REQUIREMENTS FOR WELL LOGGING Equipment § 39.53 Energy compensation source. The licensee may use an energy compensation source (ECS) which is...

  4. 10 CFR 39.55 - Tritium neutron generator target sources.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Tritium neutron generator target sources. 39.55 Section 39... Equipment § 39.55 Tritium neutron generator target sources. (a) Use of a tritium neutron generator target...) Use of a tritium neutron generator target source, containing quantities exceeding 1,110 GBg or in a...

  5. 19 CFR 111.39 - Advice to client.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Advice to client. 111.39 Section 111.39 Customs... CUSTOMS BROKERS Duties and Responsibilities of Customs Brokers § 111.39 Advice to client. (a) Withheld or false information. A broker must not withhold information relative to any customs business from a client...

  6. 41 CFR 101-39.103 - Agency appeals.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Agency appeals. 101-39.103 Section 101-39.103 Public Contracts and Property Management Federal Property Management...

  7. 41 CFR 101-39.101-1 - Agency cooperation.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Agency cooperation. 101-39.101-1 Section 101-39.101-1 Public Contracts and Property Management Federal Property Management...

  8. 41 CFR 101-39.306 - Operator's packet.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.3-Use and Care of GSA Interagency Fleet Management System Vehicles § 101-39.306 Operator's packet. The GSA Interagency Fleet Management System (IFMS) will provide each... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Operator's packet. 101-39...

  9. 41 CFR 109-39.101-1 - Agency cooperation.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.101-1 Agency cooperation. The Director, Office of... representatives to coordinate with GSA concerning the establishment of a GSA fleet management system to serve...

  10. 41 CFR 101-39.104-2 - Reimbursement.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Reimbursement. 101-39.104-2 Section 101-39.104-2 Public Contracts and Property Management Federal Property Management...

  11. 41 CFR 101-39.405 - Claims against the Government.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.4-Accidents and Claims § 101-39.405 Claims against the Government. (a) Whenever a GSA Interagency Fleet Management System (IFMS) vehicle is involved in an accident... against the agency using a GSA Interagency Fleet Management System (IFMS) vehicle, the agency shall...

  12. 41 CFR 109-39.103 - Agency appeals.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.103 Agency appeals. The Director, Office of... request exemption from, a determination made by GSA concerning the establishment of a fleet management...

  13. 41 CFR 101-39.406 - Responsibility for damages.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.4-Accidents and Claims § 101-39.406 Responsibility for..., and parking lot damage, to a GSA Interagency Fleet Management System (IFMS) vehicle which occurs... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Responsibility for...

  14. 41 CFR 109-39.106 - Unlimited exemptions.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.106 Unlimited exemptions. The Director, Office of... determination that an unlimited exemption from inclusion of a motor vehicle in a fleet management system is...

  15. 36 CFR 7.39 - Mesa Verde National Park.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Mesa Verde National Park. 7.39 Section 7.39 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR SPECIAL REGULATIONS, AREAS OF THE NATIONAL PARK SYSTEM § 7.39 Mesa Verde National Park. (a) Visiting of...

  16. 7 CFR 28.39 - Cotton reduced in grade.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Cotton reduced in grade. 28.39 Section 28.39... REGULATIONS COTTON CLASSING, TESTING, AND STANDARDS Regulations Under the United States Cotton Standards Act Classification § 28.39 Cotton reduced in grade. If cotton be reduced in grade, by reason of the presence of...

  17. 7 CFR 319.56-39 - Fragrant pears from China.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Fragrant pears from China. 319.56-39 Section 319.56-39 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FOREIGN QUARANTINE NOTICES Fruits and Vegetables § 319.56-39 Fragrant pears from China. Fragrant pears may be...

  18. 48 CFR 39.104 - Information technology services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Information technology services. 39.104 Section 39.104 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SPECIAL CATEGORIES OF CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY General 39.104 Information technology services. When acquiring information...

  19. 49 CFR 38.39 - Destination and route signs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Destination and route signs. 38.39 Section 38.39 Transportation Office of the Secretary of Transportation AMERICANS WITH DISABILITIES ACT (ADA) ACCESSIBILITY SPECIFICATIONS FOR TRANSPORTATION VEHICLES Buses, Vans and Systems § 38.39 Destination and route signs. (a) Where...

  20. 29 CFR 785.39 - Travel away from home community.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Travel away from home community. 785.39 Section 785.39 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS... Principles Traveltime § 785.39 Travel away from home community. Travel that keeps an employee away from home...

  1. 32 CFR 564.39 - Medical care benefits.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true Medical care benefits. 564.39 Section 564.39... REGULATIONS Medical Attendance and Burial § 564.39 Medical care benefits. (a) A member of the ARNG who incurs a disease or injury under the conditions enumerated herein is entitled to medical care, in a...

  2. Analysis list: unc-39 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available unc-39 Embryo,Larvae + ce10 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/...unc-39.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/unc-39.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/ce10/target/unc-39.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/unc-39.Embryo....tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/unc-39.Larvae.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/ce10/colo/Embryo.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/Larvae.gml ...

  3. Analysis list: Hr39 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Hr39 Embryo + dm3 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/Hr39.1.tsv ...http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/Hr39.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/Hr3...9.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Hr39.Embryo.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Embryo.gml ...

  4. 48 CFR 39.102 - Management of risk.

    Science.gov (United States)

    2010-10-01

    ... obsolescence, cost risk, risk implicit in a particular contract type, technical feasibility, dependencies... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Management of risk. 39.102... CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY General 39.102 Management of risk. (a) Prior to entering...

  5. 7 CFR 4280.39 - Contents of an application.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Contents of an application. 4280.39 Section 4280.39 Agriculture Regulations of the Department of Agriculture (Continued) RURAL BUSINESS-COOPERATIVE SERVICE AND RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE LOANS AND GRANTS Rural Economic Development Loan and...

  6. 12 CFR 226.39 - Mortgage transfer disclosures.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Mortgage transfer disclosures. 226.39 Section... SYSTEM TRUTH IN LENDING (REGULATION Z) Special Rules for Certain Home Mortgage Transactions § 226.39 Mortgage transfer disclosures. (a) Scope. The disclosure requirements of this section apply to any covered...

  7. Why at Least 39 Weeks Is Best for Your Baby?

    Science.gov (United States)

    ... your baby early. But if you have a choice and you're planning to schedule your baby's birth, wait until at least 39 weeks. Babies born too early may have more health problems at birth and later in life than babies born later. Being pregnant 39 weeks ...

  8. 10 CFR 39.45 - Subsurface tracer studies.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Subsurface tracer studies. 39.45 Section 39.45 Energy....45 Subsurface tracer studies. (a) The licensee shall require all personnel handling radioactive tracer material to use protective gloves and, if required by the license, other protective clothing and...

  9. 39 CFR 3020.51 - Contents of a request.

    Science.gov (United States)

    2010-07-01

    ... Mail To Modify the Product Lists Described Within the Mail Classification Schedule § 3020.51 Contents... 39 Postal Service 1 2010-07-01 2010-07-01 false Contents of a request. 3020.51 Section 3020.51... classification within the meaning of 39 U.S.C. 3622(c)(10) for market dominant products; (2) A product not of...

  10. 34 CFR 110.39 - Exhaustion of administrative remedies.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Exhaustion of administrative remedies. 110.39 Section... FINANCIAL ASSISTANCE Investigation, Conciliation, and Enforcement Procedures § 110.39 Exhaustion of administrative remedies. (a) A complainant may file a civil action following the exhaustion of administrative...

  11. 16 CFR 303.39 - Maintenance of records.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Maintenance of records. 303.39 Section 303.39 Commercial Practices FEDERAL TRADE COMMISSION REGULATIONS UNDER SPECIFIC ACTS OF CONGRESS RULES... material through processing to finished product. (b) Any person substituting a stamp, tag, label, or other...

  12. 41 CFR 101-39.106 - Unlimited exemptions.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.106 Unlimited exemptions. Unlimited exemptions from inclusion in the fleet... below. Unlimited exemptions do not preclude agencies from requesting fleet management services, if...

  13. 41 CFR 109-39.301 - Utilization guidelines.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.3-Use and Care of GSA Interagency Fleet... justified for retention shall be returned to the issuing GSA interagency fleet management center. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Utilization guidelines...

  14. 41 CFR 101-39.206 - Seasonal or unusual requirements.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services... requirements for vehicles or related services shall inform the GSA IFMS fleet management center as far in... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Seasonal or unusual...

  15. 41 CFR 101-39.202 - Contractor authorized services.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services... related GSA Interagency Fleet Management System (IFMS) services solely for official purposes. (b) To the... -leased equipment which is not controlled by a GSA IFMS fleet management center, or for authorized...

  16. 41 CFR 101-39.004 - Optional operations.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.0-General Provisions § 101-39.004 Optional operations. Nothing in this part shall preclude the establishment or operation of interagency fleet management systems by GSA or by... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Optional operations. 101...

  17. 41 CFR 101-39.207 - Reimbursement for services.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services... using agency will be billed for GSA Interagency Fleet Management System (IFMS) services provided for... from a GSA Maintenance Control Center, or approval from a GSA fleet management center, per instructions...

  18. 41 CFR 101-39.201 - Services available.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services § 101-39.201 Services available. GSA Interagency Fleet Management System (IFMS) vehicles and services shall be used in... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Services available. 101...

  19. 41 CFR 101-39.401 - Reporting of accidents.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.4-Accidents and Claims § 101-39.401 Reporting of accidents. (a) The... manager of the GSA IFMS fleet management center issuing the vehicle; (2) The employee's supervisor; and (3... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Reporting of accidents...

  20. 7 CFR 1773.39 - Utility plant and accumulated depreciation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Utility plant and accumulated depreciation. 1773.39... Procedures and Documentation § 1773.39 Utility plant and accumulated depreciation. (a) General. The audit of... depreciation reserves; (4) Examined direct purchases of special equipment and general plant; (5) Determined the...

  1. 19 CFR 146.39 - Direct delivery procedures.

    Science.gov (United States)

    2010-04-01

    ... or of a type which requires Customs examination or documentation review before or upon its arrival at... 19 Customs Duties 2 2010-04-01 2010-04-01 false Direct delivery procedures. 146.39 Section 146.39 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...

  2. 9 CFR 77.39 - Other interstate movements.

    Science.gov (United States)

    2010-01-01

    ... qualifying the herd for herd classification.) As an alternative to testing, the herd may be depopulated. (e... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Other interstate movements. 77.39 Section 77.39 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF...

  3. 19 CFR 19.39 - Delivery for exportation.

    Science.gov (United States)

    2010-04-01

    ... has departed for its foreign destination; (4) Unit-load delivery. Merchandise may be sold to... 19 Customs Duties 1 2010-04-01 2010-04-01 false Delivery for exportation. 19.39 Section 19.39... Delivery for exportation. (a) Delivery to land border locations—(1) Land border locations. Land border...

  4. 10 CFR 1045.39 - Challenging classification and declassification determinations.

    Science.gov (United States)

    2010-01-01

    ... primarily to the military utilization of nuclear weapons, the Director of Classification shall coordinate... 10 Energy 4 2010-01-01 2010-01-01 false Challenging classification and declassification determinations. 1045.39 Section 1045.39 Energy DEPARTMENT OF ENERGY (GENERAL PROVISIONS) NUCLEAR CLASSIFICATION...

  5. Rat pancreas secretes particulate ecto-nucleotidase CD39

    DEFF Research Database (Denmark)

    Sørensen, Christiane Elisabeth; Amstrup, Jan; Rasmussen, Hans N

    2003-01-01

    In exocrine pancreas, acini release ATP and the excurrent ducts express several types of purinergic P2 receptors. Thereby, ATP, or its hydrolytic products, might play a role as a paracrine regulator between acini and ducts. The aim of the present study was to elucidate whether this acinar......-ductal signalling is regulated by nucleotidase(s), and to characterize and localize one of the nucleotidases within the rat pancreas. Using RT-PCR and Western blotting we show that pancreas expresses the full length ecto-nucleoside triphosphate diphosphohydrolase, CD39. Immunofluorescence shows CD39 localization...... relocalizes in clusters towards the lumen and is secreted. As a result, pancreatic juice collected from intact pancreas stimulated with CCK-8 contained nucleotidase activity, including that of CD39, and no detectable amounts of ATP. Anti-CD39 antibodies detected the full length (78 kDa) CD39 in pancreatic...

  6. 39 CFR 954.2 - Scope of rules.

    Science.gov (United States)

    2010-07-01

    ..., SUSPENSION, OR REVOCATION OF PERIODICALS MAIL PRIVILEGES § 954.2 Scope of rules. The rules of practice shall... Periodicals mailing privileges arising under former title 39 U.S.C. 4351, 4352, 4353, 4354, 4355, 4356, and...

  7. 34 CFR 359.33-359.39 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION DISABILITY AND REHABILITATION RESEARCH: SPECIAL PROJECTS AND DEMONSTRATIONS FOR SPINAL CORD INJURIES How Does the Secretary Make a Grant? §§ 359.33-359.39 ...

  8. 7 CFR 56.39 - Quality assurance inspector required.

    Science.gov (United States)

    2010-01-01

    ....39 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT...

  9. Optimization of CR-39 for fast neutron dosimetry applications

    CERN Document Server

    Vilela, E; Giacomelli, G; Giorgini, M; Morelli, B; Patrizii, L; Serra, P; Togo, V

    1999-01-01

    We present the results of an experimental work aimed at improving the performances of the CR-39[reg] (Registered Trademark of PPG Industries Inc.) nuclear track detector for neutron dosimetry applications. The work was done in collaboration with the Intercast Europe S.p.A., producer of CR-39 for commercial and scientific applications. We compare the CR-39 made with different additives concentrations and different polymerization processes. We evaluate the response of the CR-39 to fast neutrons from three sources: sup 2 sup 4 sup 1 Am-Be, sup 2 sup 5 sup 2 Cf and sup 2 sup 3 sup 8 Pu-Li. Particular attention was paid to background fluctuations that limit the lower detectable dose.

  10. 41 CFR 101-39.107 - Limited exemptions.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet... incorporated in the fleet management system, if the exemption has been mutually agreed upon by the... of the fleet management system. ...

  11. 41 CFR 101-39.000 - Scope of part.

    Science.gov (United States)

    2010-07-01

    ... FEDERAL PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET... operation of interagency fleet management systems and operating procedures applicable to the General Services Administration (GSA) Interagency Fleet Management System. ...

  12. 40Ar/39Ar age calibration against counted annuallayers

    DEFF Research Database (Denmark)

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach ...... correlated to the Icelandic peralkaline rhyolitic Thorsmörk ignimbrite. We will present preliminary 40Ar/39Ar results on the age of this eruption...

  13. How reliable are {sup 39}Ar groundwater ages?

    Energy Technology Data Exchange (ETDEWEB)

    Purtschert, R.; Loosli, H.H.; Corcho Alvarado, J.A. [Bern Univ., Inst. fuer Physik, Climate and Environmental Physics Div. (Switzerland)

    2004-07-01

    Increasing over-exploitation and contamination of shallow groundwaters increase also the demand for deeper and older groundwater resources. The potential and need for dating tools for the age range between young waters dated by {sup 3}He/{sup 3}H, SF{sub 6}, {sup 85}Kr, and CFC's and older waters dated e.g. by {sup 14}C, {sup 4}He, {sup 36}Cl and {sup 81}Kr is therefore undisputed. Due to a half live of 269 years {sup 39}Ar is a perfect candidate to fill this gap. Based on data from several groundwater systems, we will discuss the suitability and limitation of {sup 39}Ar in groundwater research. Underground production was always mentioned as the main problem of {sup 39}Ar dating. Our experience show, that in most cases this possibility can either be excluded or is of minor importance. For a few examples, however, we have to conclude that subsurface produced {sup 39}Ar activities does not allow radioactive dating. Dating is however only one aspect of the interpretation of {sup 39}Ar results: age- and mixing studies are always connected. Furthermore, time and space related measuring series give information about shifts of the age structures of the groundwater. Underground produced {sup 39}Ar can also provide valuable information because it's a transient 'fingerprint' of the percolated rock formations. A systematic summary is given about important practical questions and the possibilities to find answers from multi-tracer studies. (authors)

  14. Scientia Militaria: South African Journal of Military Studies - Vol 39 ...

    African Journals Online (AJOL)

    Applying reinforcement learning to the weapon assignment problem in air defence · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H Mouton, J Roodt, H le Roux, 99-116. http://dx.doi.org/10.5787/39-2-115 ...

  15. Measurements of radon in dwellings with CR-39 track detectors

    DEFF Research Database (Denmark)

    Majborn, Benny

    1986-01-01

    A passive integrating dosemeter has been designed for measuring natural radiation in dwellings. The dosemeter contains one or two CR-39 track detectors to measure radon and three thermoluminescence dosemeters to measure external radiation. The dosemeter was investigated in a pilot study in 1983/8...

  16. 14 CFR 61.39 - Prerequisites for practical tests.

    Science.gov (United States)

    2010-01-01

    ... practical test and has completed the pilot in command aircraft qualification training program that is... (CONTINUED) AIRMEN CERTIFICATION: PILOTS, FLIGHT INSTRUCTORS, AND GROUND INSTRUCTORS General § 61.39... test and has satisfactorily accomplished that operator's approved— (i) Pilot in command aircraft...

  17. 39 CFR 775.11 - Environmental impact statements.

    Science.gov (United States)

    2010-07-01

    ... proposal or its impacts. (b) Preparation. (1) Except for proposals for legislation, environmental impact... interest in the outcome of the project. (h) Proposals for Legislation. Legislative environmental impact... 39 Postal Service 1 2010-07-01 2010-07-01 false Environmental impact statements. 775.11 Section...

  18. 39 CFR 3.1 - Composition and responsibilities of Board.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Composition and responsibilities of Board. 3.1 Section 3.1 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE BOARD OF GOVERNORS (ARTICLE III) § 3.1 Composition and responsibilities of Board. The composition of the...

  19. 39 CFR 3010.43 - Data collection plan.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Data collection plan. 3010.43 Section 3010.43... Rules for Rate Adjustments for Negotiated Service Agreements (Type 2 Rate Adjustments) § 3010.43 Data collection plan. The Postal Service shall include with any notice of agreement a detailed plan for providing...

  20. 39 CFR 775.7 - Planning and early coordination.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Planning and early coordination. 775.7 Section 775.7 Postal Service UNITED STATES POSTAL SERVICE ENVIRONMENTAL REGULATIONS NATIONAL ENVIRONMENTAL POLICY ACT PROCEDURES § 775.7 Planning and early coordination. Early planning and coordination among...

  1. 18 CFR 4.39 - Specifications for maps and drawings.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Specifications for maps....39 Specifications for maps and drawings. All required maps and drawings must conform to the following specifications, except as otherwise prescribed in this chapter: (a) Each original map or drawing must consist of...

  2. 39 CFR 265.5 - Public reading rooms.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Public reading rooms. 265.5 Section 265.5 Postal... reading rooms. The Library of the Postal Service Headquarters, 475 L'Enfant Plaza SW, Washington, DC 20260-1641, serves as public reading room for the materials which are listed in paragraphs (a)(2), (3), (4...

  3. 39 CFR 221.3 - Office of Inspector General.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Office of Inspector General. 221.3 Section 221.3 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION GENERAL ORGANIZATION § 221.3... programs and operations of the Postal Service. (2) Provide leadership and coordination and recommend...

  4. 39 CFR 954.10 - Intervention or other participation.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Intervention or other participation. 954.10... RELATIVE TO THE DENIAL, SUSPENSION, OR REVOCATION OF PERIODICALS MAIL PRIVILEGES § 954.10 Intervention or.... In so doing the presiding officer will consider, among other things, whether intervention or other...

  5. 39 CFR 501.2 - Postage Evidencing System provider authorization.

    Science.gov (United States)

    2010-07-01

    ... postage under 39 U.S.C. 404(a)(2) and (4). (b) Due to the potential for adverse impact upon Postal Service... other data of a commercial nature necessary to perform the function for which approval is sought would..., security, and servicing functions and the need to maintain sufficient financial reserves to guarantee...

  6. Nigerian Journal of Paediatrics - Vol 39, No 4 (2012)

    African Journals Online (AJOL)

    Socio - demographic characteristics of child street vendors in Nnewi, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EF Ugochukwu, KN Okeke, CU Onubogu, ES Edokwe, 174-178. http://dx.doi.org/10.4314/njp.v39i4.5 ...

  7. 39 CFR 3020.31 - Contents of a request.

    Science.gov (United States)

    2010-07-01

    ... Service To Modify the Product Lists Described Within the Mail Classification Schedule § 3020.31 Contents... 39 Postal Service 1 2010-07-01 2010-07-01 false Contents of a request. 3020.31 Section 3020.31...) Indicate whether each product that is the subject of the request is: (1) A special classification within...

  8. 39 CFR 3020.71 - Contents of a proposal.

    Science.gov (United States)

    2010-07-01

    ... the Product Lists Described Within the Mail Classification Schedule § 3020.71 Contents of a proposal... 39 Postal Service 1 2010-07-01 2010-07-01 false Contents of a proposal. 3020.71 Section 3020.71...) Indicate whether each product that is the subject of the proposal is: (1) A special classification within...

  9. Journal for Language Teaching - Vol 39, No 2 (2005)

    African Journals Online (AJOL)

    Phonological awareness and the minimising of reading problems: a South African perspective · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Anna J Hugo, SG le Roux, Helene Muller, Norma Nel, 210-225. http://dx.doi.org/10.4314/jlt.v39i2.6058 ...

  10. Page 1 Thermodynamic data for Rhodochrosite 39 conditions and ...

    Indian Academy of Sciences (India)

    Thermodynamic data for Rhodochrosite 39 conditions and products are presented in table 1. The total transformation of mixture of oxide and carbonate phase into a single phase ensures the direction of the reaction and the equilibrium condition. All experiments therefore were reversed runs. The products were identified ...

  11. 40 CFR 273.39 - Tracking universal waste shipments.

    Science.gov (United States)

    2010-07-01

    .... The record may take the form of a log, invoice, manifest, bill of lading, or other shipping document..., bill of lading or other shipping document. The record for each shipment of universal waste sent must... Universal Waste § 273.39 Tracking universal waste shipments. (a) Receipt of shipments. A large quantity...

  12. 39 CFR 501.18 - Customer information and authorization.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Customer information and authorization. 501.18... AND DISTRIBUTE POSTAGE EVIDENCING SYSTEMS § 501.18 Customer information and authorization. (a) Authorized providers must electronically transmit the necessary customer information to the designated Postal...

  13. 39 CFR 501.5 - Burden of proof standard.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Burden of proof standard. 501.5 Section 501.5... POSTAGE EVIDENCING SYSTEMS § 501.5 Burden of proof standard. The burden of proof is on the Postal Service... sanctions under § 501.12. Except as otherwise indicated in those sections, the standard of proof shall be...

  14. 39 CFR 602.3 - Requests for use.

    Science.gov (United States)

    2010-07-01

    ...: Office of Licensing, Philatelic and Retail Services Department, US Postal Service, 475 L'Enfant Plaza SW... 39 Postal Service 1 2010-07-01 2010-07-01 false Requests for use. 602.3 Section 602.3 Postal Service UNITED STATES POSTAL SERVICE PROCUREMENT SYSTEM FOR THE U.S. POSTAL SERVICE: INTELLECTUAL PROPERTY...

  15. 39 CFR 255.7 - Special arrangements for postal services.

    Science.gov (United States)

    2010-07-01

    .... (2) Postal retail services and programs. (i) Stamps by mail or phone. (ii) Retail service from rural... 39 Postal Service 1 2010-07-01 2010-07-01 false Special arrangements for postal services. 255.7 Section 255.7 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION ACCESS OF...

  16. 39 CFR 601.104 - Postal purchasing authority.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Postal purchasing authority. 601.104 Section 601...: INTELLECTUAL PROPERTY RIGHTS OTHER THAN PATENTS PURCHASING OF PROPERTY AND SERVICES § 601.104 Postal purchasing..., or terminating any contract regarding the acquisition of property, services, and related purchasing...

  17. 18 CFR 39.3 - Electric Reliability Organization certification.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Electric Reliability... CERTIFICATION OF THE ELECTRIC RELIABILITY ORGANIZATION; AND PROCEDURES FOR THE ESTABLISHMENT, APPROVAL, AND ENFORCEMENT OF ELECTRIC RELIABILITY STANDARDS § 39.3 Electric Reliability Organization certification. (a) Any...

  18. 39 CFR 267.5 - National Security Information.

    Science.gov (United States)

    2010-07-01

    ... classifiable. (iii) The Postal Service shall forward all FOIA and mandatory review requests for national... 39 Postal Service 1 2010-07-01 2010-07-01 false National Security Information. 267.5 Section 267.5... information that is currently classified. (3) In the Custody of the Postal Service means any national security...

  19. 39 CFR 3001.75 - Service by the Postal Service.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Service by the Postal Service. 3001.75 Section 3001.75 Postal Service POSTAL REGULATORY COMMISSION PERSONNEL RULES OF PRACTICE AND PROCEDURE Rules Applicable to Requests for Changes in the Nature of Postal Services § 3001.75 Service by the Postal Service...

  20. 39 CFR 3010.7 - Schedule of regular rate changes.

    Science.gov (United States)

    2010-07-01

    ... of mailers of each class of mail in developing the schedule. (e) Whenever the Postal Service deems it... 39 Postal Service 1 2010-07-01 2010-07-01 false Schedule of regular rate changes. 3010.7 Section... PRODUCTS General Provisions § 3010.7 Schedule of regular rate changes. (a) The Postal Service shall...

  1. 48 CFR 39.201 - Scope of subpart.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY Electronic and Information Technology 39.201 Scope of... the Architectural and Transportation Barriers Compliance Board Electronic and Information Technology... via the Internet at http://www.section508.gov. (c) When acquiring EIT, agencies must ensure that— (1...

  2. 36 CFR 1192.39 - Destination and route signs.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Destination and route signs... Buses, Vans and Systems § 1192.39 Destination and route signs. (a) Where destination or route information is displayed on the exterior of a vehicle, each vehicle shall have illuminated signs on the front...

  3. 39 CFR 952.7 - Notice of answer and hearing.

    Science.gov (United States)

    2010-07-01

    ... supporting information and determine whether a prima facie showing has been made that Respondent is engaged... civil penalties authorized by 39 U.S.C. 3012. Where he concludes that a prima facie showing has not been made he shall dismiss the complaint. Where he concludes that a prima facie showing has been made, he...

  4. 39 CFR 3002.14 - Office of the Consumer Advocate.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Office of the Consumer Advocate. 3002.14 Section... Consumer Advocate. (a) The Office of the Consumer Advocate provides representation for the interests of the... pendency of a proceeding, personnel serving in the Office of the Consumer Advocate are prohibited from...

  5. 39 CFR 761.2 - Authority of Reserve Banks.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Authority of Reserve Banks. 761.2 Section 761.2 Postal Service UNITED STATES POSTAL SERVICE POSTAL SERVICE DEBT OBLIGATIONS; DISBURSEMENT POSTAL MONEY ORDERS BOOK-ENTRY PROCEDURES § 761.2 Authority of Reserve Banks. Each Reserve Bank is hereby authorized...

  6. 41 CFR 101-39.301 - Utilization guidelines.

    Science.gov (United States)

    2010-07-01

    ...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.3-Use and Care of GSA Interagency Fleet Management System Vehicles.... The following guidelines may be employed by an agency requesting GSA Interagency Fleet Management... cooperate with GSA IFMS fleet management center personnel in studying the use of this equipment and take...

  7. 14 CFR 142.39 - Training program curriculum requirements.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Training program curriculum requirements... TRANSPORTATION (CONTINUED) SCHOOLS AND OTHER CERTIFICATED AGENCIES TRAINING CENTERS Aircrew Curriculum and Syllabus Requirements § 142.39 Training program curriculum requirements. Each training program curriculum...

  8. 39 CFR 961.10 - Waiver of employee rights.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Waiver of employee rights. 961.10 Section 961.10... EMPLOYEE HEARING PETITIONS UNDER SECTION 5 OF THE DEBT COLLECTION ACT § 961.10 Waiver of employee rights. The Hearing Official may determine the employee has waived his or her right to a hearing and the...

  9. 39 CFR 262.6 - Retention and disposal.

    Science.gov (United States)

    2010-07-01

    ... DEFINITIONS § 262.6 Retention and disposal. (a) Records control schedule. A directive describing records... officials to implement such instructions. (b) Disposal (records). The permanent removal of records or... 39 Postal Service 1 2010-07-01 2010-07-01 false Retention and disposal. 262.6 Section 262.6 Postal...

  10. 39 CFR 3001.7 - Ex parte communications.

    Science.gov (United States)

    2010-07-01

    ... communications relevant to the merits of the proceeding shall decline to listen to such communications and... 39 Postal Service 1 2010-07-01 2010-07-01 false Ex parte communications. 3001.7 Section 3001.7... Applicability § 3001.7 Ex parte communications. (a) Definitions—(1) Decision-making Commission personnel...

  11. 39 CFR 3001.31a - In camera orders.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false In camera orders. 3001.31a Section 3001.31a Postal... Applicability § 3001.31a In camera orders. (a) Definition. Except as hereinafter provided, documents and testimony made subject to in camera orders are not made a part of the public record, but are kept...

  12. 39 CFR 501.16 - PC postage payment methodology.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false PC postage payment methodology. 501.16 Section 501.16 Postal Service UNITED STATES POSTAL SERVICE POSTAGE PROGRAMS AUTHORIZATION TO MANUFACTURE AND DISTRIBUTE POSTAGE EVIDENCING SYSTEMS § 501.16 PC postage payment methodology. (a) The PC Postage customer is...

  13. 39 CFR 775.8 - Environmental evaluation guidelines.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Environmental evaluation guidelines. 775.8 Section... POLICY ACT PROCEDURES § 775.8 Environmental evaluation guidelines. (a) Approach. When dealing with proposals which may have an impact on the human environment, environmental coordinators, planners, decision...

  14. 39 CFR 775.9 - Environmental evaluation process.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Environmental evaluation process. 775.9 Section... POLICY ACT PROCEDURES § 775.9 Environmental evaluation process. (a) All actions—(1) Assessment of actions... environmental effect, or (iii) The action is a type that is not a major federal action with a significant impact...

  15. Nigerian Journal of Paediatrics - Vol 39, No 3 (2012)

    African Journals Online (AJOL)

    Case Report: Acute disseminated encephalomyelitis in two Nigerian children with typhoid fever · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. SA Adegoke, OO Ayoola, SBA Oseni, 140-143. http://dx.doi.org/10.4314/njp.v39i3.11 ...

  16. 39 CFR 959.3 - Office, business hours.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Office, business hours. 959.3 Section 959.3 Postal Service UNITED STATES POSTAL SERVICE PROCEDURES RULES OF PRACTICE IN PROCEEDINGS RELATIVE TO THE PRIVATE EXPRESS STATUTES § 959.3 Office, business hours. The offices of the officials mentioned in these rules are...

  17. 39 CFR 954.4 - Office business hours.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Office business hours. 954.4 Section 954.4 Postal Service UNITED STATES POSTAL SERVICE PROCEDURES RULES OF PRACTICE IN PROCEEDINGS RELATIVE TO THE DENIAL, SUSPENSION, OR REVOCATION OF PERIODICALS MAIL PRIVILEGES § 954.4 Office business hours. The offices of the...

  18. 39 CFR 952.4 - Office business hours.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Office business hours. 952.4 Section 952.4 Postal Service UNITED STATES POSTAL SERVICE PROCEDURES RULES OF PRACTICE IN PROCEEDINGS RELATIVE TO FALSE REPRESENTATION AND LOTTERY ORDERS § 952.4 Office business hours. The offices of the officials mentioned in these...

  19. English in Africa - Vol 39, No 2 (2012)

    African Journals Online (AJOL)

    Three Tales of Theal: Biography, History and Ethnography on the Eastern Frontier · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Naidu, 51–68. http://dx.doi.org/10.4314/eia.v39i2.3 ...

  20. 9 CFR 113.39 - Cat safety tests.

    Science.gov (United States)

    2010-01-01

    ....39 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... individual serum samples tested for antibody to the virus. (ii) The cats shall be considered susceptible if swabs are negative for virus isolation and the serums are free of virus antibody at the 1:2 final...

  1. 48 CFR 39.000 - Scope of part.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY 39.000 Scope of part. This part prescribes acquisition policies and procedures for use in acquiring— (a) Information technology, including financial management systems, consistent with other parts of this regulation, OMB Circular No. A-127, Financial Management...

  2. Phenotype abnormality: 39 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 39 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u545i abnormal for trait of behavior...al quality in organ named flower during process named organ development ... flower ... abnormal ... organ development ... behavioral quality

  3. 39 CFR 3050.40 - Additional financial reporting.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Additional financial reporting. 3050.40 Section... financial reporting. (a) In general. The Postal Service shall file with the Commission: (1) Within 40 days...), beginning with the annual report for fiscal year 2010. (c) Financial reporting. The reports required by...

  4. 41 CFR 101-39.4901 - Obtaining standard and optional forms.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.49-Forms § 101-39.4901 Obtaining standard and optional... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Obtaining standard and optional forms. 101-39.4901 Section 101-39.4901 Public Contracts and Property Management Federal Property...

  5. 41 CFR 101-39.104-1 - Consolidations into a fleet management system.

    Science.gov (United States)

    2010-07-01

    ... fleet management system. 101-39.104-1 Section 101-39.104-1 Public Contracts and Property Management..., TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.104-1 Consolidations into a fleet management...

  6. 41 CFR 101-39.105-1 - Transfers from discontinued or curtailed fleet management systems.

    Science.gov (United States)

    2010-07-01

    ... discontinued or curtailed fleet management systems. 101-39.105-1 Section 101-39.105-1 Public Contracts and... AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.105-1 Transfers from...

  7. 41 CFR 101-39.104 - Notice of establishment of a fleet management system.

    Science.gov (United States)

    2010-07-01

    ... of a fleet management system. 101-39.104 Section 101-39.104 Public Contracts and Property Management..., TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.104 Notice of establishment of a fleet management...

  8. Downregulation of histone methyltransferase genes SUV39H1 and SUV39H2 increases telomere length in embryonic stem-like cells and embryonic fibroblasts in pigs.

    Science.gov (United States)

    Dang-Nguyen, Thanh Quang; Haraguchi, Seiki; Furusawa, Tadashi; Somfai, Tamas; Kaneda, Masahiro; Watanabe, Shinya; Akagi, Satoshi; Kikuchi, Kazuhiro; Tajima, Atsushi; Nagai, Takashi

    2013-01-01

    Telomere is a nucleoprotein structure at the ends of chromosomes that helps to protect the ends of chromosomes from being fused with other chromosomes. Knockout of histone methyltransferases Suv39h1 and Suv39h2 increases the telomere length in murine cells, whereas downregulation of SUV39H1 and SUV39H2 genes decreases the telomere length in human cells, suggesting that telomere biology is different among mammalian species. However, epigenetic regulation of the telomere has not been studied in mammals other than the human and mouse. In the present study, the effect of knockdown of SUV39H1 and SUV39H2 genes on telomere length was examined in porcine embryonic stem-like cells (pESLCs) and porcine embryonic fibroblasts (PEFs). The telomeres in SUV39H1 and SUV39H2 knockdown (SUV39KD) pESLCs (37.1 ± 0.9 kb) were longer (Ptelomeres (22.1 ± 0.4 kb; Ptelomere elongation in SUV39KD pESLCs and SUV39KD PEFs. Relative levels of trimethylation of histone H3 lysine 9 and expressions of DNMT1, DNMT3A and DNMT3B were decreased in SUV39KD cells, suggesting that telomere lengthening in SUV39KD pESLCs and SUV39KD PEFs might be not only related to the loss of histone modification marks but also linked to the decrease in DNA methyltransferase in pigs.

  9. 39 GHz Interferometer System for Measuring Detonation Velocity

    Energy Technology Data Exchange (ETDEWEB)

    Ross, Patrick W. [National Security Technologies, LLC. (NSTec), Livermore, CA (United States); Tran, Vu [National Security Technologies, LLC. (NSTec), Livermore, CA (United States); Waltman, Thomas B. [National Security Technologies, LLC. (NSTec), Livermore, CA (United States); Tringe, Joe [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); May, Chadd [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Cradick, Jerry [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hodgin, Ralph [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kane, Ron [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-05-13

    A new 39 GHz RF interferometer system is presented for use in velocity measurements of high explosives (HE) detonations. The frequency was chosen to compliment the currently available suite, and provide more spatial information. An RF signal is generated and coupled to a waveguide adapter serving as an antenna. The HE is initially transparent to the RF. When the HE detonates, the detonation front becomes reflective to the RF. This reflection is picked up by the waveguide adapter and mixed with an unperturbed RF signal to give a low frequency signal which can be digitized with an oscilloscope. By comparing the signal with a reference signal, velocity information can be obtained using Fourier Transforms and wavelet models. Bench test results using a “slapper” are shown. The 39 GHz microwave interferometer is used in Deflagration to Detonation shots. The signal is reflected off a moving surface, and the Doppler shift of the reflected signal is used to calculate the velocity.

  10. LET spectrum measurements in Cr-39 PNTD with AFM

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Carl Edward [Los Alamos National Laboratory; De Witt, Joel M [OSU, PHYSICS; Benton, Eric R [OSU, PHYSICS; Yasuda, Nakahiro [NIRS, HIMAC; Benton, Eugene V [UNIV OF SAN FRANCISCO

    2010-01-01

    Energetic protons, neutrons, and heavy ions undergoing collisions with target nuclei of varying Z can produce residual heavy recoil fragments via intra-nuclear cascade/evaporation reactions. The particles produced in these non-elastic collisions generally have such extremely short range ({approx}< 10 {mu}m) that they cannot be directly observed by conventional detection methods including CR-39 plastic nuclear track detector (PNTD) that has been chemically etched for analysis by standard visible light microscopy. However, high-LET recoil fragments having range on the order of several cell diameters can be produced in tissue during radiotherapy using proton and carbon beams. We have developed a method to analyze short-range, high-LET tracks in CR-39 plastic nuclear track detector (PNTD) using short duration chemical etching ({approx}< 1 {mu}m) followed by automated atomic force microscope (AFM) scanning. The post-scan data processing used in this work was based on semi-automated matrix analysis opposed to traditional grey-scale image analysis. This method takes advantage of the 3-D data obtained via AFM to achieve robust discrimination of nuclear tracks from other features. Through automation of AFM scanning, sufficient AFM scan frames were obtained to attain an LET spectrum spanning the LET range from 200-1500 keV/{mu}m. In addition to our experiments, simulations were carried out with the Monte Carlo transport code, FLUKA. To demonstrate this method, CR-39 PNTD was exposed to the proton therapy beam at Loma Linda University Medical Center (LLUMC) at 60 and 230 MeV. Additionally, detectors were exposed to I GeV protons at the NASA Space Radiation Laboratory (NSRL) at Brookhaven National Laboratory (BNL). For these exposures CR-39 PNTD, Al and Cu target foils were used between detector layers.

  11. Response of electrochemically etched CR-39 detectors to protons

    CERN Document Server

    Dörschel, B; Kadner, K

    1999-01-01

    The neutron response of electrochemically etched (ECE) CR-39 detectors is determined by the energy and angular dependence of the response to neutron-induced charged particles. This response has been measured for the example of protons with various initial energies and angles of incidence. Besides, some studies were made for modeling the mechanism of ECE of the proton trajectories with the aim of deriving the critical angle of incidence.

  12. Accelerating CR-39 Track Detector Processing by Utilizing UV

    Science.gov (United States)

    Sparling, Jonathan; Padalino, Stephen; McLean, James; Sangster, Craig; Regan, Sean

    2017-10-01

    The use of CR-39 plastic as a Solid State Nuclear Track Detector is an effective technique for obtaining data in high energy particle experiments including inertial confinement fusion. To reveal particle tracks after irradiation, CR-39 is chemically etched in NaOH at 80°C, producing micron-scale signal pits at the nuclear track sites. It has been shown that illuminating CR-39 with UV light prior to etching increases bulk and track etch rates, especially when combined with elevated temperature. Spectroscopic analysis for amorphous solids has helped identify which UV wavelengths are most effective at enhancing etch rates. Absorption peaks found in the near infrared range provide for efficient sample heating, and may allow targeting cooperative IR-UV chemistry. Avoiding UV induced noise can be achieved through variations in absorption depths with wavelength. Vacuum drying and water absorption tests allow measurement of the resulting variation of bulk etch rate with depth. Funded in part by the NSF and an Department of Energy Grant through the Lab of Laser Energetics.

  13. Model-Based Discovery of Synthetic Agonists for the Zn2+-Sensing G-Protein-Coupled Receptor 39 (GPR39) Reveals Novel Biological Functions

    DEFF Research Database (Denmark)

    Frimurer, Thomas M.; Mende, Franziska; Graae, Anne-Sofie

    2017-01-01

    The G-protein coupled receptor 39 (GPR39) is a G protein-coupled receptor activated by Zn2. We used a homol. model-based approach to identify small-mol. pharmacol. tool compds. for the receptor. The method focused on a putative binding site in GPR39 for synthetic ligands and knowledge of ligand b...

  14. 41 CFR 101-39.307 - Grounds for withdrawal of vehicle.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.3-Use and Care of GSA Interagency Fleet Management... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Grounds for withdrawal of vehicle. 101-39.307 Section 101-39.307 Public Contracts and Property Management Federal Property...

  15. LC-39A RSS Rollback before launch of STS-113

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. - The Rotating Service Structure has been rolled back to reveal Space Shuttle Endeavour awaiting launch on Launch Pad 39A. The primary mission of STS-113 is to bring the Expedition 6 crew to the Station and return the Expedition 5 crew to Earth. Another major objective of the mission is delivery of the Port side of the S0 truss. Three spacewalks are planned to install and activate the truss and its associated equipment. Launch of Space Shuttle Endeavour on mission STS-113 is scheduled for Nov. 11 at 12:58:40 a.m. EST.

  16. Steatocystoma multiplex hos 39-årig kvinde

    DEFF Research Database (Denmark)

    Duffy, Jonas Raymond; Siersen, Hans Erik; Bonde, Christian T

    2011-01-01

    A clinical case of the rare disorder steatocystoma multiplex is described in a 39-year-old female. The patient was diagnosed with generalized intradermal lesions that started presenting in early adulthood. There was no family history of similar lesions.Skin examination showed multiple, skin......-coloured cystic lesions on the chest, abdomen, axillae and back. The patient's clinical presentations and history were compatible with steatocystoma multiplex. Various treatment options for steatocystoma multiplex and steatocystoma multiplex suppurativum have been published and include oral antibiotics...

  17. Proton beam micromachining on PMMA, Foturan and CR-39 materials

    CERN Document Server

    Rajta, I; Kiss, A Z; Gomez-Morilla, I; Abraham, M H

    2003-01-01

    Proton Beam Micromachining was demonstrated at the Institute of Nuclear Research of the Hungarian Academy of Sciences using three different types of resists: PMMA, Foturan and CR-39 type Solid State Nuclear Track Detector material. Irradiations have been performed on the nuclear microprobe facility at ATOMKI. The beam scanning was done using a National Instruments (NI) card (model 6711), and the new C++ version of the program IonScan, developed specifically for PBM applications called IonScan 2.0. (R.P.)

  18. Proceedings of the 39th Scandinavian Symposium on Physical Acoustics

    CERN Document Server

    Viggen, Erlend Magnus

    2016-01-01

    The 39th Scandinavian Symposium on Physical Acoustics was held at Geilo, Norway from January 31 to February 3, 2016. It was arranged by the Acoustics and Optics group of the Norwegian Physical Society, and was coordinated by Ulf Kristiansen and Erlend Magnus Viggen. This year, there were 48 participants, holding a total of 31 presentations on various topics in physical acoustics, such as ultrasonics, underwater sound propagation, waves in solids, flow acoustics, and sonar. After the conference, 9 of these presentations were submitted as papers to these proceedings.

  19. Preparation and characterization of a $^{39}Ar$ sample and study of the $^{39}Ar(n_{th},\\alpha)^{36}S$ reaction

    CERN Document Server

    Goeminne, G; Geltenbort, P; Johansson, L; Köster, U; Pommé, S; Wagemans, C; Wagemans, J

    2002-01-01

    The $^{39}$Ar(n$_{\\rm th}$,$\\alpha$)$^{36}$S reaction has been studied for the first time. A sample containing $2.85 \\times 10^{14}$ $^{39}$Ar atoms, was produced at the ISOLDE facility at CERN. The number of $^{39}$Ar atoms in the layer was determined by measuring the $^{39}$Ar $\\beta$-activity using a primary standardization method. Subsequently, the sample was irradiated with thermal neutrons at the High Flux Reactor of the ILL. An upper limit of 0.29~b was obtained for the $^{39}$Ar(n$_{\\rm th}$,$\\alpha$)$^{36}$S reaction cross-section.

  20. Preparation and characterization of a $^{39}Ar$ sample and study of the $^{39}Ar(n_{th},\\alpha)^{36}S$ reaction

    OpenAIRE

    Goeminne, G; Denecke, B; Geltenbort, P; Johansson, L; Köster, U; Pommé, S; Wagemans, C; Wagemans, J

    2002-01-01

    The $^{39}$Ar(n$_{\\rm th}$,$\\alpha$)$^{36}$S reaction has been studied for the first time. A sample containing $2.85 \\times 10^{14}$ $^{39}$Ar atoms, was produced at the ISOLDE facility at CERN. The number of $^{39}$Ar atoms in the layer was determined by measuring the $^{39}$Ar $\\beta$-activity using a primary standardization method. Subsequently, the sample was irradiated with thermal neutrons at the High Flux Reactor of the ILL. An upper limit of 0.29~b was obtained for the $^{39}$Ar(n$_{\\...

  1. Feldspar 40Ar/39Ar dating of ICDP PALEOVAN cores

    Science.gov (United States)

    Engelhardt, Jonathan Franz; Sudo, Masafumi; Stockhecke, Mona; Oberhänsli, Roland

    2017-11-01

    Volcaniclastic fall deposits in ICDP drilling cores from Lake Van, Turkey, contain sodium-rich sanidine and calcium-rich anorthoclase, which both comprise a variety of textural zoning and inclusions. An age model records the lake's history and is based on climate-stratigraphic correlations, tephrostratigraphy, paleomagnetics, and earlier 40Ar/39Ar analyses (Stockhecke et al., 2014b). Results from total fusion and stepwise heating 40Ar/39Ar analyses presented in this study allow for the comparison of radiometric constraints from texturally diversified feldspar and the multi-proxy lacustrine age model and vice versa. This study has investigated several grain-size fractions of feldspar from 13 volcaniclastic units. The feldspars show textural features that are visible in cathodoluminescence (CL) or back-scattered electron (BSE) images and can be subdivided into three dominant zoning-types: (1) compositional zoning, (2) round pseudo-oscillatory zoning and (3) resorbed and patchy zoning (Ginibre et al., 2004). Round pseudo-oscillatory zoning records a sensitive alternation of Fe and Ca that also reflects resorption processes. This is only visible in CL images. Compositional zoning reflects anticorrelated anorthite and orthoclase contents and is visible in BSE. Eleven inverse isochron ages from total fusion and three from stepwise heating analyses fit the age model. Four experiments resulted in older inverse isochron ages that do not concur with the model within 2σ uncertainties and that deviate from 1 ka to 17 ka minimum. C- and R-type zoning are interpreted as representing growth in magma chamber cupolas, as wall mushes, or in narrow conduits. Persistent compositions of PO-type crystals and abundant surfaces recording dissolution features correspond to formation within a magma chamber. C-type zoning and R-type zoning have revealed an irregular incorporation of melt and fluid inclusions. These two types of zoning in feldspar are interpreted as preferentially

  2. Japanese Adaptation of the Stroke and Aphasia Quality of Life Scale-39 (SAQOL-39): Comparative Study among Different Types of Aphasia.

    Science.gov (United States)

    Kamiya, Akane; Kamiya, Kentaro; Tatsumi, Hiroshi; Suzuki, Makihiko; Horiguchi, Satoshi

    2015-11-01

    We have developed a Japanese version of the Stroke and Aphasia Quality of Life Scale-39 (SAQOL-39), designated as SAQOL-39-J, and used psychometric methods to examine its acceptability and reliability. The acceptability and reliability of SAQOL-39-J, which was developed from the English version using a standard translation and back-translation method, were examined in 54 aphasia patients using standard psychometric methods. The acceptability and reliability of SAQOL-39-J were then compared among patients with different types of aphasia. SAQOL-39-J showed good acceptability, internal consistency (Cronbach's α score = .90), and test-retest reliability (intraclass correlation coefficient = .97). Broca's aphasia patients showed the lowest total scores and communication scores on SAQOL-39-J. The Japanese version of SAQOL-39, SAQOL-39-J, provides acceptable and reliable data in Japanese stroke patients with aphasia. Among different types of aphasia, Broca's aphasia patients had the lowest total and communication SAQOL-39-J scores. Further studies are needed to assess the effectiveness of health care interventions on health-related quality of life in this population. Copyright © 2015 National Stroke Association. Published by Elsevier Inc. All rights reserved.

  3. Study of a radiator degrader CR39 based neutron spectrometer

    Science.gov (United States)

    Caresana, M.; Ferrarini, M.; Pola, A.; Agosteo, S.; Campi, F.; Porta, A.

    2010-08-01

    The paper describes the experimental characterization of a neutron spectrometer based on a CR39 SSNTD coupled to a polyethylene radiator and an aluminium degrader. The response function of the spectrometer is calculated by using two analytical codes: the first one, written in Labview, permits to evaluate the critical angle of a particle (proton, alpha or recoil nucleus) impinging on the detector surface, as a function of the particle energy; the second code, written in Mathcad, calculates the recoil proton distribution generated by a monoenergetic neutron beam impinging on the polyethylene converter. The simulation software also accounts for the self radiator effect due to the recoil protons and to the oxygen and carbon recoil nuclei. The calculated response functions are compared with experimental data showing a fairly good agreement. Also the experimental reproducibility is satisfactory.

  4. STS-76 liftoff - right side view from Pad 39B

    Science.gov (United States)

    1996-01-01

    The chase to catch up with the Russian Space Station Mir gets under way with an on-time liftoff, as the Space Shuttle Atlantis hurtles skyward from Launch Pad 39B at 3:13:04 a.m. EST, March 22. On board for Mission STS-76 -- also the 76th Shuttle flight - - are a crew of six: Mission Commander Kevin P. Chilton; Pilot Richard A. Searfoss; Payload Commander Ronald M. Sega; and Mission Specialists Michael Richard 'Rich' Clifford, Linda M. Godwin, and Shannon W. Lucid. During the course of the planned nine-day flight, Atlantis will rendezvous and dock with Mir for athe third time. Lucid will transfer to the station for an approximately four-and-a-half month stay, becoming the first American woman to live on Mir. In addition, Godwin and Clifford will perform an extravehicular activity later in the mission, the first around the mated Atlantis-Mir assembly.

  5. Orthovoltage radiotherapy of acanthomatous epulides in 39 dogs.

    Science.gov (United States)

    Thrall, D E

    1984-04-01

    Acanthomatous epulides in 39 dogs were treated with orthovoltage x-rays. The acanthomatous epulis recurred in only 3 dogs, 2 of which were successfully retreated with x-rays. Malignant tumors other than acanthomatous epulis developed at the site of the irradiated acanthomatous epulis in 7 of the dogs. Five of the tumors were squamous cell carcinoma, one was a fibrosarcoma, and one was an osteosarcoma. The range of survival times (1 to 102 months), mean survival time (38 months), median survival time (37 months), 1-year survival rate (85%), and 2-year survival rate (67%) were encouraging and suggested that the described treatment was satisfactory for acanthomatous epulides. Cause of death in most dogs was not related to the acanthomatous epulis.

  6. [Retrospective analysis of 39 child cases of paragonimiasis].

    Science.gov (United States)

    Guo, Mei; Wang, Wei; Jiang, Jian-yu

    2011-08-01

    Clinical data of 39 children with paragonimiasis treated in Chongqing Three Gorges Central Hospital during 2008-2010 were retrospectively analyzed. The cases aged from 3 to 10 years old, with 25 cases of polyserositis (64.1%), 14 cases of cerebral paragonimiasis (35.9%). Among the cases of polyserositis, all showed dyspnea,tachypnea and diminished respiration (100%). Other symptoms or signs included purulent pleurisy, orthopnea, restricted activity, distant heart sounds, purulent pericarditis, abdominal distension, and hepatomegaly. In the 14 cases of cerebral paragonimiasis, 10 cases (71.4%) complained headache, 8 cases (57.1%) with vomiting, and other symptoms such as seizures, limb rigidity associated with conscious disturbance. Eight patients were treated with surgery and praziquantel, while others with praziquantel alone. After treatment 25 cases (64.1%) were cured, 13 cases (33.3%) improved, and 1 case (2.6%) showed no change.

  7. Downregulation of Histone Methyltransferase Genes SUV39H1 and SUV39H2 Increases Telomere Length in Embryonic Stem-like Cells and Embryonic Fibroblasts in Pigs

    OpenAIRE

    DANG-NGUYEN, Thanh Quang; Haraguchi, Seiki; FURUSAWA, Tadashi; SOMFAI, Tamas; Kaneda, Masahiro; Watanabe, Shinya; AKAGI, Satoshi; KIKUCHI, Kazuhiro; Tajima, Atsushi; Nagai, Takashi

    2012-01-01

    Abstract Telomere is a nucleoprotein structure at the ends of chromosomes that helps to protect the ends of chromosomes from being fused with other chromosomes. Knockout of histone methyltransferases Suv39h1 and Suv39h2 increases the telomere length in murine cells, whereas downregulation of SUV39H1 and SUV39H2 genes decreases the telomere length in human cells, suggesting that telomere biology is different among mammalian species. However, epigenetic regulation of the telomere has not been s...

  8. High Precision 40K/39K Ratio Determination

    Science.gov (United States)

    Naumenko, M. O.; Mezger, K.; Nagler, T. F.; Villa, I. M.

    2012-12-01

    Potassium is one of the eight most abundant chemical elements in the Earth's crust and a major element in many rock-forming minerals. The isotope 40K is radioactive and undergoes β- decay to 40Ca (ca. 89.3%) and electron capture to 40Ar (ca. 10.7%). Both decays can potentially be used as dating systems. The most commonly used branch is the decay of 40K to 40Ar because it can yield highly precise ages. Both decay schemes rely on the knowledge of the 40K branching ratio and the natural 40K abundance. A 40K abundance of 0.011672±41 % was measured on terrestrial material [1]. The relative uncertainty of 0.35 % has not been improved since. Recent improvements in the precision of mass spectrometric measurements have led to the situation that the uncertainties on the K decay constant and the abundance of 40K are a major source of uncertainty on the measured ages. A more precise definition of the 40K decay constant was attempted by different research groups within the last decade [2-9] but the goal of obtaining 0.1 % relative uncertainty on K-Ar ages for geological materials, as requested by the EARTHtime initiative, has not been achieved yet. In order to improve on this situation we studied the abundances of the K isotopes in terrestrial standards. A ThermoFischer Triton+ thermal ionisation mass spectrometer was used for K isotope ratio measurements of the NIST SRM 918b K standard loaded on Ta filaments with 0.1M phosphoric acid. Three techniques were applied: (A) dynamic measurement with in-run normalisation to the IUPAC value 41K/39K=0.072168; (B) a simple total evaporation procedure; (C) the "NBL-modified" total evaporation [10]. The 40K ion beam was measured in a Faraday cup with a 1E12 Ω resistor; 39K and 41K were collected in Faraday cups with 1E11 Ω resistors. Amplifier gains were intercalibrated by supplying fixed voltages off-line. Different measurement techniques were combined with different loading procedures. We also tested ionisation yields for the

  9. 41 CFR 101-39.203 - Obtaining motor vehicles for short-term use.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management... Fleet Management System (IFMS). Short-term use vehicles may be provided through Military Traffic... General Services Administration IFMS fleet management center. ...

  10. Data of evolutionary structure change: 1N39A-2NOZA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available EEAHKALCILPGVGTKVADCICLMALDKPQAVPVEVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQ ...EEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTT--AKGPCPQTNKELGNFFRSLWGPYAGWAFAVLFSADL-- ...> 2NOZA WHPTT--AKGPC -- ...> 1N39A WHPTTSQAKGPS

  11. Morphologic and molecular analysis of 39 spontaneous feline pulmonary carcinomas.

    Science.gov (United States)

    D'Costa, S; Yoon, B-I; Kim, D-Y; Motsinger-Reif, A A; Williams, M; Kim, Y

    2012-11-01

    The present study was performed to determine the morphologic change and selected molecular features of spontaneous lung tumors in cats examined at the North Carolina State University Veterinary Teaching Hospital. Thirty-nine primary lung carcinomas represented 0.69% of all feline cases admitted to the hospital. Most lung tumors were observed in aged cats (P adenocarcinoma (64.1%), bronchioloalveolar carcinoma (20.5%), and adenosquamous carcinoma (15.4%). Metastasis was observed in about 80% of 39 cases, with decreasing order of intrapulmonary metastasis, intrathoracic carcinomatosis, regional lymph nodes, and distant organs, including digits. The size of the largest tumor mass was significantly associated with metastatic potential (P feline lung tumors were positively labeled with either surfactant protein A or thyroid transcription factor 1. Epidermal growth factor receptor mutant and p53 proteins were detected in approximately 20% (5 of 24) and 25% (6 of 24) of the feline lung tumor cases, respectively. Limited sequencing analysis of K-ras and p53 genes in 3 selected normal and neoplastic lung tissues did not reveal any alteration. Results indicate that primary lung carcinomas are rare but aggressive tumors in cats, thereby warranting further studies on molecular carcinogenesis.

  12. Corrosion behavior of Ti-39Nb alloy for dentistry.

    Science.gov (United States)

    Fojt, Jaroslav; Joska, Ludek; Malek, Jaroslav; Sefl, Vaclav

    2015-11-01

    To increase an orthopedic implant's lifetime, researchers are now concerned on the development of new titanium alloys with suitable mechanical properties (low elastic modulus-high fatigue strength), corrosion resistance and good workability. Corrosion resistance of the newly developed titanium alloys should be comparable with that of pure titanium. The effect of medical preparations containing fluoride ions represents a specific problem related to the use of titanium based materials in dentistry. The aim of this study was to determine the corrosion behavior of β titanium alloy Ti-39Nb in physiological saline solution and in physiological solution containing fluoride ions. Corrosion behavior was studied using standard electrochemical techniques and X-ray photoelectron spectroscopy. It was found that corrosion properties of the studied alloy were comparable with the properties of titanium grade 2. The passive layer was based on the oxides of titanium and niobium in several oxidation states. Alloying with niobium, which was the important part of the alloy passive layer, resulted in no significant changes of corrosion behavior. In the presence of fluoride ions, the corrosion resistance was higher than the resistance of titanium. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. Invasive pulmonary aspergillosis: A study of 39 cases at autopsy

    Directory of Open Access Journals (Sweden)

    Vaideeswar P

    2004-01-01

    Full Text Available Background: Aspergillus is a common cause of invasive mycosis, especially in immunocompromised or immunosuppressed individuals. Aims: To study the incidence of invasive pulmonary aspergillosis and evaluate the predisposing factors and clinico-pathological manifestations. Settings and Design: Retrospective analysis of autopsy material from a tertiary care hospital. Material and Methods: All autopsies performed over a 12-year period were reviewed and cases with invasive aspergillosis were analysed with respect to their clinical presentation, predisposing factors, gross and histological features, complications and causes of death. Results: Among a total of 20475 autopsies performed in 12 years, 39 patients (0.19 % had invasive pulmonary aspergillosis. There were 28 males and 11 females. Their ages ranged from five months to 67 years. Dyspnoea, fever, cough with mucopurulent expectoration, chest pain and haemoptysis were commonly encountered symptoms. Forty-one per cent of the patients had no respiratory symptoms. Fungal aetiology was not entertained clinically in any of the patients. The major underlying conditions were prolonged antibiotic therapy, steroid therapy, and renal transplantation, often associated with underlying lung diseases. Pneumonia, abscesses, vascular thrombosis and infarction were common findings at autopsy. Antecedent tuberculosis, mucormycosis, Pneumocystis carinii pneumonia and Cytomegalovirus infection were also present. In most cases, death was related to extensive pulmonary involvement or fungal dissemination. Conclusion: A diagnosis of invasive pulmonary aspergillosis should always be borne in mind whenever one is dealing with recalcitrant lung infections even with subtle immunosuppression. Radiological investigations and serologic markers can be utilised for confirmation and prompt therapy.

  14. Subtask 3.9 - Direct Coal Liquefaction Process Development

    Energy Technology Data Exchange (ETDEWEB)

    Aulich, Ted; Sharma, Ramesh

    2012-07-01

    The Energy and Environmental Research Center (EERC), in partnership with the U.S. Department of Energy (DOE) and Accelergy Corporation, an advanced fuels developer with technologies exclusively licensed from ExxonMobil, undertook Subtask 3.9 to design, build, and preliminarily operate a bench-scale direct coal liquefaction (DCL) system capable of converting 45 pounds/hour of pulverized, dried coal to a liquid suitable for upgrading to fuels and/or chemicals. Fabrication and installation of the DCL system and an accompanying distillation system for off-line fractionation of raw coal liquids into 1) a naphtha middle distillate stream for upgrading and 2) a recycle stream was completed in May 2012. Shakedown of the system was initiated in July 2012. In addition to completing fabrication of the DCL system, the project also produced a 500-milliliter sample of jet fuel derived in part from direct liquefaction of Illinois No. 6 coal, and submitted the sample to the Air Force Research Laboratory (AFRL) at Wright Patterson Air Force Base, Dayton, Ohio, for evaluation. The sample was confirmed by AFRL to be in compliance with all U.S. Air Force-prescribed alternative aviation fuel initial screening criteria.

  15. A principal component analysis of 39 scientific impact measures.

    Directory of Open Access Journals (Sweden)

    Johan Bollen

    Full Text Available BACKGROUND: The impact of scientific publications has traditionally been expressed in terms of citation counts. However, scientific activity has moved online over the past decade. To better capture scientific impact in the digital era, a variety of new impact measures has been proposed on the basis of social network analysis and usage log data. Here we investigate how these new measures relate to each other, and how accurately and completely they express scientific impact. METHODOLOGY: We performed a principal component analysis of the rankings produced by 39 existing and proposed measures of scholarly impact that were calculated on the basis of both citation and usage log data. CONCLUSIONS: Our results indicate that the notion of scientific impact is a multi-dimensional construct that can not be adequately measured by any single indicator, although some measures are more suitable than others. The commonly used citation Impact Factor is not positioned at the core of this construct, but at its periphery, and should thus be used with caution.

  16. 25 CFR 39.603 - Is school board training required for all Bureau-funded schools?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Is school board training required for all Bureau-funded schools? 39.603 Section 39.603 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR EDUCATION THE INDIAN SCHOOL EQUALIZATION PROGRAM School Board Training Expenses § 39.603 Is school board training...

  17. 43 CFR 35.39 - Appeal to the Secretary of the Interior.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Appeal to the Secretary of the Interior. 35.39 Section 35.39 Public Lands: Interior Office of the Secretary of the Interior ADMINISTRATIVE REMEDIES FOR FRAUDULENT CLAIMS AND STATEMENTS § 35.39 Appeal to the Secretary of the Interior. (a) Any...

  18. 27 CFR 41.39 - Determination of sale price of large cigars.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Determination of sale price of large cigars. 41.39 Section 41.39 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO....39 Determination of sale price of large cigars. The tax imposed on large cigars is computed based on...

  19. 41 CFR 101-39.101 - Notice of intention to begin a study.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Notice of intention to begin a study. 101-39.101 Section 101-39.101 Public Contracts and Property Management Federal Property... Interagency Fleet Management Systems § 101-39.101 Notice of intention to begin a study. The Administrator, GSA...

  20. 41 CFR 109-39.101 - Notice of intention to begin a study.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Notice of intention to begin a study. 109-39.101 Section 109-39.101 Public Contracts and Property Management Federal Property... Discontinuance of Interagency Fleet Management Systems § 109-39.101 Notice of intention to begin a study. ...

  1. 41 CFR 101-39.404 - Claims in favor of the Government.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.4-Accidents and Claims § 101-39.404 Claims in favor of... Interagency Fleet Management System (IFMS) vehicle is at fault and that party can be reasonably identified... pertaining to the accident and its investigation to the servicing GSA IFMS fleet management center. The GSA...

  2. 41 CFR 101-39.105-2 - Agency requests to withdraw participation.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.105-2 Agency requests to withdraw participation. (a) Executive agencies receiving motor vehicle services from fleet management systems may request...

  3. 41 CFR 109-39.105-2 - Agency requests to withdraw participation.

    Science.gov (United States)

    2010-07-01

    ... AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.105-2 Agency requests to... of participation by a DOE organization of a given interagency fleet management system, the...

  4. 41 CFR 109-39.105 - Discontinuance or curtailment of service.

    Science.gov (United States)

    2010-07-01

    ... AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.105 Discontinuance or... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Discontinuance or...

  5. 41 CFR 101-39.304 - Modification or installation of accessory equipment.

    Science.gov (United States)

    2010-07-01

    ..., TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.3-Use and Care of GSA Interagency Fleet Management System Vehicles § 101-39.304 Modification or installation of accessory equipment. The modification of a GSA Interagency Fleet Management System (IFMS) vehicle or the permanent installation of...

  6. 41 CFR 101-39.102-1 - Records, facilities, personnel, and appropriations.

    Science.gov (United States)

    2010-07-01

    ..., TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.102-1 Records, facilities, personnel, and appropriations. (a) If GSA decides to establish a fleet management system, GSA, with the assistance of the...

  7. 41 CFR 101-39.105 - Discontinuance or curtailment of service.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.105 Discontinuance or curtailment of service. (a... efficiencies are realized from the operation of any fleet management system, the Administrator, GSA, will...

  8. 41 CFR 101-39.102-2 - Effective date of determination.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.102-2 Effective date of determination. Unless a longer time is... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Effective date of...

  9. 25 CFR 39.705 - Are schools eligible for transportation funds to transport special education students?

    Science.gov (United States)

    2010-04-01

    ... transport special education students? 39.705 Section 39.705 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF... Funds § 39.705 Are schools eligible for transportation funds to transport special education students? Yes. A school that transports a special education student from home to a treatment center and back to...

  10. 41 CFR 102-39.75 - What are the sales methods?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the sales methods? 102-39.75 Section 102-39.75 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 39-REPLACEMENT OF PERSONAL...

  11. 41 CFR 102-39.70 - What are the exchange methods?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the exchange methods? 102-39.70 Section 102-39.70 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 39-REPLACEMENT OF PERSONAL...

  12. 25 CFR 39.144 - What is the small high school adjustment?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What is the small high school adjustment? 39.144 Section 39.144 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR EDUCATION THE INDIAN SCHOOL EQUALIZATION PROGRAM Indian School Equalization Formula Small School Adjustment § 39.144 What is the small high school adjustment? (a) The small high...

  13. Oral diseases affect some 3.9 billion people.

    Science.gov (United States)

    Richards, Derek

    2013-01-01

    Medline, Embase, Lilacs. Published and unpublished observational population-based studies presenting information on the prevalence, incidence, case fatality and cause-specific mortality related to untreated caries, severe periodontitis and severe tooth loss between January 1980 and December 2010. There were no language restrictions. Study quality was assessed using the STROBE checklist (http://www.strobe-statement.org/). Prevalence estimates were calculated on the database for all age-gender-country-year groups using a specifically developed Bayesian meta-regression tool. Disability-adjusted life-years (DALYs) and years lived with disability (YLDs) metrics were used to quantify the disease burden. Disability weights were calculated based on population-based surveys in five countries (USA, Peru, Tanzania, Bangladesh and Indonesia) and an open Internet survey. Uncertainties in estimates were examined using Monte Carlo simulation techniques with uncertainty levels presented as the 2.5th and 97.5th centiles, which can be interpreted as a 95% UI. Oral diseases remain highly prevalent in 2010 affecting 3.9 billion people. Untreated caries in permanent teeth was the most prevalent condition evaluated for the entire GBD (Global Burden of Disease) 2010 Study with a global prevalence of 35% for all ages combined. Severe periodontitis and untreated caries in deciduous teeth were the 6th and 10th most prevalent conditions, affecting, respectively, 11% and 9% of the global population. Oral conditions combined accounted for 15 million DALYs globally (1.9% of all YLDs and 0.6% of all DALYs), implying an average health loss of 224 years per 100,000 people. DALYs due to oral conditions increased 20.8% between 1990 and 2010, mainly due to population growth and aging. While DALYs due to severe periodontitis and untreated caries increased, those due to severe tooth loss decreased. The findings highlight the challenge in responding to the diversity of urgent oral health needs world

  14. Accidental chlorine gas intoxication: evaluation of 39 patients.

    Science.gov (United States)

    Sever, Mustafa; Mordeniz, Cengiz; Sever, Fidan; Dokur, Mehmet

    2009-12-01

    Chlorine is a known pulmonary irritant gas that may cause acute damage in the respiratory system. In this paper, the socio-demographic and clinical characteristics of 39 accidentally exposed patients to chlorine gas are reported and different emergency treatment modalities are also discussed. Two emergency departments applications were retrospectively analyzed for evaluation of accidental chlorine gas exposure for year 2007. Patients were classified into 3 groups according to severity of clinical and laboratory findings based on the literature and duration of land of stay in the emergency department. The first group was slightly exposed (discharged within 6 hours), second group moderately exposed (treated and observed for 24 hours), and third group was severely exposed (hospitalized). Most of the patients were initially treated with a combination of humidified oxygen, corticosteroids, and bronchodilators. The average age was 17.03 ± 16.01 years (95% CI). Seven (17.9%) of them were female and 29 (74.4%) were children. Twenty-four patients (61.5%) were included in the first, nine (23.1%) were in second and six (15.4%) were in the third group. The presenting symptoms were cough, nausea, and vomiting and conjunctiva hyperemia for the first group, first groups symptoms plus dyspnea for the second group. Second groups symptoms plus palpitation, weakness and chest tightness were for the third group. Cough and dyspnea were seen in 64.1% and 30.8% of the patients respectively. No patients died. The authors recommend that non symptomatic or slightly exposed patients do not need any specific treatment or symptomatic treatment is sufficient. Accidental; Chlorine exposure; Chlorine gas; Chlorine intoxication; Emergency department.

  15. Portal biliopathy: a study of 39 surgically treated patients.

    Science.gov (United States)

    Agarwal, Anil Kumar; Sharma, Dharamanjai; Singh, Shivendra; Agarwal, Shaleen; Girish, S P

    2011-01-01

    Portal biliopathy (PBP) denotes intra- and extrahepatic biliary duct abnormalities that occur as a result of portal hypertension and is commonly seen in extrahepatic portal vein obstruction (EHPVO). The management of symptomatic PBP is still controversial. Prospectively collected data for surgically managed PBP patients from 1996 to 2007 were retrospectively analysed for presentation, clinical features, imaging and the results of surgery. All patients were assessed with a view to performing decompressive shunt surgery as a first-stage procedure and biliary drainage as a second stage-procedure if required, based on evaluation at 6 weeks after shunt surgery. A total of 39 patients (27 males, mean age 29.56 years) with symptomatic PBP were managed surgically. Jaundice was the most common symptom. Two patients in whom shunt surgery was unsuitable underwent a biliary drainage procedure. A total of 37 patients required a proximal splenorenal shunt as first-stage surgery. Of these, only 13 patients required second-stage surgery. Biliary drainage procedures (hepaticojejunostomy [n= 11], choledochoduodenostomy [n= 1]) were performed in 12 patients with dominant strictures and choledocholithiasis. One patient had successful endoscopic clearance of common bile duct (CBD) stones after first-stage surgery and required only cholecystectomy as a second-stage procedure. The average perioperative blood product transfusion requirement in second-stage surgery was 0.9 units and postoperative complications were minimal with no mortality. Over a mean follow-up of 32.2 months, all patients were asymptomatic. Decompressive shunt surgery alone relieved biliary obstruction in 24 of 37 patients (64.9%) and facilitated a safe second-stage biliary decompressive procedure in the remaining 13 patients (35.1%). Decompressive shunt surgery alone relieves biliary obstruction in the majority of patients with symptomatic PBP and facilitates endoscopic or surgical management in patients who require

  16. Track sensitivity and the surface roughness measurements of CR-39 with atomic force microscope

    CERN Document Server

    Yasuda, N; Amemiya, K; Takahashi, H; Kyan, A; Ogura, K

    1999-01-01

    Atomic Force Microscope (AFM) has been applied to evaluate the surface roughness and the track sensitivity of CR-39 track detector. We experimentally confirmed the inverse correlation between the track sensitivity and the roughness of the detector surface after etching. The surface of CR-39 (CR-39 doped with antioxidant (HARZLAS (TD-1)) and copolymer of CR-39/NIPAAm (TNF-1)) with high sensitivity becomes rough by the etching, while the pure CR-39 (BARYOTRAK) with low sensitivity keeps its original surface clarity even for the long etching.

  17. G protein-coupled receptor 39 deficiency is associated with pancreatic islet dysfunction

    DEFF Research Database (Denmark)

    Holst, Birgitte; Egerod, Kristoffer L; Jin, Chunyu

    2009-01-01

    tolerance both during oral and iv glucose tolerance tests, and Gpr39(-/-) mice had decreased plasma insulin response to oral glucose. Islet architecture was normal in the Gpr39 null mice, but expression of Pdx-1 and Hnf-1alpha was reduced. Isolated, perifused islets from Gpr39 null mice secreted less......alpha, and in the present study, we addressed the importance of GPR39 for glucose homeostasis and pancreatic islets function. The expression and localization of GPR39 were characterized in the endocrine pancreas and pancreatic cell lines. Gpr39(-/-) mice were studied in vivo, especially in respect...... of glucose tolerance and insulin sensitivity, and in vitro in respect of islet architecture, gene expression, and insulin secretion. Gpr39 was down-regulated on differentiation of the pluripotent pancreatic cell line AR42J cells toward the exocrine phenotype but was along with Pdx-1 strongly up...

  18. Differential expression and function of breast regression protein 39 (BRP-39 in murine models of subacute cigarette smoke exposure and allergic airway inflammation

    Directory of Open Access Journals (Sweden)

    Coyle Anthony J

    2011-04-01

    Full Text Available Abstract Background While the presence of the chitinase-like molecule YKL40 has been reported in COPD and asthma, its relevance to inflammatory processes elicited by cigarette smoke and common environmental allergens, such as house dust mite (HDM, is not well understood. The objective of the current study was to assess expression and function of BRP-39, the murine equivalent of YKL40 in a murine model of cigarette smoke-induced inflammation and contrast expression and function to a model of HDM-induced allergic airway inflammation. Methods CD1, C57BL/6, and BALB/c mice were room air- or cigarette smoke-exposed for 4 days in a whole-body exposure system. In separate experiments, BALB/c mice were challenged with HDM extract once a day for 10 days. BRP-39 was assessed by ELISA and immunohistochemistry. IL-13, IL-1R1, IL-18, and BRP-39 knock out (KO mice were utilized to assess the mechanism and relevance of BRP-39 in cigarette smoke- and HDM-induced airway inflammation. Results Cigarette smoke exposure elicited a robust induction of BRP-39 but not the catalytically active chitinase, AMCase, in lung epithelial cells and alveolar macrophages of all mouse strains tested. Both BRP-39 and AMCase were increased in lung tissue after HDM exposure. Examining smoke-exposed IL-1R1, IL-18, and IL-13 deficient mice, BRP-39 induction was found to be IL-1 and not IL-18 or IL-13 dependent, while induction of BRP-39 by HDM was independent of IL-1 and IL-13. Despite the importance of BRP-39 in cellular inflammation in HDM-induced airway inflammation, BRP-39 was found to be redundant for cigarette smoke-induced airway inflammation and the adjuvant properties of cigarette smoke. Conclusions These data highlight the contrast between the importance of BRP-39 in HDM- and cigarette smoke-induced inflammation. While functionally important in HDM-induced inflammation, BRP-39 is a biomarker of cigarette smoke induced inflammation which is the byproduct of an IL-1

  19. The role of the obestatin/GPR39 system in human gastric adenocarcinomas.

    Science.gov (United States)

    Alén, Begoña O; Leal-López, Saúl; Alén, María Otero; Viaño, Patricia; García-Castro, Victoria; Mosteiro, Carlos S; Beiras, Andrés; Casanueva, Felipe F; Gallego, Rosalía; García-Caballero, Tomás; Camiña, Jesús P; Pazos, Yolanda

    2016-02-02

    Obestatin, a 23-amino acid peptide encoded by the ghrelin gene, and the GPR39 receptor were reported to be involved in the control of mitogenesis of gastric cancer cell lines; however, the relationship between the obestatin/GPR39 system and gastric cancer progression remains unknown. In the present study, we determined the expression levels of the obestatin/GPR39 system in human gastric adenocarcinomas and explored their potential functional roles. Twenty-eight patients with gastric adenocarcinomas were retrospectively studied, and clinical data were obtained. The role of obestatin/GPR39 in gastric cancer progression was studied in vitro using the human gastric adenocarcinoma AGS cell line. Obestatin exogenous administration in these GPR39-bearing cells deregulated the expression of several hallmarks of the epithelial-mesenchymal transition (EMT) and angiogenesis. Moreover, obestatin signaling promoted phenotypic changes via GPR39, increasingly impacting on the cell morphology, proliferation, migration and invasion of these cells. In healthy human stomachs, obestatin expression was observed in the neuroendocrine cells and GPR39 expression was localized mainly in the chief cells of the oxyntic glands. In human gastric adenocarcinomas, no obestatin expression was found; however, an aberrant pattern of GPR39 expression was discovered, correlating to the dedifferentiation of the tumor. Altogether, our data strongly suggest the involvement of the obestatin/GPR39 system in the pathogenesis and/or clinical outcome of human gastric adenocarcinomas and highlight the potential usefulness of GPR39 as a prognostic marker in gastric cancer.

  20. Functional interaction between nonreceptor tyrosine kinase c-Abl and SR-Rich protein RBM39

    Energy Technology Data Exchange (ETDEWEB)

    Mai, Sanyue [Beijing Institute of Biotechnology, 27 Taiping Rd, Haidian District, Beijing 100850 (China); Qu, Xiuhua [General Navy Hospital of PLA, 6 Fucheng Rd, Haidian District, Beijing 100037 (China); Li, Ping; Ma, Qingjun [Beijing Institute of Biotechnology, 27 Taiping Rd, Haidian District, Beijing 100850 (China); Liu, Xuan, E-mail: liux931932@163.com [Beijing Institute of Biotechnology, 27 Taiping Rd, Haidian District, Beijing 100850 (China); Cao, Cheng, E-mail: cao_c@sohu.com [Beijing Institute of Biotechnology, 27 Taiping Rd, Haidian District, Beijing 100850 (China)

    2016-04-22

    RBM39, also known as splicing factor HCC1.4, acts as a transcriptional coactivator for the steroid nuclear receptors JUN/AP-1, ESR1/ER-α and ESR2/ER-β. RBM39 is involved in the regulation of the transcriptional responses of these steroid nuclear receptors and promotes transcriptional initiation. In this paper, we report that RBM39 interacts with the nonreceptor tyrosine kinase c-Abl. Both the Src homology (SH) 2 and SH3 domains of c-Abl interact with RBM39. The major tyrosine phosphorylation sites on RBM39 that are phosphorylated by c-Abl are Y95 and Y99, as demonstrated by liquid chromatography coupled with tandem mass spectrometry (LC/MS/MS) and mutational analysis. c-Abl was shown boost the transcriptional coactivation activity of RBM39 for ERα and PRβ in a tyrosine kinase-dependent manner. The results suggest that mammalian c-Abl plays an important role in steroid hormone receptor-mediated transcription by regulating RBM39. - Highlights: • c-Abl interacts with RBM39. • RBM39 is phosphorylated by c-Abl. • c-Abl regulates transcriptional coactivation activity of RBM39 on the ERα and PRβ.

  1. Cross-cultural adaptation and validation of the instrument Diabetes - 39 (D-39): brazilian version for type 2 diabetes mellitus patients - stage 1

    OpenAIRE

    Flávia Alline de Queiroz; Ana Emilia Pace; Claudia Benedita dos Santos

    2009-01-01

    The study aimed to accomplish a cross-cultural adaptation of the "Diabetes - 39 - D-39" instrument for Brazil, to test the validity of the adapted version in a sample of type 2 diabetes mellitus patients and to describe the participants of the study, according to the scores obtained on the Likert-type scale. The instrument adaptation process followed several steps: instrument translation; achievement of the consensus in Portuguese; evaluation by an expert committee; back-translation; achievem...

  2. Book review: Advances in 40Ar/39Ar dating: From archaeology to planetary sciences

    Science.gov (United States)

    Cosca, Michael A.

    2015-01-01

    The recently published book Advances in 40Ar/39Ar Dating: From Archaeology to Planetary Sciences is a collection of 24 chapters authored by international scientists on topics ranging from decay constants to 40Ar/39Ar dating of extraterrestrial objects. As stated by the editors in their introduction, these chapters were assembled with the goal of providing technique-specific examples highlighting recent advances in the field of 40Ar/39Ar dating. As this is the first book truly dedicated to 40Ar/39Ar dating since the second edition printing of the argon geochronologist’s handbook Geochronology and Thermochronology by the 40Ar/39Ar Method (McDougall and Harrison 1999), a new collection of chapters highlighting recent advances in 40Ar/39Ar geochronology offers much to the interested reader.

  3. The role of the obestatin/GPR39 system in human gastric adenocarcinomas

    OpenAIRE

    Al?n, Bego?a O.; Leal-L?pez, Sa?l; Al?n, Mar?a Otero; Via?o, Patricia; Garc?a-Castro, Victoria; Mosteiro, Carlos S.; Beiras, Andr?s; Casanueva, Felipe F.; Gallego, Rosal?a; Garc?a-Caballero, Tom?s; Cami?a, Jes?s P.; Pazos, Yolanda

    2015-01-01

    Obestatin, a 23-amino acid peptide encoded by the ghrelin gene, and the GPR39 receptor were reported to be involved in the control of mitogenesis of gastric cancer cell lines; however, the relationship between the obestatin/GPR39 system and gastric cancer progression remains unknown. In the present study, we determined the expression levels of the obestatin/GPR39 system in human gastric adenocarcinomas and explored their potential functional roles. Twenty-eight patients with gastric adenocarc...

  4. A fast method for the determination of the efficiency coefficient of bare CR-39 detector

    Energy Technology Data Exchange (ETDEWEB)

    Dwaikat, Nidal, E-mail: nidaldwaiakt@yahoo.co [Department of Electronics, Information Systems and Energy Engineering, Graduate School of Engineering, Osaka University, 2-1 Yamadaoka, Suita, Osaka (Japan); Department of Physics, An-Najah National University, Nablus, Palestine (Country Unknown); El-hasan, Mousa [Department of Physics, An-Najah National University, Nablus, Palestine (Country Unknown); Sueyasu, Masto; Kada, Wataru; Sato, Fuminobu; Kato, Yushi [Department of Electronics, Information Systems and Energy Engineering, Graduate School of Engineering, Osaka University, 2-1 Yamadaoka, Suita, Osaka (Japan); Saffarini, G. [Department of Physics, An-Najah National University, Nablus, Palestine (Country Unknown); Iida, Toshiyuki [Department of Electronics, Information Systems and Energy Engineering, Graduate School of Engineering, Osaka University, 2-1 Yamadaoka, Suita, Osaka (Japan)

    2010-10-15

    A fast and simple method for the determination of the efficiency coefficient ({eta}) of bare CR-39 detector is presented and discussed. The efficiency coefficient of bare CR-39 detector is then calculated by different ways and the obtained values are found to be comparable to each other. The average value of {eta} of bare CR-39 is found to be 0.20 {+-} 0.01 tracks cm{sup -2} day{sup -1} per Bq m{sup -3}.

  5. 25 CFR 39.143 - What is a small high school?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What is a small high school? 39.143 Section 39.143 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR EDUCATION THE INDIAN SCHOOL EQUALIZATION PROGRAM Indian School Equalization Formula Small School Adjustment § 39.143 What is a small high school? For purposes of this part, a small high school: ...

  6. Bibliography on Cold Regions Science and Technology. Volume 39, Part 2, 1985,

    Science.gov (United States)

    1985-12-01

    crystal halo phenomena: sky archaeology areas of the Ukrainian SSR 1 1984, p.88-95, rus~t 3991 Geographic analysisnf mosses growintgin dak-coafer mon...t1984, Complex ice-crystal halo phetnormena sky archaeology Mareheako, I.I. 224M. rti 39-2367 t 1980. pr34h-353. eng 39-3882 Parameters and schemes...1 984 , 184p., CM 3g3] 6129. eng3 39-2.%-7 and geological) procesues 1 1984. p. 15-17. rusl 39.354 Problem of the Arctic and the Antarctic

  7. Acceptability, reliability, and validity of the Stroke and Aphasia Quality of Life Scale-39 (SAQOL-39) across languages: a systematic review.

    Science.gov (United States)

    Ahmadi, Akram; Tohidast, Seyed Abolfazl; Mansuri, Banafshe; Kamali, Mohammad; Krishnan, Gopee

    2017-09-01

    This systematic review aimed to explore the acceptability, reliability, and validity of the Stroke and Aphasia Quality of Life-39 (SAQOL-39) scale across languages. We employed a systematic search of the online databases including MEDLINE (Pubmed), Science direct, Web of science, Psychinfo, Scopus, ProQuest, Google Scholar, and Cochrane library published between 2003 and 2016. We used PRISMA guidelines for conducting and reporting this review. Subsequently, screening of the titles and abstracts, extraction of data as well as the appraisal of the quality of relevant studies were carried out. The initial search returned 8185 studies. Subsequent screening and study selection processes narrowed them to 20, needing detailed review. Forward-backward translation scheme was the preferred method for translation of the SAQOL-39 from English to other languages. Mainly, the socio-cultural and linguistic adaptations were performed in the translated versions. Most versions of the SAQOL-39 showed high test-retest reliability and internal consistency. However, several psychometric properties including the validity and responsiveness were seldom reported in these versions. The SAQOL-39 scale showed high acceptability, and reliability across the languages reviewed in this study. Future translations may additionally focus on reporting the validity and responsiveness of the instrument.

  8. 41 CFR 102-39.20 - What definitions apply to this part?

    Science.gov (United States)

    2010-07-01

    ... identical; or (2) Fall within a single Federal Supply Classification (FSC) Group of property (includes any... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What definitions apply to this part? 102-39.20 Section 102-39.20 Public Contracts and Property Management Federal Property...

  9. 27 CFR 478.39a - Reporting theft or loss of firearms.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Reporting theft or loss of firearms. 478.39a Section 478.39a Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION COMMERCE IN FIREARMS AND AMMUNITION...

  10. 49 CFR 178.65 - Specification 39 non-reusable (non-refillable) cylinders.

    Science.gov (United States)

    2010-10-01

    ... cylinder must be completed prior to all pressure tests. (4) Welding procedures and operators must be... 49 Transportation 2 2010-10-01 2010-10-01 false Specification 39 non-reusable (non-refillable... SPECIFICATIONS FOR PACKAGINGS Specifications for Cylinders § 178.65 Specification 39 non-reusable (non-refillable...

  11. 21 CFR 170.39 - Threshold of regulation for substances used in food-contact articles.

    Science.gov (United States)

    2010-04-01

    ... is at or below 1 percent of the acceptable dietary intake (ADI); (4) Data that will enable the Food... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Threshold of regulation for substances used in food-contact articles. 170.39 Section 170.39 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH...

  12. 7 CFR 1230.39 - Powers and duties of the Delegate Body.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Powers and duties of the Delegate Body. 1230.39... Order National Pork Producers Delegate Body § 1230.39 Powers and duties of the Delegate Body. The Delegate Body shall have the following powers and duties: (a) To meet annually; (b) To recommend the rate...

  13. 34 CFR 200.39 - Responsibilities resulting from identification for school improvement.

    Science.gov (United States)

    2010-07-01

    ... school improvement plan in accordance with § 200.41. (b) If a school fails to make AYP by the end of the... school improvement. 200.39 Section 200.39 Education Regulations of the Offices of the Department of... ACADEMIC ACHIEVEMENT OF THE DISADVANTAGED Improving Basic Programs Operated by Local Educational Agencies...

  14. 46 CFR 39.10-5 - Incorporation by reference-TB/ALL.

    Science.gov (United States)

    2010-10-01

    ... Association (NFPA), 1 Batterymarch Park, Quincy, MA 02269 NFPA 70—National Electrical Code, 1987 39.20-9 Oil..., 1981 39.20-9 National Electrical Manufacturers Association (NEMA), 2101 L St. NW., Washington, DC 20036... 2nd St. SW., Stop 7126, Washington, DC 20593-7126, or at the National Archives and Records...

  15. 25 CFR 39.221 - What is a full school month?

    Science.gov (United States)

    2010-04-01

    ... a full school month? A full school month is each 30-day period following the first day that... 25 Indians 1 2010-04-01 2010-04-01 false What is a full school month? 39.221 Section 39.221 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR EDUCATION THE INDIAN SCHOOL EQUALIZATION...

  16. 21 CFR 102.39 - Onion rings made from diced onion.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Onion rings made from diced onion. 102.39 Section... Nonstandardized Foods § 102.39 Onion rings made from diced onion. (a) The common or usual name of the food product that resembles and is of the same composition as onion rings, except that it is composed of comminuted...

  17. 15 CFR 30.39 - Special exemptions for shipments to the U.S. Armed Services.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Special exemptions for shipments to the U.S. Armed Services. 30.39 Section 30.39 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade BUREAU OF THE CENSUS, DEPARTMENT OF COMMERCE FOREIGN TRADE REGULATIONS...

  18. 25 CFR 39.111 - What does the term gifted and talented mean?

    Science.gov (United States)

    2010-04-01

    ... term gifted and talented mean? The term gifted and talented means students, children, or youth who: (a... 25 Indians 1 2010-04-01 2010-04-01 false What does the term gifted and talented mean? 39.111 Section 39.111 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR EDUCATION THE INDIAN SCHOOL...

  19. 27 CFR 479.39 - Engaging in more than one business at the same location.

    Science.gov (United States)

    2010-04-01

    ... business at the same location. 479.39 Section 479.39 Alcohol, Tobacco Products, and Firearms BUREAU OF... one business at the same location. If more than one business taxable under 26 U.S.C. 5801, is carried on at the same location during a taxable year, the special (occupational) tax imposed on each such...

  20. 36 CFR 1193.39 - Prohibited reduction of accessibility, usability, and compatibility.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Prohibited reduction of accessibility, usability, and compatibility. 1193.39 Section 1193.39 Parks, Forests, and Public Property ARCHITECTURAL AND TRANSPORTATION BARRIERS COMPLIANCE BOARD TELECOMMUNICATIONS ACT ACCESSIBILITY GUIDELINES...

  1. 46 CFR 385.39 - Socio-economic and environmental policies.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Socio-economic and environmental policies. 385.39... DEVELOPMENT GRANT AND COOPERATIVE AGREEMENTS REGULATIONS General Policies § 385.39 Socio-economic and environmental policies. A number of socio-economic and environmental policies of the Federal Government are...

  2. 41 CFR 101-39.204 - Obtaining motor vehicles for indefinite assignment.

    Science.gov (United States)

    2010-07-01

    ..., TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management... related services of the GSA Interagency Fleet Management System (IFMS) are provided to requesting agencies... have been consolidated into the supporting GSA IFMS fleet management center, and no agency-owned...

  3. 41 CFR 101-39.203-1 - Obtaining motor vehicles while on temporary duty (TDY) travel.

    Science.gov (United States)

    2010-07-01

    ... Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Obtaining motor vehicles...

  4. 41 CFR 101-39.208 - Vehicles removed from defined areas.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services... operated outside the geographical area served by the issuing GSA IFMS fleet management center. However... shall notify the issuing GSA IFMS fleet management center of the following: (1) The location at which...

  5. Increased plasma levels of microparticles expressing CD39 and CD133 in acute liver injury

    DEFF Research Database (Denmark)

    Schmelzle, Moritz; Splith, Katrin; Wiuff Andersen, Lars

    2013-01-01

    BACKGROUND: We have previously demonstrated that CD133 and CD39 are expressed by hematopoietic stem cells (HSC), which are mobilized after liver injury and target sites of injury, limit vascular inflammation, and boost hepatic regeneration. Plasma microparticles (MP) expressing CD39 can block...

  6. 25 CFR 39.136 - What is the WSU for Language Development programs?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What is the WSU for Language Development programs? 39.136... EQUALIZATION PROGRAM Indian School Equalization Formula Language Development Programs § 39.136 What is the WSU for Language Development programs? Language Development programs are funded at 0.13 WSUs per student. ...

  7. 25 CFR 39.105 - Are additional funds available for special education?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Are additional funds available for special education? 39... additional funds available for special education? (a) Schools may supplement the 15 percent base academic funding reserved under § 39.104 for special education with funds available under part B of the Individuals...

  8. 25 CFR 39.106 - Who is eligible for special education funding?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Who is eligible for special education funding? 39.106 Section 39.106 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR EDUCATION THE INDIAN SCHOOL... for special education funding? To receive ISEP special education funding, a student must be under 22...

  9. 41 CFR 102-39.35 - When should I consider using the exchange/sale authority?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false When should I consider using the exchange/sale authority? 102-39.35 Section 102-39.35 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY...

  10. 41 CFR 102-39.40 - Why should I consider using the exchange/sale authority?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Why should I consider using the exchange/sale authority? 102-39.40 Section 102-39.40 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY...

  11. 41 CFR 102-39.45 - When should I not use the exchange/sale authority?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false When should I not use the exchange/sale authority? 102-39.45 Section 102-39.45 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY...

  12. 25 CFR 39.409 - How does the OIEP Director ensure accountability?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How does the OIEP Director ensure accountability? 39.409... EQUALIZATION PROGRAM Accountability § 39.409 How does the OIEP Director ensure accountability? (a) The Director of OIEP must ensure accountability in student counts and student transportation by doing all of the...

  13. rK39 enzyme-linked immunosorbent assay for diagnosis of Leishmania donovani infection

    NARCIS (Netherlands)

    Zijlstra, E. E.; Daifalla, N. S.; Kager, P. A.; Khalil, E. A.; El-Hassan, A. M.; Reed, S. G.; Ghalib, H. W.

    1998-01-01

    The rK39 enzyme-linked immunosorbent assay (ELISA) was compared with the direct agglutination test (DAT) for Leishmania donovani infection in the Sudan. rK39 ELISA proved more sensitive than DAT in diagnosis of kala-azar (93 and 80%, respectively); both tests may remain positive up to 24 months

  14. 14 CFR 39.13 - Are airworthiness directives part of the Code of Federal Regulations?

    Science.gov (United States)

    2010-01-01

    ... references and citations to FAA airworthiness directives. ... in the Federal Register as amendments to § 39.13. Editorial Note: For a complete list of citations to... GPO Access. For citations to prior amendments, see the entries for 14 CFR 39.13 in the separate...

  15. 40Ar-39Ar age of a lava flow from the Bhimashankar Formation ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    the St. Mary's Islands volcanics, southern India: record of India-Madagascar breakup on the Indian subcontinent;. Earth Planet. Sci. Lett. 139 39–46. Pande K, Venkatesan T R, Gopalan K, Krishnamurthy P and Macdougall J D 1988. 40. Ar-. 39. Ar ages of alkali basalts from Kutch, Deccan volcanic province, India; Geol. Soc.

  16. 19 CFR 145.39 - Articles for diplomatic officers, representatives of international organizations, and foreign...

    Science.gov (United States)

    2010-04-01

    ... of international organizations, and foreign military personnel. 145.39 Section 145.39 Customs Duties..., representatives of international organizations, and foreign military personnel. Free entry of articles in mail articles addressed to diplomatic officers, representatives of certain international organizations, and...

  17. 75 FR 48336 - Notice of Issuance of Statement of Federal Financial Accounting Standard 39, Subsequent Events...

    Science.gov (United States)

    2010-08-10

    ... ADVISORY BOARD Notice of Issuance of Statement of Federal Financial Accounting Standard 39, Subsequent Events: Codification of Accounting and Financial Reporting Standards Contained in the AICPA Statement on... Statement of Federal Financial Accounting Standard 39, Subsequent Events: Codification of Accounting and...

  18. Deficiency of the GPR39 receptor is associated with obesity and altered adipocyte metabolism

    DEFF Research Database (Denmark)

    Petersen, Pia Steen; Jin, Chunyu; Madsen, Andreas Nygaard

    2011-01-01

    GPR39, a constitutively active 7TM receptor important for glucose-induced insulin secretion and maturation of pancreatic ß-cell function, is up-regulated in adipose tissue on abstinence from food and chemically induced diabetes. In the present study, we investigated the effect of GPR39 deficiency...... on body weight and adipocyte metabolism. GPR39-deficient mice were subjected to a high-fat diet and body composition, glucose tolerance, insulin secretion, food intake, and energy expenditure were evaluated. The cell biology of adipocyte metabolism was studied on both mRNA and protein levels....... A significant increase in body weight corresponding to a 2-fold selective increase in fat mass was observed in GPR39-deficient mice fed a high-fat diet as compared with wild-type littermate controls fed the same diet. The GPR39-deficient animals had similar food intake but displayed almost eliminated diet...

  19. GPR39 signaling is stimulated by zinc ions but not by obestatin

    DEFF Research Database (Denmark)

    Holst, Birgitte; Egerod, Kristoffer L; Schild, Enrico

    2006-01-01

    GPR39 is an orphan member of the ghrelin receptor family that recently was suggested to be the receptor for obestatin, a peptide derived from the ghrelin precursor. Here, we compare the effect of obestatin to the effect of Zn(2+) on signal transduction and study the effect of obestatin on food...... intake. Although Zn(2+) stimulated inositol phosphate turnover, cAMP production, arrestin mobilization, as well as cAMP response element-dependent and serum response element-dependent transcriptional activity in GPR39-expressing cells as opposed to mock-transfected cells, no reproducible effect...... was obtained with obestatin in the GPR39-expressing cells. Moreover, no specific binding of obestatin could be detected in two different types of GPR39-expressing cells using three different radioiodinated forms of obestatin. By quantitative PCR analysis, GPR39 expression was readily detected in peripheral...

  20. Suv39h1 Protects from Myocardial Ischemia-Reperfusion Injury in Diabetic Rats

    Directory of Open Access Journals (Sweden)

    Bo Yang

    2014-04-01

    Full Text Available Background: Patients with diabetes are at increased risk of ischemic events. Suv39h1 is a histone methyltransferase that catalyzes the methylation of histone 3 lysine 9, which is associated with the suppression of inflammatory genes in diabetes. However, the role of Suv39h1 in myocardial ischemia/reperfusion (I/R injury under diabetic condition has not been evaluated. Methods: To generate diabetic model, male SD rats were fed with 60% fat diet followed by intraperitoneal injection with 40mg/kg streptozotocin. Adenovirus encoding Suv39h1 gene was used for Suv39h1 overexpression. Each rat received injections of adenovirus at five myocardial sites. Three days after gene transfection, each rat was subjected to left main coronary artery occlusion and reperfusion. After 30 min ischemia and reperfusion for 4 h, the rats were euthanized for real-time PCR, Western blot, immunohistochemical staining, and morphometric analysis. Results: Delivery of Ad-Suv39h1 into the hearts of diabetic rats could markedly increase Suv39h1 expression. Up-regulation of Suv39h1 significantly reduced infarct size and tissue damage after I/R injury, which was associated with protection from apoptosis of cardiac myocytes and reduction of inflammatory response. In addition, compared with injury group, Ad-Suv39h1 led to a decreased activity of mitogen-activated protein kinase family and its down-steam transcriptional factor NF-κB. Conclusion: Overexpression of Suv39h1 results in the de-activation of proinflammatory pathways and reduced apoptosis and myocardial injury. Therefore, Suv39h1 might represent a novel therapeutic strategy to reduce I/R injury under diabetic condition.

  1. Arabidopsis aspartic proteases A36 and A39 play roles in plant reproduction.

    Science.gov (United States)

    Gao, Hui; Li, Rui; Guo, Yi

    2017-04-03

    Aspartic proteases (Aps, EC3.4.23) are one of the 4 major mechanistic classes of proteolytic enzymes with the conserved motifs Asp-Thr/Ser-Gly (DT/SG) at the active site and are activated at acidic pH. In Arabidopsis, 69 genes were identified as coding putative aspartic proteinases. However, little is known about most of these enzymes. Recently, we characterized 2 novel Arabidopsis Aps genes, A36 and A39, which encode 2 putative GPI-anchored pollen-high-expressed Aps. a36 a39 mutants display significant abortion. The pollen grains underwent apoptosis-like programmed cell death and the degeneration of female gametes was also appeared in the a36 a39 mutant. Besides, the pollen tube of a36 a39 has compromised micropylar guidance. A36 and A39 were membrane-anchored protein and co-localized with a reported GPI-anchored protein COBRA-LIKE 10 (COBL10). In apical region of a36 a39 pollen tubes cell wall, the abundance of highly methlyestered homogalacturonans and xyloglucans were significantly increased. These results indicated that A36 and A39 are vital factors involved in gametogenesis and pollen guidance in Arabidopsis.

  2. Streptomyces sp. strain PGPA39 alleviates salt stress and promotes growth of 'Micro Tom' tomato plants.

    Science.gov (United States)

    Palaniyandi, S A; Damodharan, K; Yang, S H; Suh, J W

    2014-09-01

    To identify an actinobacterial strain that can promote growth and alleviate salinity stress in tomato plants. Actinobacteria were isolated from agricultural soil and screened for ACC deaminase activity, production of indole acetic acid (IAA), solubilization of tricalcium phosphate and sodium chloride (NaCl) salinity tolerance. Among the several strains tested, one strain designated PGPA39 exhibited higher IAA production, and phosphate solubilization in addition to ACC deaminase activity, and tolerance to 1 mol l(-1) NaCl. Strain PGPA39 was identified as a Streptomyces strain based on 16S rDNA sequence and designated Streptomyces sp. strain PGPA39. It promoted the growth of Arabidopsis seedlings in vitro as evidenced by a significant increase in plant biomass and number of lateral roots. Salinity stress-alleviating activity of PGPA39 was evaluated using 'Micro Tom' tomato plants with 180 mmol l(-1) NaCl stress under gnotobiotic condition. A significant increase in plant biomass and chlorophyll content and a reduction in leaf proline content were observed in PGPA39-inoculated tomato plants under salt stress compared with control and salt-stressed noninoculated plants. Streptomyces sp. strain PGPA39 alleviated salt stress and promoted the growth of tomato plants. This study shows the potential of Streptomyces sp. strain PGPA39 in alleviating salinity stress in tomato plants and could be utilized for stress alleviation in crop plants under field conditions. © 2014 The Society for Applied Microbiology.

  3. Increased CD39 nucleotidase activity on microparticles from patients with idiopathic pulmonary arterial hypertension.

    Directory of Open Access Journals (Sweden)

    Scott H Visovatti

    Full Text Available Idiopathic pulmonary arterial hypertension (IPAH is a devastating disease characterized by increased pulmonary vascular resistance, smooth muscle and endothelial cell proliferation, perivascular inflammatory infiltrates, and in situ thrombosis. Circulating intravascular ATP, ADP, AMP and adenosine activate purinergic cell signaling pathways and appear to induce many of the same pathologic processes that underlie IPAH. Extracellular dephosphorylation of ATP to ADP and AMP occurs primarily via CD39 (ENTPD1, an ectonucleotidase found on the surface of leukocytes, platelets, and endothelial cells. Microparticles are micron-sized phospholipid vesicles formed from the membranes of platelets and endothelial cells.Studies here examine whether CD39 is an important microparticle surface nucleotidase, and whether patients with IPAH have altered microparticle-bound CD39 activity that may contribute to the pathophysiology of the disease.Kinetic parameters, inhibitor blocking experiments, and immunogold labeling with electron microscopy support the role of CD39 as a major nucleotidase on the surface of microparticles. Comparison of microparticle surface CD39 expression and nucleotidase activity in 10 patients with advanced IPAH and 10 healthy controls using flow cytometry and thin layer chromatograph demonstrate the following: 1 circulating platelet (CD39(+CD31(+CD42b(+ and endothelial (CD39(+CD31(+CD42b(- microparticle subpopulations in patients with IPAH show increased CD39 expression; 2 microparticle ATPase and ADPase activity in patients with IPAH is increased.We demonstrate for the first time increased CD39 expression and function on circulating microparticles in patients with IPAH. Further research is needed to elucidate whether these findings identify an important trigger for the development of the disease, or reflect a physiologic response to IPAH.

  4. AN/TTC-39 Program: A Case Study of Manpower, Personnel and Training Requirements Determination

    Science.gov (United States)

    1984-01-01

    concepts. The Central Processor Group ( CPG ), used in the AN/TTC-39 and AN/TYC-39, is basically the same as that used in the TACFIRE and AN/TSO-73...Insertion Demonstration A Fault Insertion Demonstration ( FID ) was performed on two AN/TYC-39 Message Switches at FT Huachuca, AZ from 4 May to 21 July...criterion. However, the overall median repair time was 35 minutes which approaches the user established requirement. An assessment of training during the FID

  5. Synopsis of the results of ISP-39 on FARO test L-14

    Energy Technology Data Exchange (ETDEWEB)

    Addabbo, C.; Annunziato, A.; Magallon, D. [Commission of the European Communities, Ispra (Italy). Joint Research Center

    1998-01-01

    This paper provides a synopsis of the salient results from the ISP(International Standard Problem)-39 exercise promoted by OECD-CSNI in the frame of the NEA activities aimed at fostering international cooperation in reactor safety research and development. ISP-39 has been conceived to benchmark the predictive capabilities of computer codes used in the evaluation of FCI and quenching phenomenologies of relevance in water cooled reactors severe accidents safety analysis. The ISP-39 reference case is FARO test L-14, a non-energetic FCI test performed in the FARO experimental installation under realistic melt composition and prototypical test conditions. (author)

  6. Results of Hg speciation testing on tank 39 and 1Q16 tank 50 samples

    Energy Technology Data Exchange (ETDEWEB)

    Bannochie, C. J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-03-07

    The Savannah River National Laboratory (SRNL) was tasked with preparing and shipping samples for Hg speciation by Eurofins Frontier Global Sciences, Inc. in Seattle, WA on behalf of the Savannah River Remediation (SRR) Mercury Task Team.i,ii The seventeenth shipment of samples was designated to include two Tank 39 samples and the 1Q16 Tank 50 Quarterly WAC sample. The surface Tank 39 sample was pulled at 262.1” from the tank bottom, and the depth Tank 39 sample was pulled at 95” from the tank bottom. The 1Q16 Tank 50 WAC sample was drawn from the 1-L variable depth sample received by SRNL.

  7. Molecular mechanism of Zn2+ agonism in the extracellular domain of GPR39

    DEFF Research Database (Denmark)

    Storjohann, Laura; Holst, Birgitte; Schwartz, Thue W

    2008-01-01

    Ala substitution of potential metal-ion binding residues in the main ligand-binding pocket of the Zn2+-activated G protein-coupled receptor 39 (GPR39) receptor did not decrease Zn2+ potency. In contrast, Zn2+ stimulation was eliminated by combined substitution of His17 and His19, located in the N......-terminal segment. Surprisingly, substitution of Asp313 located in extracellular loop 3 greatly increased ligand-independent signaling and apparently eliminated Zn2+-induced activation. It is proposed that Zn2+ acts as an agonist for GPR39, not in the classical manner by directly stabilizing an active conformation...

  8. 40Ar-39Ar age of a lava flow from the Bhimashankar Formation ...

    Indian Academy of Sciences (India)

    39Ar age of a lava flow from the Bhimashankar Formation, Giravali Ghat, Deccan Traps. Kanchan Pande S K Pattanayak K V Subbarao P Navaneethakrishnan T R Venkatesan. Volume 113 Issue 4 December 2004 pp 755-758 ...

  9. Immune malfunction in the GPR39 zinc receptor of knockout mice

    DEFF Research Database (Denmark)

    Młyniec, Katarzyna; Trojan, Ewa; Ślusarczyk, Joanna

    2016-01-01

    as an anti-inflammatory agent, and its link with depression has been proved, zinc deficiency causing depression- and anxiety-like behavior with immune malfunction. It has been discovered that trace-element zinc acts as a neurotransmitter in the central nervous system via zinc receptor GPR39. In this study we...... investigated whether GPR39 knockout would cause depressive-like behavior as measured by the forced swim test, and whether these changes would coexist with immune malfunction. In GPR39 knockout mice versus a wild-type control we found: i) depressive-like behavior; ii) significantly reduced thymus weight; (iii......) reduced cell viability of splenocytes; iv) reduced proliferative response of splenocytes; and v) increased IL-6 production of splenocytes after ConA stimulation and decreased IL-1b and IL-6 release after LPS stimulation. The results indicate depressive-like behavior in GPR39 KO animals with an immune...

  10. Subsistence in Alaska and the Effect of H.R. 39

    Science.gov (United States)

    Camerino, Vicki

    1977-01-01

    H.R. 39, the Alaska National Interest Conservation Act, acknowledges that the continuation of subsistence land use is essential to Alaska Native welfare and that there are no practical alternative means available to replace subsistence resources. (JC)

  11. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian

    2011-01-01

    Intercalibration between the astronomical and radio-isotopic dating methods provides a means to improving accuracy and reducing uncertainty of an integrated, multi-chronometer geologic timescale. Here we report a high-precision 40Ar/39Ar age for the Fish Canyon sanidine (FCs) neutron fluence...... monitor, by multi-collector noble gas mass spectrometry, through cross-calibration with A1 tephra sanidines (A1Ts) of the direct astronomically tuned Faneromeni section (Crete). The astronomically intercalibrated 40Ar/39Ar age of FCs of 28.172±0.028 Ma (2σ, external errors) is within the uncertainty of......, but more precise (±0.10%) than, the previous 40Ar/39Ar age determined by intercalibration with astronomically tuned tephras from the Melilla Basin (Morocco). Using this proposed age for FCs, combined with measurements using the A1Ts as the neutron fluence monitor, a weighted mean Bishop Tuff 40Ar/39Ar...

  12. 23 CFR 661.39 - How are project cost overruns funded?

    Science.gov (United States)

    2010-04-01

    ... OPERATIONS INDIAN RESERVATION ROAD BRIDGE PROGRAM § 661.39 How are project cost overruns funded? (a) A request for additional IRRBP funds for cost overruns on a specific bridge project must be submitted to...

  13. TIP39 modulates effects of novelty‐induced arousal on memory

    National Research Council Canada - National Science Library

    Coutellier, L; Logemann, A; Kuo, J; Rusnak, M; Usdin, T. B

    2011-01-01

    ...‐induced arousal modulates memory functions via noradrenergic activation, we hypothesized that exposure to a novel environment differently affects memory performance of mice with or without TIP39...

  14. 39. Cupressaceae

    DEFF Research Database (Denmark)

    Friis, Ib

    2009-01-01

    A taxonomic and floristic account of all the species of the gymnosperm family Cupressaceae recorded from Ethiopia and Eritrea......A taxonomic and floristic account of all the species of the gymnosperm family Cupressaceae recorded from Ethiopia and Eritrea...

  15. Slide 39

    Indian Academy of Sciences (India)

    Flora is a fundamental requirement which forms the base of the pyramid of biomass. A successive reduction in consumer level at each stage forms the “tires” of the pyramid. Predators are located on the top, denoting their supremacy over the food chain in terms of an ideal ecosystem. Scavengers fill up the remaining aspect ...

  16. Slide 39

    Indian Academy of Sciences (India)

    Given transgene may lead to stress tolerance but may bring in certain traits that are not acceptable like altered plant phenotype or penalty on biomass or yield. Transgenic plant produced must be assessed for growth and yield by plant physiologists, biochemists and geneticists.

  17. Fundamental structural and biochemical features for the obestatin/GPR39 system mitogenic action

    OpenAIRE

    Otero Alén, Begoña

    2016-01-01

    In 2005, a new peptide derived from the ghrelin peptide precursor, named obestatin, was discovered. One of the most important functions of obestatin is its mitogenic activity. Obestatin and the GPR39 receptor were reported to be involved in the control of mitogenesis of gastric cancer cell lines; this fact prompted us to investigate obestatin/GPR39 signalling and the relationship between the system and gastric cancer progression, and explored their potential functional roles. The main obje...

  18. The adenosine generating enzymes CD39/CD73 control microglial processes ramification in the mouse brain

    Science.gov (United States)

    Matyash, Marina; Zabiegalov, Oleksandr; Wendt, Stefan; Matyash, Vitali

    2017-01-01

    Microglial cells invade the brain as amoeboid precursors and acquire a highly ramified morphology in the postnatal brain. Microglia express all essential purinergic elements such as receptors, nucleoside transporters and ecto-enzymes, including CD39 (NTPDase1) and CD73 (5'-nucleotidase), which sequentially degrade extracellular ATP to adenosine. Here, we show that constitutive deletion of CD39 and CD73 or both caused an inhibition of the microglia ramified phenotype in the brain with a reduction in the length of processes, branching frequency and number of intersections with Sholl spheres. In vitro, unlike wild-type microglia, cd39-/- and cd73-/- microglial cells were less complex and did not respond to ATP with the transformation into a more ramified phenotype. In acute brain slices, wild-type microglia retracted approximately 50% of their processes within 15 min after slicing of the brain, and this phenomenon was augmented in cd39-/- mice; moreover, the elongation of microglial processes towards the source of ATP or towards a laser lesion was observed only in wild-type but not in cd39-/- microglia. An elevation of extracellular adenosine 1) by the inhibition of adenosine transport with dipyridamole, 2) by application of exogenous adenosine or 3) by degradation of endogenous ATP/ADP with apyrase enhanced spontaneous and ATP-induced ramification of cd39-/- microglia in acute brain slices and facilitated the transformation of cd39-/- and cd73-/- microglia into a ramified process-bearing phenotype in vitro. These data indicate that under normal physiological conditions, CD39 and CD73 nucleotidases together with equilibrative nucleoside transporter 1 (ENT1) control the fate of extracellular adenosine and thereby the ramification of microglial processes. PMID:28376099

  19. The adenosine generating enzymes CD39/CD73 control microglial processes ramification in the mouse brain.

    Directory of Open Access Journals (Sweden)

    Marina Matyash

    Full Text Available Microglial cells invade the brain as amoeboid precursors and acquire a highly ramified morphology in the postnatal brain. Microglia express all essential purinergic elements such as receptors, nucleoside transporters and ecto-enzymes, including CD39 (NTPDase1 and CD73 (5'-nucleotidase, which sequentially degrade extracellular ATP to adenosine. Here, we show that constitutive deletion of CD39 and CD73 or both caused an inhibition of the microglia ramified phenotype in the brain with a reduction in the length of processes, branching frequency and number of intersections with Sholl spheres. In vitro, unlike wild-type microglia, cd39-/- and cd73-/- microglial cells were less complex and did not respond to ATP with the transformation into a more ramified phenotype. In acute brain slices, wild-type microglia retracted approximately 50% of their processes within 15 min after slicing of the brain, and this phenomenon was augmented in cd39-/- mice; moreover, the elongation of microglial processes towards the source of ATP or towards a laser lesion was observed only in wild-type but not in cd39-/- microglia. An elevation of extracellular adenosine 1 by the inhibition of adenosine transport with dipyridamole, 2 by application of exogenous adenosine or 3 by degradation of endogenous ATP/ADP with apyrase enhanced spontaneous and ATP-induced ramification of cd39-/- microglia in acute brain slices and facilitated the transformation of cd39-/- and cd73-/- microglia into a ramified process-bearing phenotype in vitro. These data indicate that under normal physiological conditions, CD39 and CD73 nucleotidases together with equilibrative nucleoside transporter 1 (ENT1 control the fate of extracellular adenosine and thereby the ramification of microglial processes.

  20. Loss of vascular expression of nucleoside triphosphate diphosphohydrolase-1/CD39 in hypertension.

    Science.gov (United States)

    Roy, Charlotte; Tabiasco, Julie; Caillon, Antoine; Delneste, Yves; Merot, Jean; Favre, Julie; Guihot, Anne Laure; Martin, Ludovic; Nascimento, Daniele C; Ryffel, Bernhard; Robson, Simon C; Sévigny, Jean; Henrion, Daniel; Kauffenstein, Gilles

    2017-12-13

    Ectonucleoside triphosphate diphosphohydrolase-1, the major vascular/immune ectonucleotidase, exerts anti-thrombotic and immunomodulatory actions by hydrolyzing extracellular nucleotides (danger signals). Hypertension is characterized by vascular wall remodeling, endothelial dysfunction, and immune infiltration. Here our aim was to investigate the impact of arterial hypertension on CD39 expression and activity in mice. Arterial expression of CD39 was determined by reverse transcription quantitative real-time PCR in experimental models of hypertension, including angiotensin II (AngII)-treated mice (1 mg/kg/day, 21 days), deoxycorticosterone acetate-salt mice (1% salt and uninephrectomy, 21 days), and spontaneously hypertensive rats. A decrease in CD39 expression occurred in the resistance and conductance arteries of hypertensive animals with no effect on lymphoid organs. In AngII-treated mice, a decrease in CD39 protein levels (Western blot) was corroborated by reduced arterial nucleotidase activity, as evaluated by fluorescent (etheno)-ADP hydrolysis. Moreover, serum-soluble ADPase activity, supported by CD39, was significantly decreased in AngII-treated mice. Experiments were conducted in vitro on vascular cells to determine the elements underlying this downregulation. We found that CD39 transcription was reduced by proinflammatory cytokines interleukin (IL)-1β and tumor necrosis factor alpha on vascular smooth muscle cells and by IL-6 and anti-inflammatory and profibrotic cytokine transforming growth factor beta 1 on endothelial cells. In addition, CD39 expression was downregulated by mechanical stretch on vascular cells. Arterial expression and activity of CD39 were decreased in hypertension as a result of both a proinflammatory environment and mechanical strain exerted on vascular cells. Reduced ectonucleotidase activity may alter the vascular condition, thus enhancing arterial damage, remodeling, or thrombotic events.

  1. Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide-binding properties

    OpenAIRE

    Schimpl, Marianne; Rush, Christina L.; Betou, Marie; Eggleston, Ian M.; Recklies, Anneliese D.; van Aalten, Daan M. F.

    2012-01-01

    The chitinase-like proteins YKL-39 (chitinase 3-like-2) and YKL-40 (chitinase 3-like-1) are highly expressed in a number of human cells independent of their origin (mesenchymal, epithelial or haemapoietic). Elevated serum levels of YKL-40 have been associated with a negative outcome in a number of diseases ranging from cancer to inflammation and asthma. YKL-39 expression has been associated with osteoarthritis. However, despite the reported association with disease, the physiological or patho...

  2. Enhancement of Particle Track Etch Rate in CR-39 by UV Exposure

    Science.gov (United States)

    Wiesner, Micah; Ume, Rubab; McLean, James; Sangster, Craig; Regan, Sean

    2015-11-01

    The use of CR-39 plastic as a Solid State Nuclear Track Detector is effective for obtaining data in high-energy particle experiments including inertial confinement fusion. To reveal particle tracks after irradiation, CR-39 is chemically etched at elevated temperatures with NaOH, producing signal pits at the nuclear track sites that are measurable by an optical microscope. CR-39 pieces sometimes also exhibit etch-induced noise, either surface features not caused by nuclear particles. When CR-39 is exposed to high intensity UV light after nuclear irradiation with 5.4 MeV alpha particles and before etching, an increase in etch rates and pit diameters is observed, though UV exposure can also increase noise. We have determined that light from a low pressure mercury vapor lamp (predominantly wavelength 253.7 nm) increases etch rates and pit diameters while causing minimal background noise. Heating CR-39 to elevated temperatures (~80 °C) during UV exposure also improves the signal-to-noise ratio for this process. Surprisingly, initial data from CR-39 irradiated with 3.4 MeV protons and exposed to UV show reduced pit diameters. This material is based in part upon work supported by the Department of Energy National Nuclear Security Administration under Award Number DE-NA0001944.

  3. Scandium doped Strontium Titanate Ceramics: Structure, Microstructure, and Dielectric Properties

    Directory of Open Access Journals (Sweden)

    Tkach, Alexander

    2008-08-01

    Full Text Available Sc-doped strontium titanate (ST ceramics were synthesised by solid state reaction, according to the composition Sr1-1.5xScxTiO3 with x = 0-0.01. Structural properties and microstructure development was examined by XRD and SEM. The dielectric properties were evaluated as a function of the temperature and frequency in the radio frequency range. Lattice parameter, density and grain size, were found to decrease slightly with increasing Sc content. The dielectric permittivity and losses decrease also. Sc-doping has only a weak effect on the quantum paraelectric behaviour of ST and no dielectric anomaly was observed, what is probably related to the limited solubility of Sc on the Sr site of the perovskite lattice of ST.

    Se sintetizaron materiales cerámicos de titanato de estroncio dopado con escandio mediante reacción en estado sólido De acuerdo a la composición Sr1-1.5xScxTiO3 con x= 0-0.1. Las propiedades estructurales y el desarrollo microestructural se estudiaron mediante XRD y SEM. La propiedades dieléctricas se estudiaron como función de la temperatura y de la frecuencia en el rango de la frecuencias de radio. Se observó que los parámetros de red, la densidad y el tamaño del grano disminuyen ligeramente con el contenido en Sc. La permitividad dieléctrica y las perdidas también disminuyen. El dopado con Sc tiene un efecto muy ligero sobre el comportamiento paraeléctrico cuántico del titanato de estroncio y no se observó anomalías dioeléctricas , lo que está probablemente relacionado con la baja solubilidad del Sc en posiciones del Sr en la estructura tipo perovskita del titanato de estroncio.

  4. Phenoxyl radical complexes of gallium, scandium, iron and manganese.

    Science.gov (United States)

    Adam, B; Bill, E; Bothe, E; Goerdt, B; Haselhorst, G; Hildenbrand, K; Sokolowski, A; Steenken, S; Weyhermüller, T; Wieghardt, K

    1997-02-01

    The hexadentate macrocyclic ligands 1,4,7-tris(3,5-dimethyl-2-hydroxybenzyl)-1,4,7-triazacyclononane (L CH 3H3 ), 1,4,7-tris(3,5-di-tert-butyl-2-hydroxybenzyl)-1,4,7-triazacyclononane (L(Bu) H3 ) and 1,4,7-tris(3-tert-butyl-5-methoxy-2-hydroxybenzyl)-1,4,7-triazacyclononane (L OCH 3-H3 ) form very stable octahedral neutral complexes LM(III) with trivalent (or tetravalent) metal ions (Ga(III) , Sc(III) , Fe(III) , Mn(III) , Mn(IV) ). The following complexes have been synthesized: [L(Bu) M], where M = Ga (1), Sc (2), Fe (3); [L(Bu) Mn(IV) ]PF6 (4'); [L OCH 3M], where M = Ga (1 a), Sc (2 a), Fe (3 a); [L OCH 3Mn(IV) ]PF6 (4 a'); [L CH 3M], where M = Sc (2 b), Fe (3 b), Mn(III) (4 b); [L CH 3Mn(IV) ]2 (ClO4 )3 (H3 O)(H2 O)3 (4 b'). An electrochemical study has shown that complexes 1, 2, 3, 1 a, 2 a and 3 a each display three reversible, ligand-centred, one-electron oxidation steps. The salts [L OCH 3Fe(III) ]ClO4 and [L OCH 3Ga(III) ]ClO4 , have been isolated as stable crystalline materials. Electronic and EPR spectra prove that these oxidations produce species containing one, two or three coordinated phenoxyl radicals. The Mössbauer spectra of 3 a and [3 a](+) show conclusively that both compounds contain high-spin iron(III) central ions. Temperature-dependent magnetic susceptibility measurements reveal that 3 a has an S = 5/2 and [3a](+) an S = 2 ground state. The latter is attained through intramolecular antiferromagnetic exchange coupling between a high-spin iron(III) (S1 = 5/2) and a phenoxyl radical (S2 = 1/2) (H = - 2JS1 S2 ; J = - 80 cm(-1) ). The manganese complexes undergo metal- and ligand-centred redox processes, which were elucidated by spectroelectrochemistry; a phenoxyl radical Mn(IV) complex [Mn(IV) L OCH 3](2+) is accessible. Copyright © 1997 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Atomic layer deposition of scandium-based oxides

    Energy Technology Data Exchange (ETDEWEB)

    Nyns, Laura; Lisoni, Judit G.; Bosch, Geert van den; Elshocht, Sven van; Houdt, Jan van [IMEC, Leuven (Belgium)

    2014-02-15

    Gd{sub x}Sc{sub 2-x}O{sub 3} and Al{sub x}Sc{sub 2-x}O{sub 3} have been investigated as potential high-k intergate dielectric (IGD) in planar NAND flash technology, such as hybrid floating gate (HFG). We have examined the atomic layer deposition (ALD) of Sc{sub 2}O{sub 3}, Gd{sub x}Sc{sub 2-x}O{sub 3}, and Al{sub x}Sc{sub 2-x}O{sub 3} on Si using Sc(MeCp){sub 3}, Gd({sup i}PrCp){sub 3}, TMA, and H{sub 2}O as precursors. The composition of Gd{sub x}Sc{sub 2-x}O{sub 3} and Al{sub x}Sc{sub 2-x}O{sub 3} ranged from 4% to 76% Gd and from 7% to 66% Al, respectively. All compositions show linear growth behavior. While pure Sc{sub 2}O{sub 3} is crystalline as-deposited, the layer becomes amorphous once ∝20% of Al is added. The (222) reflection of the cubic phase is also seen for Gd{sub x}Sc{sub 2-x}O{sub 3} with less than 9% Gd. The bandgap of as-deposited Gd{sub x}Sc{sub 2-x}O{sub 3} decreases with increasing Gd content while the opposite trend is observed for Al{sub x}Sc{sub 2-x}O{sub 3}. A k-value of ∝21 can be obtained for Gd{sub x}Sc{sub 2-x}O{sub 3} with approximately 26-52% Gd, irrespective of the Gd content. For Al{sub x}Sc{sub 2-x}O{sub 3} on the other hand, a maximum k-value of ∝19 is achieved with ∝48% Al. Although the k-value of Al{sub x}Sc{sub 2-x}O{sub 3} is lower than that of Gd{sub x}Sc{sub 2-x}O{sub 3}, its large breakdown field makes this material more suitable for HFG flash applications. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. Spark plasma sintering of aluminum powders prealloyed with scandium additions

    Energy Technology Data Exchange (ETDEWEB)

    Cooke, R.W.; Kraus, N.P.; Bishop, D.P., E-mail: Paul.Bishop@dal.ca

    2016-03-07

    The objective of this research was to commence work on the spark plasma sintering (SPS) of Al–Sc alloys in an effort to develop fundamental data in this area. In this precursory study, a series of binary systems containing 0.1 to 0.4 wt% Sc were processed in laboratory and industrial-scale equipment. Data revealed that all powders were responsive to SPS in both scenarios and that sintering temperature was a variable of critical importance. Hardness of as-sintered products scaled directly with Sc concentration but varied inversely with SPS temperature owing to in-situ aging of the raw powders. Hardness losses could be recovered through a post-SPS heat treatment into the T6 condition. Industrially processed slugs of Al-0.4Sc-T6 exhibited full densification and offered the highest hardness (786+/−8 MPa). This was accompanied by a nominal tensile yield strength of 197 MPa, UTS of 226 MPa and tensile ductility of 11%.

  7. Tin etching from metallic and oxidized scandium thin films

    NARCIS (Netherlands)

    Pachecka, Malgorzata; Lee, Christopher James; Sturm, J.M.; Bijkerk, Frederik

    The role of oxide on Sn adhesion to Sc surfaces was studied with in-situ ellipsometry, X-ray photoelectron spectroscopy and secondary electron microscopy. Sn etching with hydrogen radicals was performed on metallic Sc, metallic Sc with a native oxide, and a fully oxidized Sc layer. The results show

  8. The structural and magnetic properties of holmium/scandium superlattices

    DEFF Research Database (Denmark)

    Bryn-Jacobsen, C.; Cowley, R.A.; McMorrow, D.F.

    1997-01-01

    The properties of Ho/Sc superlattices grown by molecular beam epitaxy (MBE) have been investigated using X-ray and neutron diffraction techniques. Structural studies reveal the novel existence of more than one a lattice parameter. Examining the magnetic properties, it is found that the Ho 4f...

  9. Physical Property Data Review of Selected Chemical Agents and Related Compounds: Updating Field Manual 3-9 (FM 3-9)

    Science.gov (United States)

    2003-09-01

    DESTRUCTION NOTICE For unclassified /limited distribution documents, use the same standard as "For Official Use Only" material, and destroy by any...16. PRICE CODE 20. LIMITATION OF ABSTRACT SAR NSN 7540-01-280-5500 Standard Form 298 (Rev. 2-89) Prescribed byANStStd. Z39-18 298-102 14...Ed.; Reinhold Book Corporation: New York, 1968. Daroff, P.M.; Metz, D.; Roberts, A.; Adams, J.A.; Jenkins, W. Oleoresin Capsicum: An Effective Less

  10. Differential expression and function of breast regression protein 39 (BRP-39) in murine models of subacute cigarette smoke exposure and allergic airway inflammation

    OpenAIRE

    Coyle Anthony J; Jordana Manel; Bauer Carla MT; Botelho Fernando M; Nikota Jake K; Humbles Alison A; Stampfli Martin R

    2011-01-01

    Abstract Background While the presence of the chitinase-like molecule YKL40 has been reported in COPD and asthma, its relevance to inflammatory processes elicited by cigarette smoke and common environmental allergens, such as house dust mite (HDM), is not well understood. The objective of the current study was to assess expression and function of BRP-39, the murine equivalent of YKL40 in a murine model of cigarette smoke-induced inflammation and contrast expression and function to a model of ...

  11. 40Ar/39Ar age spectra of some undisturbed terrestrial samples

    Science.gov (United States)

    Brent, Dalrymple G.; Lanphere, M.A.

    1974-01-01

    40Ar/39Ar age spectra and 40Ar/36Ar vs 39Ar/36Ar isochrons were determined by incremental heating for 11 terrestrial rocks and minerals whose geology indicates that they represent essentially undisturbed systems. The samples include muscovite, biotite, hornblende, sanidine, plagioclase, dacite, diabase and basalt and range in age from 40 to 1700 m.y. For each sample, the 40Ar/39Ar ratios, corrected for atmospheric and neutron-generated argon isotopes, are the same for most of the gas fractions released and the age spectra, which show pronounced plateaus, thus are consistent with models previously proposed for undisturbed samples. Plateau ages and isochron ages calculated using plateau age fractions are concordant and appear to be meaningful estimates of the crystallization and cooling ages of these samples. Seemingly anomalous age spectrum points can be attributed entirely to small amounts of previously unrecognized argon loss and to gas fractions that contain too small (less than 2 per cent) a proportion of the 39Ar released to be geologically significant. The use of a quantitative abscissa for age spectrum diagrams is recommended so that the size of each gas fraction is readily apparent. Increments containing less than about 4-5 per cent of the total 39Ar released should be interpreted cautiously. Both the age spectrum and isochron methods of data reduction for incremental heating experiments are worthwhile, as each gives slightly different but complementary information about the sample from the same basic data. Use of a least-squares fit that allows for correlated errors is recommended for 40Ar/36Ar vs 39Ar/36Ar isochrons. The results indicate that the 40Ar/39Ar incremental heating technique can be used to distinguish disturbed from undisturbed rock and mineral systems and will be a valuable geochronological tool in geologically complex terranes. ?? 1994.

  12. The C. elegans hox gene lin-39 controls cell cycle progression during vulval development.

    Science.gov (United States)

    Roiz, Daniel; Escobar-Restrepo, Juan Miguel; Leu, Philipp; Hajnal, Alex

    2016-10-01

    Cell fate specification during organogenesis is usually followed by a phase of cell proliferation to produce the required number of differentiated cells. The Caenorhabditis elegans vulva is an excellent model to study how cell fate specification and cell proliferation are coordinated. The six vulval precursor cells (VPCs) are born at the first larval stage, but they arrest in the G1 phase of the cell cycle until the beginning of the third larval stage, when their fates are specified and the three proximal VPCs proliferate to generate 22 vulval cells. An epidermal growth factor (EGF) signal from the gonadal anchor cell combined with lateral DELTA/NOTCH signaling between the VPCs determine the primary (1°) and secondary (2°) fates, respectively. The hox gene lin-39 plays a key role in integrating these spatial patterning signals and in maintaining the VPCs as polarized epithelial cells. Using a fusion-defective eff-1(lf) mutation to keep the VPCs polarized, we find that VPCs lacking lin-39 can neither activate lateral NOTCH signaling nor proliferate. LIN-39 promotes cell cycle progression through two distinct mechanisms. First, LIN-39 maintains the VPCs competent to proliferate by inducing cdk-4 cdk and cye-1 cyclinE expression via a non-canonical HOX binding motif. Second, LIN-39 activates in the adjacent VPCs the NOTCH signaling pathway, which promotes VPC proliferation independently of LIN-39. The hox gene lin-39 is therefore a central node in a regulatory network coordinating VPC differentiation and proliferation. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  13. Characterization of Himawari-8 AHI 3.9-um channel stray light

    Science.gov (United States)

    Shao, Xi; Wu, Xiangqian; Yu, Fangfang

    2016-09-01

    The Advanced Himawari Imager (AHI) is the primary instrument aboard Himawari-8 and has 16 multispectral channels, including six visible and near infrared and 10 thermal emissive bands. The 3.9-μm channel imagery of AHI has spatial resolution of 2 km and performs routine full-disk imaging every 10 minutes. There have been stray light observed in the full disk imagery of the AHI 3.9-μm channel over a few weeks around February and October-November when the line of sight of the sun is at 10 to 20 degrees south of the nadir of the Himawari-8. In this paper, difference data between consecutive AHI 3.9-μm images have been processed to quantitatively characterize and monitor the AHI stray light. Stray light indices are also developed to trend the occurrence, position and magnitude of the stray light in the AHI 3.9- μm imageries. It is also found that the stray light is the greatest in the AHI 3.9-μm band but also is detectable in other Mid-Wavelength IR channels. Analysis of the ratio of stray light magnitude between AHI 3.9-μm and 6.2-μm band indicates that it is consistent with the ratio of solar radiance for these two bands. This suggests that the stray light is mainly due to direct illumination of the attenuated solar radiation on the AHI detector rather than from onboard thermal body emission due to heating. The upcoming Advanced Baseline Imager (ABI) onboard the GOES-R satellite has very similar spectral and spatial characteristics as AHI. Therefore, characterizing the stray light in the 3.9-μm channel of AHI helps support post-launch calibration activities of ABI.

  14. Novel Zn2+ Modulated GPR39 Receptor Agonists Do Not Drive Acute Insulin Secretion in Rodents.

    Directory of Open Access Journals (Sweden)

    Ola Fjellström

    Full Text Available Type 2 diabetes (T2D occurs when there is insufficient insulin release to control blood glucose, due to insulin resistance and impaired β-cell function. The GPR39 receptor is expressed in metabolic tissues including pancreatic β-cells and has been proposed as a T2D target. Specifically, GPR39 agonists might improve β-cell function leading to more adequate and sustained insulin release and glucose control. The present study aimed to test the hypothesis that GPR39 agonism would improve glucose stimulated insulin secretion in vivo. A high throughput screen, followed by a medicinal chemistry program, identified three novel potent Zn2+ modulated GPR39 agonists. These agonists were evaluated in acute rodent glucose tolerance tests. The results showed a lack of glucose lowering and insulinotropic effects not only in lean mice, but also in diet-induced obese (DIO mice and Zucker fatty rats. It is concluded that Zn2+ modulated GPR39 agonists do not acutely stimulate insulin release in rodents.

  15. Ablation and cone formation mechanism on CR-39 by ArF laser irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Shakeri Jooybari, B., E-mail: baninshakery@gmail.com, E-mail: hafarideh@aut.ac.ir [Department of Energy Engineering and Physics, Amirkabir University of Technology, P.O. Box 15875-4413, Tehran, Islamic Republic of Iran (Iran, Islamic Republic of); Nuclear Science and Technology Research Institute NSRT, Tehran (Iran, Islamic Republic of); Afarideh, H., E-mail: baninshakery@gmail.com, E-mail: hafarideh@aut.ac.ir [Department of Energy Engineering and Physics, Amirkabir University of Technology, P.O. Box 15875-4413, Tehran, Islamic Republic of Iran (Iran, Islamic Republic of); Lamehi-Rachti, M. [Nuclear Science and Technology Research Institute NSRT, Tehran (Iran, Islamic Republic of); Ghergherehchi, M. [Department of Energy Engineering and Physics, Amirkabir University of Technology, P.O. Box 15875-4413, Tehran, Islamic Republic of Iran (Iran, Islamic Republic of); College of Information and Communication Engineering, Sungkyunkwan University, Suwon (Korea, Republic of)

    2015-03-07

    In this work, chemical properties, surface modification, and micro structures formation on ablated polyallyl di-glycol carbonate (CR-39) polymer by ArF laser irradiation (λ = 193 nm) at various fluences and pulse number were investigated. CR-39 samples have been irradiated with an ArF laser (193 nm) at a repetition rate of 1 Hz. Threshold fluence of ablation and effective absorption coefficient of CR-39 were determined. Conical microstructures (Taylor cone) formed on laser-ablated CR-39 exhibit: smooth, Taylor cone shape walls and sharp tips together with interference and well defined fringe-structure with a period of 230 nm, around cone base. Mechanism of cone formation and cone evolution of CR-39 ablated surface were investigated by change of fluences (at a given pulse number) and pulse number (at a given fluence). Cone height, cone base, and region of interface were increased in micrometer steps by increasing the total fluence. Depression on the base of the cone and the circular fringe were simulated. FTIR spectra were measured and energy dispersive x-ray analysis of irradiated and un-irradiated samples was performed.

  16. A comparison between SR-90 and two types of CR-39 nuclear track detectors

    Energy Technology Data Exchange (ETDEWEB)

    Abu-Jarad, F. [King Fahd University of Petroleum and Minerals, Dhahran (Saudi Arabia). Energy Research Laboratory, Research Inst.

    1993-12-31

    A new nuclear track detector, called SR-90, has been compared with two types of CR-39 nuclear track detectors (i) super grade PM-355 Pershore Mouldings/U.K. and (ii) MA-ND/{alpha}/Hungary. All types were irradiated with alpha and fission fragments and all etched under the same etching conditions. The bulk etching rate (V{sub B}) of SR-90 was twice that of the CR-39 for all etching times. The track etching rate (V{sub t}) of SR-90 starts with 8.5 {mu}m.h{sup -1} at 2 h etching time and increased to 13 {mu}m.h{sup -1} at 6.5 h, while for CR-39 remains nearly constant (2{mu}m.h{sup -1}) for all etching time. Thus, the sensitivity of SR-90 was found to improve with etching time. The surface of SR-90 is found to be rough and less transparent than both types of CR-39 detectors. The shape of perpendicular alpha and fission fragment tracks in SR-90 was not a uniform circular shape as in the CR-39. (author).

  17. Heparan sulfate proteoglycan-dependent neutrophil chemotaxis toward PR-39 cathelicidin

    Directory of Open Access Journals (Sweden)

    Patsch Josef R

    2006-11-01

    Full Text Available Abstract Cathelicidins are mammalian proteins containing a C-terminal cationic antimicrobial domain. Porcine PR-39 cathelicidin affects leukocyte biology. Mechanisms of action may involve alteration of heparan sulfate proteoglycan-dependent functions in inflammatory cells. It was tested whether PR-39 affects human neutrophil migration and if such effects involve heparan sulphate proteoglycans. Neutrophils were from forearm venous blood of healthy donors. Migration was tested in modified Boyden chamber assays. Involvement of heparan sulfate proteoglycans was tested by their chemical modification and by the use of specific antibodies. PR-39 induced migration in neutrophils in a concentration dependent manner. Modification of heparan sulfate proteoglycans with sodium chlorate inhibited migration whereas chemotaxis toward the chemoattractant formyl-Met-Leu-Phe was not affected. Removal of heparan sulfates or chondroitin sulfates from the surface of neutrophils by heparinase or chondroitinase inhibited migration toward PR-39. In conclusion, antimicrobial PR-39 stimulates human neutrophil chemotaxis in a heparan sulfate proteoglycan-dependent manner. Involvment of syndecans is likely as both heparinase and chondroitinase were abrogating. Data suggest active participation of heparan sulfate proteoglycans of neutrophils in cathelicidin peptide-mediated regulation of the antimicrobial host defense.

  18. YY-39, a tick anti-thrombosis peptide containing RGD domain.

    Science.gov (United States)

    Tang, Jing; Fang, Yaqun; Han, Yajun; Bai, Xuewei; Yan, Xiuwen; Zhang, Yun; Lai, Ren; Zhang, Zhiye

    2015-06-01

    Ticks are obligatory blood feeding ectoparasites, which continuously attach to their hosts for 1-2 weeks. There are many biologically active compounds in tick salivary glands interfering host haemostatic system and to successfully obtain blood meal. Several platelet aggregation inhibitors have been identified from ticks. A family of conserved peptides, which were identified from transcriptome analysis of many tick salivary glands, were found to contain unique primary structure including predicted mature peptides of 39-47 amino acid residues in length and a Pro/Glu(P/E)-Pro/His(P/H)-Lys-Gly-Asp(RGD) domain. Given their unique structure and RGD domain, they are considered a novel family of disintegrins that inhibit platelet aggregation. One of them (YY-39) was tested for its effects on platelets and thrombosis in vivo. YY-39 was found effectively to inhibit platelet aggregation induced by adenosine diphosphate (ADP), thrombin and thromboxane A2 (TXA2). Furthermore, YY-39 blocked platelet adhesion to soluble collagen and bound to purified GPIIb/IIIa in a dose-dependent manner. In in vivo experiments, YY-39 reduced thrombus weight effectively in a rat arteriovenous shunt model and inhibited thrombosis in a carrageenan-induced mouse tail thrombosis model. Combined with their prevalence in ticks and platelet inhibitory functions, this family of peptides might be conserved tick anti-haemostatic molecules. Copyright © 2014 Elsevier Inc. All rights reserved.

  19. Magnetic and magnetocaloric properties of Ni50-xCuxMn39Sn11 alloys

    Science.gov (United States)

    Kaya, Melike; Dincer, Ilker

    2017-11-01

    The effect of Cu substitution on the martensitic transition and magnetocaloric properties of arc-melted Ni50-xCuxMn39Sn11 (x = 6 and 7) Heusler alloys are investigated by differential scanning calorimetry, X-ray powder diffraction, scanning electron microscopy and magnetic measurements. According to XRD patterns, while Ni44Cu6Mn39Sn11 alloy exhibit orthorhombic structure, Ni43Cu7Mn39Sn11 alloy crystallize cubic L21 structure at room temperature. The substitution of Cu for Ni leads to decreasing on the martensitic transition temperatures to lower values. The magnetic entropy changes calculated from M(T) curves, for avoiding hysteresis losses in the vicinity of the martensitic transition region, by using Maxwell relation. The maximum magnetic entropy change, ΔSM is found 11.0 J kg-1 K-1 for Ni43Cu7Mn39Sn11 alloy around the martensitic transition region, which is nearly twice as large as the Ni44Cu6Mn39Sn11 alloy under the magnetic field changing from 0 to 2 T.

  20. 40 CFR 180.1201 - Trichoderma harzianum strain T-39; exemption from the requirement of a tolerance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Trichoderma harzianum strain T-39... RESIDUES IN FOOD Exemptions From Tolerances § 180.1201 Trichoderma harzianum strain T-39; exemption from the requirement of a tolerance. Trichoderma harzianum strain T-39 is exempt from the requirement of a...

  1. File list: Oth.PSC.10.Suv39h1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.10.Suv39h1.AllCell mm9 TFs and others Suv39h1 Pluripotent stem cell SRX6042...54,SRX604255 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.10.Suv39h1.AllCell.bed ...

  2. 16 CFR 1025.39 - Orders requiring witnesses to testify or provide other information and granting immunity.

    Science.gov (United States)

    2010-01-01

    ... provide other information and granting immunity. 1025.39 Section 1025.39 Commercial Practices CONSUMER... Process § 1025.39 Orders requiring witnesses to testify or provide other information and granting immunity... witness or deponent to testify or provide other information upon being granted immunity from prosecution...

  3. File list: Oth.PSC.20.Suv39h2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.20.Suv39h2.AllCell mm9 TFs and others Suv39h2 Pluripotent stem cell SRX6042...57,SRX604256 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.20.Suv39h2.AllCell.bed ...

  4. File list: Oth.ALL.20.Suv39h2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.Suv39h2.AllCell mm9 TFs and others Suv39h2 All cell types SRX604257,SRX6...04256 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.20.Suv39h2.AllCell.bed ...

  5. File list: Oth.PSC.05.Suv39h1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.05.Suv39h1.AllCell mm9 TFs and others Suv39h1 Pluripotent stem cell SRX6042...54,SRX604255 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.05.Suv39h1.AllCell.bed ...

  6. File list: Oth.ALL.50.Suv39h2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.50.Suv39h2.AllCell mm9 TFs and others Suv39h2 All cell types SRX604257,SRX6...04256 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.50.Suv39h2.AllCell.bed ...

  7. File list: Oth.ALL.10.Suv39h1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.10.Suv39h1.AllCell mm9 TFs and others Suv39h1 All cell types SRX604254,SRX6...04255 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.10.Suv39h1.AllCell.bed ...

  8. File list: Oth.ALL.05.Suv39h2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.05.Suv39h2.AllCell mm9 TFs and others Suv39h2 All cell types SRX604257,SRX6...04256 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.05.Suv39h2.AllCell.bed ...

  9. File list: Oth.ALL.50.Suv39h1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.50.Suv39h1.AllCell mm9 TFs and others Suv39h1 All cell types SRX604254,SRX6...04255 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.50.Suv39h1.AllCell.bed ...

  10. File list: Oth.ALL.05.Suv39h1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.05.Suv39h1.AllCell mm9 TFs and others Suv39h1 All cell types SRX604254,SRX6...04255 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.05.Suv39h1.AllCell.bed ...

  11. File list: Oth.PSC.05.Suv39h2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.05.Suv39h2.AllCell mm9 TFs and others Suv39h2 Pluripotent stem cell SRX6042...57,SRX604256 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.05.Suv39h2.AllCell.bed ...

  12. File list: Oth.PSC.50.Suv39h2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.50.Suv39h2.AllCell mm9 TFs and others Suv39h2 Pluripotent stem cell SRX6042...57,SRX604256 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.50.Suv39h2.AllCell.bed ...

  13. File list: Oth.ALL.20.Suv39h1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.Suv39h1.AllCell mm9 TFs and others Suv39h1 All cell types SRX604254,SRX6...04255 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.20.Suv39h1.AllCell.bed ...

  14. File list: Oth.ALL.05.SuBRACKETLvarBRACKETR3-9.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.05.SuBRACKETLvarBRACKETR3-9.AllCell dm3 TFs and others Su(var)3-9 All cell ...types SRX331403 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.ALL.05.SuBRACKETLvarBRACKETR3-9.AllCell.bed ...

  15. File list: Oth.Unc.10.SuBRACKETLvarBRACKETR3-9.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Unc.10.SuBRACKETLvarBRACKETR3-9.AllCell dm3 TFs and others Su(var)3-9 Unclassif...ied http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.Unc.10.SuBRACKETLvarBRACKETR3-9.AllCell.bed ...

  16. File list: Oth.Lar.10.SuBRACKETLvarBRACKETR3-9.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Lar.10.SuBRACKETLvarBRACKETR3-9.AllCell dm3 TFs and others Su(var)3-9 Larvae SR...X331403 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.Lar.10.SuBRACKETLvarBRACKETR3-9.AllCell.bed ...

  17. File list: Oth.Pup.05.SuBRACKETLvarBRACKETR3-9.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Pup.05.SuBRACKETLvarBRACKETR3-9.AllCell dm3 TFs and others Su(var)3-9 Pupae htt...p://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.Pup.05.SuBRACKETLvarBRACKETR3-9.AllCell.bed ...

  18. File list: Oth.Adl.20.SuBRACKETLvarBRACKETR3-9.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Adl.20.SuBRACKETLvarBRACKETR3-9.AllCell dm3 TFs and others Su(var)3-9 Adult htt...p://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.Adl.20.SuBRACKETLvarBRACKETR3-9.AllCell.bed ...

  19. File list: Oth.Emb.10.SuBRACKETLvarBRACKETR3-9.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Emb.10.SuBRACKETLvarBRACKETR3-9.AllCell dm3 TFs and others Su(var)3-9 Embryo ht...tp://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.Emb.10.SuBRACKETLvarBRACKETR3-9.AllCell.bed ...

  20. File list: Oth.Pup.20.SuBRACKETLvarBRACKETR3-9.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Pup.20.SuBRACKETLvarBRACKETR3-9.AllCell dm3 TFs and others Su(var)3-9 Pupae htt...p://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.Pup.20.SuBRACKETLvarBRACKETR3-9.AllCell.bed ...

  1. 25 CFR 39.801 - What is the formula to determine the amount necessary to sustain a school's academic or...

    Science.gov (United States)

    2010-04-01

    ... sustain a school's academic or residential program? 39.801 Section 39.801 Indians BUREAU OF INDIAN AFFAIRS... To Sustain an Academic or Residential Program § 39.801 What is the formula to determine the amount necessary to sustain a school's academic or residential program? (a) The Secretary's formula to determine...

  2. File list: Oth.PSC.10.Suv39h2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.10.Suv39h2.AllCell mm9 TFs and others Suv39h2 Pluripotent stem cell SRX6042...57,SRX604256 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.10.Suv39h2.AllCell.bed ...

  3. File list: Oth.PSC.50.Suv39h1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.50.Suv39h1.AllCell mm9 TFs and others Suv39h1 Pluripotent stem cell SRX6042...54,SRX604255 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.50.Suv39h1.AllCell.bed ...

  4. File list: Oth.ALL.10.Suv39h2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.10.Suv39h2.AllCell mm9 TFs and others Suv39h2 All cell types SRX604257,SRX6...04256 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.10.Suv39h2.AllCell.bed ...

  5. 49 CFR 39.63 - What modifications and auxiliary aids and services are required at terminals and other landside...

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What modifications and auxiliary aids and services... impairments? 39.63 Section 39.63 Transportation Office of the Secretary of Transportation TRANSPORTATION FOR INDIVIDUALS WITH DISABILITIES: PASSENGER VESSELS Accessibility of Landside Facilities § 39.63 What...

  6. 25 CFR 39.145 - Can a school receive both a small school adjustment and a small high school adjustment?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can a school receive both a small school adjustment and a small high school adjustment? 39.145 Section 39.145 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR EDUCATION THE INDIAN SCHOOL EQUALIZATION PROGRAM Indian School Equalization Formula Small School Adjustment § 39.145 Can a school...

  7. 14 CFR 125.39 - Carriage of narcotic drugs, marihuana, and depressant or stimulant drugs or substances.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Carriage of narcotic drugs, marihuana, and depressant or stimulant drugs or substances. 125.39 Section 125.39 Aeronautics and Space FEDERAL AVIATION... AIRCRAFT Certification Rules and Miscellaneous Requirements § 125.39 Carriage of narcotic drugs, marihuana...

  8. Fast neutrons detection in CR-39 and DAM-ADC nuclear track detectors

    Science.gov (United States)

    Abdalla, A. M.; Ashraf, O.; Rammah, Y. S.; Ashry, A. H.; Eisa, M.; Tsuruta, T.

    2015-03-01

    Fast detection of neutrons in CR-39 and DAM-ADC nuclear track detectors were investigated using new etching conditions. The neutron irradiation is performed using a 5 mCi Am-Be source present at the National Institute of Standards (NIS) of Egypt. Using the new etching condition, irradiated CR-39 samples were etched for 4 h and DAM-ADC samples for 80 min. Suitable analyzing software has been used to analyze experimental data.The dependence of neutrons track density on the neutrons fluence is investigated. When etched under optimum conditions, the relationship between track density and fluence is determined which is found to be linear. Detection efficiency has been represented for both SSNTDs and found to be constant with fluence, which reflects the importance of using CR-39 and DAM-ADC detectors in the field of neutron dosimetry. Linear relationship between track density and effective dose is determined.

  9. Safety Assessment of Polyquaternium-22 and Polyquarternium-39 as Used in Cosmetics.

    Science.gov (United States)

    Johnson, Wilbur; Heldreth, Bart; Bergfeld, Wilma F; Belsito, Donald V; Hill, Ronald A; Klaassen, Curtis D; Liebler, Daniel C; Marks, James G; Shank, Ronald C; Slaga, Thomas J; Snyder, Paul W; Andersen, F Alan

    2016-11-01

    Polyquaternium-22 and polyquaternium-39 are polymers that function as antistatic agents, film formers, and hair fixatives in cosmetic products. These ingredients are being used at concentrations up to 2% (polyquaternium-22, in a rinse-off product) and up to 3% (polyquaternium-39, in rinse-off and leave-on products). The unreacted monomer content of these ingredients was considered low and of no toxicological concern. Limited data showed no skin irritation/sensitization. Although these ingredients were nongenotoxic in bacterial assays, mammalian genotoxicity, carcinogenicity, and reproductive and developmental toxicity data were not available. These polymers, however, are large, highly polar molecules that would likely not be absorbed, and neither local effects in the respiratory tract nor systemic toxicity are expected following product application/exposure. The Expert Panel concluded that polyquaternium-22 and polyquaternium-39 are safe in the present practices of use and concentration in cosmetic formulations. © The Author(s) 2016.

  10. Redesign of the End Group in the 3.9 GHz LCLS-II Cavity

    Energy Technology Data Exchange (ETDEWEB)

    Lunin, Andrei [Fermilab; Gonin, Ivan [Fermilab; Khabiboulline, Timergali [Fermilab; Solyak, Nikolay [Fermilab

    2017-05-01

    Development and production of Linac Coherent Light Source II (LCLS-II) is underway. The central part of LCLS-II is a continuous wave superconducting RF (CW SCRF) electron linac. The 3.9 GHz third harmonic cavity similar to the XFEL design will be used in LCLS-II for linearizing the longitudinal beam profile*. The initial design of the 3.9 GHz cavity developed for XFEL project has a large, 40 mm, beam pipe aperture for better higher-order mode (HOM) damping. It is resulted in dipole HOMs with frequencies nearby the operating mode, which causes difficulties with HOM coupler notch filter tuning. The CW linac operation requires an extra caution in the design of the HOM coupler in order to prevent its possible overheating. In this paper we present the modified 3.9 GHz cavity End Group for meeting the LCLS-II requirements

  11. Gr39a, a highly diversified gustatory receptor in Drosophila, has a role in sexual behavior.

    Science.gov (United States)

    Watanabe, Kanako; Toba, Gakuta; Koganezawa, Masayuki; Yamamoto, Daisuke

    2011-09-01

    Sexual recognition among individuals is crucial for the reproduction of animals. In Drosophila, like in many other animals, pheromones are suggested to play an important role in conveying information about an individual, such as sex, maturity and mating status. Sex-specific cuticular hydrocarbon components are thought to be major sex pheromones in Drosophila, and are postulated to act through the gustatory system, since they are mostly non-volatile chemicals. However, very little is known about the molecular and neural bases of gustatory pheromone reception. So far, a few putative gustatory receptors, including Gr32a and Gr68a, have been implicated in courtship behavior. Here, we examine another putative gustatory receptor, Gr39a, which shares a cluster with both Gr32a and Gr68a in a molecular phylogeny of the gustatory receptor family, for its potential role in courtship behavior. The Gr39a gene produces four isoforms through alternative splicing of different 5'-most exons. A quantitative real-time PCR analysis showed that the expression levels of all four splice variants of Gr39a were reduced in a fly line in which a P element was inserted into the Gr39a locus. Homozygous and hemizygous males for the P-element insertion, as well as males in which Gr39a was knocked down by RNAi, all showed reduced courtship levels toward females. The courtship levels returned to normal when the P element was excised out. A close analysis of courtship behavior of the mutant males revealed that the average duration of a continuous courtship bout was significantly shorter in the mutants than in the wild type. The results suggest that Gr39a has a role in sustaining courtship behavior in males, possibly through the reception of a stimulating arrestant pheromone.

  12. High Spatial Resolution 40Ar/39Ar Geochronology of Lunar Impact Melt Rocks

    Science.gov (United States)

    Mercer, Cameron Mark

    Impact cratering has played a key role in the evolution of the solid surfaces of Solar System bodies. While much of Earth’s impact record has been erased, its Moon preserves an extensive history of bombardment. Quantifying the timing of lunar impact events is crucial to understanding how impacts have shaped the evolution of early Earth, and provides the basis for estimating the ages of other cratered surfaces in the Solar System. Many lunar impact melt rocks are complex mixtures of glassy and crystalline “melt” materials and inherited clasts of pre-impact minerals and rocks. If analyzed in bulk, these samples can yield complicated incremental release 40Ar/39Ar spectra, making it challenging to uniquely interpret impact ages. Here, I have used a combination of high-spatial resolution 40Ar/39Ar geochronology and thermal-kinetic modeling to gain new insights into the impact histories recorded by such lunar samples. To compare my data to those of previous studies, I developed a software tool to account for differences in the decay, isotopic, and monitor age parameters used for different published 40Ar/39Ar datasets. Using an ultraviolet laser ablation microprobe (UVLAMP) system I selectively dated melt and clast components of impact melt rocks collected during the Apollo 16 and 17 missions. UVLAMP 40Ar/39Ar data for samples 77135, 60315, 61015, and 63355 show evidence of open-system behavior, and provide new insights into how to interpret some complexities of published incremental heating 40Ar/39Ar spectra. Samples 77115, 63525, 63549, and 65015 have relatively simple thermal histories, and UVLAMP 40Ar/39Ar data for the melt components of these rocks indicate the timing of impact events—spanning hundreds of millions of years—that influenced the Apollo 16 and 17 sites. My modeling and UVLAMP 40Ar/39Ar data for sample 73217 indicate that some impact melt rocks can quantitatively retain evidence for multiple melt-producing impact events, and imply that such

  13. Higher order modes HOMs in coupled cavities of the FLASH module ACC39

    CERN Document Server

    Shinton, I R R; Li, Z; Zhang, P

    2011-01-01

    We analyse the higher order modes (HOM’s) in the 3.9GHz bunch shaping cavities installed in the FLASH facility at DESY. A suite of finite element computer codes (including HFSS and ACE3P) and globalised scattering matrix calculations (GSM) are used to investigate the modes in these cavities. This study is primarily focused on the dipole component of the multiband expansion of the wakefield, with the emphasis being on the development of a HOM-based BPM system for ACC39. Coupled inter-cavity modes are simulated together with a limited band of trapped modes.

  14. Lentivirus mediated silencing of Ubiquitin Specific Peptidase 39 inhibits cell proliferation of human hepatocellular carcinoma cells in vitro

    OpenAIRE

    PAN, ZEYA; Pan, Hao; Zhang, Jin; Yang, Yun; Liu, Hui; Yang, Yuan; Huang, Gang; Ni, Junsheng; Huang, Jian; Zhou, Weiping

    2015-01-01

    Background Ubiquitin Specific Peptidase 39 (USP39) is a 65?kDa SR-related protein involved in RNA splicing. Previous studies showed that USP39 is related with tumorigenesis of human breast cancer cells. Results In the present study, we investigated the functions of USP39 in human hepatocellular carcinoma (HCC) cell line SMMC-7721. We knocked down the expression of USP39 through lentivirus mediated RNA interference. The results of qRT-PCR and western blotting assay showed that both the mRNA an...

  15. 39 Annual Meeting of Spanish Nuclear Society, September 25-27, 2013, Reus, Spain; 39 Reunion Anual Sociedad Nuclear Espanola, 25-27 Septiembre 2013, Reus, Espana

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-07-01

    The Spanish Nuclear Society (SNE) is a non-profit association, made up of professionals and institutions in order to promote awareness and dissemination of science and nuclear technology. The 39th meeting of the SNE held in Reus, analyzes the current situation of nuclear energy and its future challenges, covering different topics from engineering to R and D, nuclear safety, also the impact on health and the environment in the vicinity of a nuclear facility, the experience of Spanish companies in the construction of power and knowledge management in the nuclear sector.

  16. Issues Related to the Use of Z39.50 To Emulate a Centralized Union Catalogue.

    Science.gov (United States)

    Lunau, Carrol; Turner, Fay

    The virtual Canadian union catalog (vCuc) project is a project among Canadian libraries to use Z39.50 (an information protocol standard) for searching distributed individual library catalogs and union catalogs. This paper summarizes the major technical, vendor, bibliographic data, and administrative issues that must be resolved before the…

  17. 39 CFR 320.7 - Suspension for advertisements accompanying parcels or periodicals.

    Science.gov (United States)

    2010-07-01

    ... or periodicals. 320.7 Section 320.7 Postal Service UNITED STATES POSTAL SERVICE RESTRICTIONS ON... advertisements accompanying parcels or periodicals. (a) The operation of 39 U.S.C. 601(a) (1) through (6) and... with merchandise in parcels or accompanying periodicals under the following circumstances: (1) The...

  18. 17 CFR 39.5 - Information relating to derivatives clearing organization operations.

    Science.gov (United States)

    2010-04-01

    ... FUTURES TRADING COMMISSION DERIVATIVES CLEARING ORGANIZATIONS § 39.5 Information relating to derivatives... shall file with the Commission such information related to its business as a clearing organization... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Information relating to...

  19. Rate.ee tõi nelja aastaga 39 miljonit / Krista Taim

    Index Scriptorium Estoniae

    Taim, Krista

    2006-01-01

    Andrei Korobeinik müüs EMT-le 39 miljoni krooni eest 51%-lise osaluse suhtlusportaalis Rate.ee. Vt. samas: Gert D. Hankewitz. EMT kindlustab oma kohta noorte seas; Online-suhtluses konkurents kasvab; Viik: EMT maksis liiga kõrget hinda; Rate.ee on noorte suhtlusportaal

  20. 25 CFR 39.600 - Are Bureau-operated school board expenses funded by ISEP limited?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Are Bureau-operated school board expenses funded by ISEP... INDIAN SCHOOL EQUALIZATION PROGRAM School Board Training Expenses § 39.600 Are Bureau-operated school board expenses funded by ISEP limited? Yes. Bureau-operated schools are limited to $8,000 or one percent...

  1. 7 CFR 15a.39 - Health and insurance benefits and services.

    Science.gov (United States)

    2010-01-01

    ... Section 15a.39 Agriculture Office of the Secretary of Agriculture EDUCATION PROGRAMS OR ACTIVITIES RECEIVING OR BENEFITTING FROM FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Education... proportion of students of one sex than of the other, including family planning services. However, any...

  2. 39 CFR 3007.10 - Submission of non-public materials under seal.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Submission of non-public materials under seal. 3007.10 Section 3007.10 Postal Service POSTAL REGULATORY COMMISSION PERSONNEL TREATMENT OF NON-PUBLIC MATERIALS PROVIDED BY THE POSTAL SERVICE § 3007.10 Submission of non-public materials under seal. (a) Non...

  3. Rose Atoll Site 31P 3/6/2006 38-39M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Rose Atoll, site 31P (14 32.568S, 168 09.417W), between 38 and 39 meters along a permanent transect.

  4. Jarvis Island Site 11P 3/22/2006 39-40M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Jarvis Island, site 11P (00 22.135S, 160 00.484W), between 39 and 40 meters along a permanent transect.

  5. Palmyra Atoll Site 9P-B 3/29/2004 39-40M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 39 and 40 meters along a permanent transect.

  6. 39 CFR 3050.53 - Information on customer satisfaction and retail access. [Reserved

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Information on customer satisfaction and retail access. 3050.53 Section 3050.53 Postal Service POSTAL REGULATORY COMMISSION PERSONNEL PERIODIC REPORTING § 3050.53 Information on customer satisfaction and retail access. ...

  7. 14 CFR 26.39 - Newly produced airplanes: Fuel tank flammability.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Newly produced airplanes: Fuel tank... TRANSPORTATION AIRCRAFT CONTINUED AIRWORTHINESS AND SAFETY IMPROVEMENTS FOR TRANSPORT CATEGORY AIRPLANES Fuel Tank Flammability § 26.39 Newly produced airplanes: Fuel tank flammability. (a) Applicability: This...

  8. Engineering Delftia acidovorans DSM39 to produce polyhydroxyalkanoates from slaughterhouse waste.

    Science.gov (United States)

    Romanelli, Maria Giovanna; Povolo, Silvana; Favaro, Lorenzo; Fontana, Federico; Basaglia, Marina; Casella, Sergio

    2014-11-01

    The inexpensive agricultural fatty by-products could be usefully converted to polyhydroxyalkanoates (PHAs) by properly selected and/or developed microbes. Delftia acidovorans DSM39 is a well-known producer of PHAs with high molar fractions of 4-hydroxybutyrate (4HB), but unable to grow on fatty substrates. The aim of this study was to construct a recombinant strain of D. acidovorans DSM39 using fats-containing waste such as udder, lard and tallow, to produce PHAs. The lipC and lipH genes of Pseudomonas stutzeri BT3, proficient lipolytic isolate, were successfully co-expressed into D. acidovorans DSM39 and the resulting recombinant strain displayed high extracellular enzymatic activity on corn oil. The PHAs production from corn oil achieved high levels (26% of cell dry weight, with about 7% of 4HB). Surprisingly, the recombinant strain produced greater values directly from slaughterhouse residues such as udder and lard (43 and 39%, respectively, with almost 7% of 4HB). Moreover, this work proved the ability of the recombinant D. acidovorans strain to produce PHAs with significant percentage of 4HB, without the supplementation of any precursor in the liquid broth. This research paves the way to the efficient one-step conversion of fatty residues into PHAs having valuable properties exploitable in several medical and industrial applications. Copyright © 2014 Elsevier B.V. All rights reserved.

  9. 39 CFR 3.6 - Information furnished to Board-financial and operating reports.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Information furnished to Board-financial and... U.S. POSTAL SERVICE BOARD OF GOVERNORS (ARTICLE III) § 3.6 Information furnished to Board—financial...) Balance sheet information; (4) service quality measurements; (5) productivity measurements (reflecting...

  10. ß-Cell Specific Overexpression of GPR39 Protects against Streptozotocin-Induced Hyperglycemia

    DEFF Research Database (Denmark)

    Egerod, Kristoffer Lihme; Jin, Chunyu; Petersen, Pia Steen

    2011-01-01

    promoter to selectively overexpress GPR39 in the ß cells in a double transgenic mouse strain and challenge them with multiple low doses of streptozotocin, which in the wild-type littermates leads to a gradual increase in nonfasting glucose levels and glucose intolerance observed during both food intake...

  11. 39 CFR 235.1 - Postal Service to the Armed Forces.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Postal Service to the Armed Forces. 235.1 Section... LIAISON § 235.1 Postal Service to the Armed Forces. (a) Publication 38, Postal Agreement with the... Armed Forces. (b) The Chief Inspector is responsible for military liaison. (c) Postal inspectors provide...

  12. 39 CFR 501.14 - Postage Evidencing System inventory control processes.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Postage Evidencing System inventory control... TO MANUFACTURE AND DISTRIBUTE POSTAGE EVIDENCING SYSTEMS § 501.14 Postage Evidencing System inventory control processes. (a) Each authorized provider of Postage Evidencing Systems must permanently hold title...

  13. 40 CFR 710.39 - How do I submit the required information?

    Science.gov (United States)

    2010-07-01

    ... SUBSTANCES CONTROL ACT TSCA CHEMICAL INVENTORY REGULATIONS 2002 Inventory Update Reporting § 710.39 How do I... at the following address: OPPT Document Control Officer, Mail Code 7407M, ATTN: Inventory Update Rule... Partial Updating of the TSCA Chemical Inventory Data Base,” via the Internet or the TSCA Hotline. (c...

  14. 39 CFR 3004.61 - Freedom of Information Act Public Liaison.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Freedom of Information Act Public Liaison. 3004.61 Section 3004.61 Postal Service POSTAL REGULATORY COMMISSION PERSONNEL PUBLIC RECORDS AND FREEDOM OF INFORMATION ACT § 3004.61 Freedom of Information Act Public Liaison. The Commission designates the Director of...

  15. 11 CFR 111.39 - When must the respondent pay the civil money penalty?

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false When must the respondent pay the civil money... (2 U.S.C. 437g, 437d(a)) Administrative Fines § 111.39 When must the respondent pay the civil money... States, the respondent must remit payment of the civil money penalty within thirty (30) days of receipt...

  16. 39 CFR 762.43 - Issuance of substitute disbursement postal money order.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Issuance of substitute disbursement postal money...; DISBURSEMENT POSTAL MONEY ORDERS DISBURSEMENT POSTAL MONEY ORDERS Issuance of Substitutes for Lost, Destroyed, Mutilated, and Defaced Disbursement Postal Money Orders § 762.43 Issuance of substitute disbursement postal...

  17. 39 CFR 762.28 - Release of original disbursement postal money orders.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Release of original disbursement postal money...; DISBURSEMENT POSTAL MONEY ORDERS DISBURSEMENT POSTAL MONEY ORDERS Endorsements, Payment, Guaranties, Warranties and Processing of Disbursement Postal Money Orders § 762.28 Release of original disbursement postal...

  18. Rose Atoll Site 10P 2/19/2012 39-40M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Rose Atoll, site 10P (14 33.075S, 168 09.622W), between 39 and 40 meters along a permanent transect.

  19. Rose Atoll Site 9P 7/30/2004 38-39M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Rose Atoll, site 9P (14 33.075S, 168 09.622W), between 38 and 39 meters along a permanent transect.

  20. 39 CFR 3050.26 - Documentation of demand elasticities and volume forecasts.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Documentation of demand elasticities and volume... § 3050.26 Documentation of demand elasticities and volume forecasts. By January 20 of each year, the Postal Service shall provide econometric estimates of demand elasticity for all postal products...

  1. 39 CFR 946.4 - Disposition of property of unknown owners.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Disposition of property of unknown owners. 946.4 Section 946.4 Postal Service UNITED STATES POSTAL SERVICE PROCEDURES RULES OF PROCEDURE RELATING TO THE... § 946.4 Disposition of property of unknown owners. (a) Where no apparent owner of property subject to...

  2. 39 CFR 946.2 - Disposition of property of apparent owners.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Disposition of property of apparent owners. 946.2... § 946.2 Disposition of property of apparent owners. Where an apparent owner of property subject to this... owner's last known address, written notice describing the property and the procedure for filing a claim...

  3. The four-transmembrane protein IP39 of Euglena forms strands by a trimeric unit repeat

    Science.gov (United States)

    Suzuki, Hiroshi; Ito, Yasuyuki; Yamazaki, Yuji; Mineta, Katsuhiko; Uji, Masami; Abe, Kazuhiro; Tani, Kazutoshi; Fujiyoshi, Yoshinori; Tsukita, Sachiko

    2013-01-01

    Euglenoid flagellates have striped surface structures comprising pellicles, which allow the cell shape to vary from rigid to flexible during the characteristic movement of the flagellates. In Euglena gracilis, the pellicular strip membranes are covered with paracrystalline arrays of a major integral membrane protein, IP39, a putative four-membrane-spanning protein with the conserved sequence motif of the PMP-22/EMP/MP20/Claudin superfamily. Here we report the three-dimensional structure of Euglena IP39 determined by electron crystallography. Two-dimensional crystals of IP39 appear to form a striated pattern of antiparallel double-rows in which trimeric IP39 units are longitudinally polymerised, resulting in continuously extending zigzag-shaped lines. Structural analysis revealed an asymmetric molecular arrangement in the trimer, and suggested that at least four different interactions between neighbouring protomers are involved. A combination of such multiple interactions would be important for linear strand formation of membrane proteins in a lipid bilayer. PMID:23612307

  4. Cladosporium cladosporioides H39: A new biological control agent for apple scab control

    NARCIS (Netherlands)

    Köhl, J.; Scheer, C.; Holb, I.J.; Masny, S.; Molhoek, W.M.L.

    2015-01-01

    Apple scab caused by Venturia inaequalis is the most important disease in apple production. Control of apple scab currently depends on the multiple applications of fungicides. The potential of the antagonist isolate Cladosporium cladosporioides H39, originating from a sporulating colony of V.

  5. 25 CFR 39.412 - What sanctions apply for failure to comply with this subpart?

    Science.gov (United States)

    2010-04-01

    ... INDIAN SCHOOL EQUALIZATION PROGRAM Accountability § 39.412 What sanctions apply for failure to comply... 25 Indians 1 2010-04-01 2010-04-01 false What sanctions apply for failure to comply with this... school board; and (2) Notice of final tribal or school board personnel action to the Director of OIEP. ...

  6. 39 CFR 762.27 - Processing of disbursement postal money orders by Federal Reserve Banks.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Processing of disbursement postal money orders by... DEBT OBLIGATIONS; DISBURSEMENT POSTAL MONEY ORDERS DISBURSEMENT POSTAL MONEY ORDERS Endorsements, Payment, Guaranties, Warranties and Processing of Disbursement Postal Money Orders § 762.27 Processing of...

  7. 39 CFR 501.9 - Demonstration or test Postage Evidencing Systems.

    Science.gov (United States)

    2010-07-01

    ... demonstration or test Postage Evidencing System must be recorded as such on internal provider inventory records... Postage Evidencing System must remain under the provider's direct control. A demonstration or test Postage... 39 Postal Service 1 2010-07-01 2010-07-01 false Demonstration or test Postage Evidencing Systems...

  8. Study of bulk-etch rates and track-etch rates in CR39

    Energy Technology Data Exchange (ETDEWEB)

    Green, P.F.; Ramli, A.G.; Al-Najjar, S.A.R.; Abu-Jarad, F.; Durrani, S.A. (Birmingham Univ. (UK). Dept. of Physics)

    1982-12-01

    The bulk-etch rate, Vsub(B), of CR39 has been measured in various concentrations of NaOH and KOH (in the range 1-12 N) at temperatures from 40/sup 0/C to 80/sup 0/C. In addition, the track-etch, Vsub(T), and the ratio V = Vsub(T)/Vsub(B), of various energies of alpha particles have been measured in a similar range of etching conditions. These studies show that 6 N NaOH at 70/sup 0/C represent the optimum etching conditions for Cr39, within the range of the present study. An empirical method is presented for correcting V measurements on alpha particle tracks for varying amounts of surface removal. Evidence is presented for severe variations in the response of different commercial batches of CR39. Finally, it is shown that heat treatment of CR39 results in the formation of a layer of enhanced bulk-etch rate at a depth of approx.= 20 ..mu..m within the sheet, even in samples produced in a curing cycle designed to yield uniform polymerisation with depth. It is suggested that this effect is a property of the polymer itself, rather than being due to experimental conditions during formation. One possible advantage of this effect is suggested.

  9. NCBI nr-aa BLAST: CBRC-CFAM-39-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-39-0028 ref|NP_001026714.1| olfactory receptor 4 [Gallus gallus] emb|CAA6...4370.1| olfactory receptor 4 [Gallus gallus] gb|AAW56070.1| olfactory receptor 4 [Gallus gallus] NP_001026714.1 6e-91 52% ...

  10. 39 CFR 602.2 - Office of Licensing, Philatelic and Retail Services Department.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Office of Licensing, Philatelic and Retail... OTHER THAN PATENTS § 602.2 Office of Licensing, Philatelic and Retail Services Department. In accordance with the foregoing policy, the Postal Service Office of Licensing, Philatelic and Retail Services...

  11. South African Journal of Animal Science - Vol 39, No 4 (2009)

    African Journals Online (AJOL)

    Genetic parameter estimates for tick resistance in Bonsmara cattle · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. M.A Budeli, K.A Nephawe, D Norris, N.W Selapa, L Bergh, A Maiwashe. http://dx.doi.org/10.4314/sajas.v39i4.51125 ...

  12. 75 FR 39208 - Termination of Foreign-Trade Subzone 39J Lewisville, TX

    Science.gov (United States)

    2010-07-08

    ... Foreign-Trade Zones Board Termination of Foreign-Trade Subzone 39J Lewisville, TX Pursuant to the authority granted in the Foreign-Trade Zones Act of June 18, 1934, as amended (19 U.S.C. 81a-81u), and the Foreign-Trade Zones Board Regulations (15 CFR part 400), the Foreign-Trade Zones Board has adopted the...

  13. 39 CFR 3020.13 - Contents of the Mail Classification Schedule.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Contents of the Mail Classification Schedule. 3020... Classification Schedule § 3020.13 Contents of the Mail Classification Schedule. The Mail Classification Schedule shall provide: (a) The list of market dominant products, including: (1) The class of each market...

  14. 42 CFR 414.39 - Special rules for payment of care plan oversight.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Special rules for payment of care plan oversight... HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM PAYMENT FOR PART B MEDICAL AND OTHER HEALTH SERVICES Physicians and Other Practitioners § 414.39 Special rules for payment of care plan oversight. (a) General...

  15. Calibrations of CR39 and Makrofol nuclear track detectors and search for exotic particles

    Science.gov (United States)

    Togo, V.

    2003-09-01

    We present the final results of the search for exotic massive particles in the cosmic radiation performed with the MACRO underground experiment. Magnetic monopoles and nuclearites flux upper limits obtained with the CR39 nuclear track subdetector, the scintillation and streamer tube subdetectors are given. Searches at high altitude with the SLIM experiment are in progress.

  16. STS-39 MS Veach monitors AFP-675 panel on OV-103's aft flight deck

    Science.gov (United States)

    1991-01-01

    STS-39 Mission Specialist (MS) Charles L. Veach analyzes data displayed on Air Force Program 675 (APF-675) command and monitor panel on the aft flight deck payload station aboard Discovery, Orbiter Vehicle (OV) 103. Just above Veach's head, Panel A3 closed circuit television (CCTV) screen A2 glows. At Veach's right is a portable laptop computer attached to panel L10.

  17. Adhesion Testing of Firebricks from Launch Pad 39A Flame Trench after STS-124

    Science.gov (United States)

    Hintze, Paul E.; Curran, Jerome P.

    2009-01-01

    Adhesion testing was performed on the firebricks in the flame trench of Launch Complex 39A to determine the strength of the epoxy/firebrick bond to the backing concrete wall. The testing used an Elcometer 110 pneumatic adhesion tensile testing instrument (PATTI).

  18. 1 KGS 3:9: Receiving and forming towards a listening heart | Cachia ...

    African Journals Online (AJOL)

    This reflection article studies the request made by King Solomon to God for “a listening heart” (1 Kgs 3:9) at the beginning of his reign. It shows that this request entails a deliberate and conscious openness of the whole person to God as well as an attentiveness to the demands of the people whom he is called to govern.

  19. 39 CFR 3010.2 - Types of rate adjustments for market dominant products.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Types of rate adjustments for market dominant... FOR MARKET DOMINANT PRODUCTS General Provisions § 3010.2 Types of rate adjustments for market dominant products. (a) There are four types of rate adjustments for market dominant products. A Type 1-A rate...

  20. 39 CFR 501.11 - Reporting Postage Evidencing System security weaknesses.

    Science.gov (United States)

    2010-07-01

    ... foreign postal administration(s). (2) All potential security weaknesses or methods of tampering with the... security breaches of the Computerized Meter Resetting System (CMRS) or databases housing confidential... 39 Postal Service 1 2010-07-01 2010-07-01 false Reporting Postage Evidencing System security...