East–West GEO Satellite Station-Keeping with Degraded Thruster Response
Directory of Open Access Journals (Sweden)
Stoian Borissov
2015-09-01
Full Text Available The higher harmonic terms of Earth’s gravitational potential slowly modify the nominal longitude of geostationary Earth orbit (GEO satellites, while the third-body presence (Moon and Sun mainly affects their latitude. For this reason, GEO satellites periodically need to perform station-keeping maneuvers, namely, east–west and north–south maneuvers to compensate for longitudinal and latitudinal variations, respectively. During the operational lifetime of GEO satellites, the thrusters’ response when commanded to perform these maneuvers slowly departs from the original nominal impulsive behavior. This paper addresses the practical problem of how to perform reliable east–west station-keeping maneuvers when thruster response is degraded. The need for contingency intervention from ground-based satellite operators is reduced by breaking apart the scheduled automatic station-keeping maneuvers into smaller maneuvers. Orbital alignment and attitude are tracked on-board during and in between sub-maneuvers, and any off nominal variations are corrected for with subsequent maneuvers. These corrections are particularly important near the end of the lifetime of GEO satellites, where thruster response is farthest from nominal performance.
Electric Propellant Solid Rocket Motor Thruster Results Enabling Small Satellites
Koehler, Frederick; Langhenry, Mark; Summers, Matt; Villarreal, James; Villarreal, Thomas
2017-01-01
Raytheon Missile Systems has developed and tested true on/off/restart solid propellant thrusters which are controlled only by electrical current. This new patented class of energetic rocket propellant is safe, controllable and simple. The range of applications for this game changing technology includes attitude control systems and a safe alternative to higher impulse space satellite thrusters. Described herein are descriptions and performance data for several small electric propellant solid r...
CASTOR: Cathode/Anode Satellite Thruster for Orbital Repositioning
Mruphy, Gloria A.
2010-01-01
The purpose of CASTOR (Cathode/Anode Satellite Thruster for Orbital Repositioning) satellite is to demonstrate in Low Earth Orbit (LEO) a nanosatellite that uses a Divergent Cusped Field Thruster (DCFT) to perform orbital maneuvers representative of an orbital transfer vehicle. Powered by semi-deployable solar arrays generating 165W of power, CASTOR will achieve nearly 1 km/s of velocity increment over one year. As a technology demonstration mission, success of CASTOR in LEO will pave the way for a low cost, high delta-V orbital transfer capability for small military and civilian payloads in support of Air Force and NASA missions. The educational objective is to engage graduate and undergraduate students in critical roles in the design, development, test, carrier integration and on-orbit operations of CASTOR as a supplement to their curricular activities. This program is laying the foundation for a long-term satellite construction program at MIT. The satellite is being designed as a part of AFRL's University Nanosatellite Program, which provides the funding and a framework in which student satellite teams compete for a launch to orbit. To this end, the satellite must fit within an envelope of 50cmx50cmx60cm, have a mass of less than 50kg, and meet stringent structural and other requirements. In this framework, the CASTOR team successfully completed PDR in August 2009 and CDR in April 2010 and will compete at FCR (Flight Competition Review) in January 2011. The complexity of the project requires implementation of many systems engineering techniques which allow for development of CASTOR from conception through FCR and encompass the full design, fabrication, and testing process.
Schneider, Steven J. (Inventor)
2001-01-01
A reduced toxicity fuel satellite propulsion system including a reduced toxicity propellant supply for consumption in an axial class thruster and an ACS class thruster. The system includes suitable valves and conduits for supplying the reduced toxicity propellant to the ACS decomposing element of an ACS thruster. The ACS decomposing element is operative to decompose the reduced toxicity propellant into hot propulsive gases. In addition the system includes suitable valves and conduits for supplying the reduced toxicity propellant to an axial decomposing element of the axial thruster. The axial decomposing element is operative to decompose the reduced toxicity propellant into hot gases. The system further includes suitable valves and conduits for supplying a second propellant to a combustion chamber of the axial thruster, whereby the hot gases and the second propellant auto-ignite and begin the combustion process for producing thrust.
Development of a green bipropellant hydrogen peroxide thruster for attitude control on satellites
Woschnak, A.; Krejci, D.; Schiebl, M.; Scharlemann, C.
2013-03-01
This document describes the selection assessment of propellants for a 1-newton green bipropellant thruster for attitude control on satellites. The development of this thruster was conducted as a part of the project GRASP (Green Advanced Space Propellants) within the European FP7 research program. The green propellant combinations hydrogen peroxide (highly concentrated with 87.5 %(wt.)) with kerosene or hydrogen peroxide (87.5 %(wt.)) with ethanol were identified as interesting candidates and were investigated in detail with the help of an experimental combustion chamber in the chemical propulsion laboratory at the Forschungsund Technologietransfer GmbH ― Fotec. Based on the test results, a final selection of propellants was performed.
Electrospray Thrusters for Attitude Control of a 1-U CubeSat
Timilsina, Navin
With a rapid increase in the interest in use of nanosatellites in the past decade, finding a precise and low-power-consuming attitude control system for these satellites has been a real challenge. In this thesis, it is intended to design and test an electrospray thruster system that could perform the attitude control of a 1-unit CubeSat. Firstly, an experimental setup is built to calculate the conductivity of different liquids that could be used as propellants for the CubeSat. Secondly, a Time-Of-Flight experiment is performed to find out the thrust and specific impulse given by these liquids and hence selecting the optimum propellant. On the other hand, a colloidal thruster system for a 1-U CubeSat is designed in Solidworks and fabricated using Lathe and CNC Milling Machine. Afterwards, passive propellant feeding is tested in this thruster system. Finally, the electronic circuit and wireless control system necessary to remotely control the CubeSat is designed and the final testing is performed. Among the propellants studied, Ethyl ammonium nitrate (EAN) was selected as the best propellant for the CubeSat. Theoretical design and fabrication of the thruster system was performed successfully and so was the passive propellant feeding test. The satellite was assembled for the final experiment but unfortunately the microcontroller broke down during the first test and no promising results were found out. However, after proving that one thruster works with passive feeding, it could be said that the ACS testing would have worked if we had performed vacuum compatibility tests for other components beforehand.
Diagnostics Systems for Permanent Hall Thrusters Development
Ferreira, Jose Leonardo; Soares Ferreira, Ivan; Santos, Jean; Miranda, Rodrigo; Possa, M. Gabriela
-Effect Thruster (PMHET), developed at the Plasma Physics Laboratory of UnB. The idea of using an array of permanent magnets, instead of an electromagnet, to produce a radial magnetic field inside the cylindrical plasma drift channel of the thruster is very attractive, especially because of the possibility of developing a HET with power consumption low enough to be used in small satellites or medium-size satellites with low on board power. Hall-Effect Thrusters are now a very good option for spacecraft primary propulsion and also for station-keeping of medium and large satellites. This is because of their high specific impulse, efficient use of propellant mass and combined low and precise thrust capabilities, which are related to an economy in terms of propellant mass utilization , longer satellite lifetime and easier spacecraft maneuvering in microgravity environment. The first HETs were developed in the mid 1950’s, and they were first called Closed Drift Thrusters. Today, the successful use of electric thrusters for attitude control and orbit modification on hundreds of satellites shows the advanced stage of development of this technology. In addition to this, after the success of space missions such as Deep Space One and Dawn (NASA), Hayabusa (JAXA) and Smart-1 (ESA), the employment of electric thrusters is also consolidated for the primary propulsion of spacecraft. This success is mainly due to three factors: reliability of this technology; efficiency of propellant utilization, and therefore reduction of the initial mass of the ship; possibility of operation over long time intervals, with practically unlimited cycling and restarts. This thrusting system is designed to be used in satellite attitude control and long term space missions. One of the greatest advantage of this kind of thruster is the production of a steady state magnetic field by permanent magnets providing electron trapping and Hall current generation within a significant decrease on the electric energy supply
Power processing systems for ion thrusters.
Herron, B. G.; Garth, D. R.; Finke, R. C.; Shumaker, H. A.
1972-01-01
The proposed use of ion thrusters to fulfill various communication satellite propulsion functions such as east-west and north-south stationkeeping, attitude control, station relocation and orbit raising, naturally leads to the requirement for lightweight, efficient and reliable thruster power processing systems. Collectively, the propulsion requirements dictate a wide range of thruster power levels and operational lifetimes, which must be matched by the power processing. This paper will discuss the status of such power processing systems, present system design alternatives and project expected near future power system performance.
Bi-Modal Micro-Cathode Arc Thruster for Cube Satellites
Chiu, Dereck
A new concept design, named the Bi-Modal Micro-Cathode Arc Thruster (BM-muCAT), has been introduced utilizing features from previous generations of muCATs and incorporating a multi-propellant functionality. This arc thruster is a micro-Newton level thruster based off of vacuum arc technology utilizing an enhanced magnetic field. Adjusting the magnetic field allows the thrusters performance to be varied. The goal of this thesis is to present a new generation of micro-cathode arc thrusters utilizing a bi-propellant, nickel and titanium, system. Three experimental procedures were run to test the new designs capabilities. Arc rotation experiment was used as a base experiment to ensure erosion was occurring uniformly along each electrode. Ion utilization efficiency was found, using an ion collector, to be up to 2% with the nickel material and 2.5% with the titanium material. Ion velocities were also studied using a time-of-flight method with an enhanced ion detection system. This system utilizes double electrostatic probes to measure plasma propagation. Ion velocities were measured to be 10km/s and 20km/s for nickel and titanium without a magnetic field. With an applied magnetic field of 0.2T, nickel ion velocities almost doubled to about 17km/s, while titanium ion velocities also increased to about 30km/s.
The Iodine Satellite (iSAT) Hall Thruster Demonstration Mission Concept and Development
Dankanich, John W.; Polzin, Kurt A.; Calvert, Derek; Kamhawi, Hani
2014-01-01
The use of iodine propellant for Hall thrusters has been studied and proposed by multiple organizations due to the potential mission benefits over xenon. In 2013, NASA Marshall Space Flight Center competitively selected a project for the maturation of an iodine flight operational feed system through the Technology Investment Program. Multiple partnerships and collaborations have allowed the team to expand the scope to include additional mission concept development and risk reduction to support a flight system demonstration, the iodine Satellite (iSAT). The iSAT project was initiated and is progressing towards a technology demonstration mission preliminary design review. The current status of the mission concept development and risk reduction efforts in support of this project is presented.
Trade Study of Multiple Thruster Options for the Mars Airplane Concept
Kuhl, Christopher A.; Gayle, Steven W.; Hunter, Craig A.; Kenney, Patrick S.; Scola, Salvatore; Paddock, David A.; Wright, Henry S.; Gasbarre, Joseph F.
2009-01-01
A trade study was performed at NASA Langley Research Center under the Planetary Airplane Risk Reduction (PARR) project (2004-2005) to examine the option of using multiple, smaller thrusters in place of a single large thruster on the Mars airplane concept with the goal to reduce overall cost, schedule, and technical risk. The 5-lbf (22N) thruster is a common reaction control thruster on many satellites. Thousands of these types of thrusters have been built and flown on numerous programs, including MILSTAR and Intelsat VI. This study has examined the use of three 22N thrusters for the Mars airplane propulsion system and compared the results to those of the baseline single thruster system.
Contamination Study of Micro Pulsed Plasma Thruster
National Research Council Canada - National Science Library
Kesenek, Ceylan
2008-01-01
.... Micro-Pulsed Plasma Thrusters (PPTs) are highly reliable and simple micro propulsion systems that will offer attitude control, station keeping, constellation flying, and drag compensation for such satellites...
Micro Cathode Arc Thruster for PhoneSat: Development and Potential Applications
Gazulla, Oriol Tintore; Perez, Andres Dono; Agasid, Elwood; Uribe, Eddie; Trinh, Greenfield; Keidar, Michael; Teel, George; Haque, Samudra; Lukas, Joseph; Salas, Alberto Guillen;
2014-01-01
NASA Ames Research Center and the George Washington University are developing an electric propulsion subsystem that will be integrated into the PhoneSat bus. Experimental tests have shown a reliable performance by firing three different thrusters at various frequencies in vacuum conditions. The interface consists of a microcontroller that sends a trigger pulse to the Pulsed Plasma Unit that is responsible for the thruster operation. A Smartphone is utilized as the main user interface for the selection of commands that control the entire system. The propellant, which is the cathode itself, is a solid cylinder made of Titanium. This simplicity in the design avoids miniaturization and manufacturing problems. The characteristics of this thruster allow an array of µCATs to perform attitude control and orbital correction maneuvers that will open the door for the implementation of an extensive collection of new mission concepts and space applications for CubeSats. NASA Ames is currently working on the integration of the system to fit the thrusters and the PPU inside a 1.5U CubeSat together with the PhoneSat bus. This satellite is intended to be deployed from the ISS in 2015 and test the functionality of the thrusters by spinning the satellite around its long axis and measure the rotational speed with the phone gyros. This test flight will raise the TRL of the propulsion system from 5 to 7 and will be a first test for further CubeSats with propulsion systems, a key subsystem for long duration or interplanetary small satellite missions.
Pocket rocket: An electrothermal plasma micro-thruster
Greig, Amelia Diane
Recently, an increase in use of micro-satellites constructed from commercial off the shelf (COTS) components has developed, to address the large costs associated with designing, testing and launching satellites. One particular type of micro-satellite of interest are CubeSats, which are modular 10 cm cubic satellites with total weight less than 1.33 kg. To assist with orbit boosting and attitude control of CubeSats, micro-propulsion systems are required, but are currently limited. A potential electrothermal plasma micro-thruster for use with CubeSats or other micro-satellites is under development at The Australian National University and forms the basis for this work. The thruster, known as ‘Pocket Rocket’, utilises neutral gas heating from ion-neutral collisions within a weakly ionised asymmetric plasma discharge, increasing the exhaust thermal velocity of the propellant gas, thereby producing higher thrust than if the propellant was emitted cold. In this work, neutral gas temperature of the Pocket Rocket discharge is studied in depth using rovibrational spectroscopy of the nitrogen (N2) second positive system (C3Πu → B3Πg), using both pure N2 and argon/N2 mixtures as the operating gas. Volume averaged steady state gas temperatures are measured for a range of operating conditions, with an analytical collisional model developed to verify experimental results. Results show that neutral gas heating is occurring with volume averaged steady state temperatures reaching 430 K in N2 and 1060 K for argon with 1% N2 at standard operating conditions of 1.5 Torr pressure and 10 W power input, demonstrating proof of concept for the Pocket Rocket thruster. Spatiotemporal profiles of gas temperature identify that the dominant heating mechanisms are ion-neutral collisions within the discharge and wall heating from ion bombardment of the thruster walls. To complement the experimental results, computational fluid dynamics (CFD) simulations using the commercial CFD
The physics, performance and predictions of the PEGASES ion-ion thruster
Aanesland, Ane
2014-10-01
Electric propulsion (EP) is now used systematically in space applications (due to the fuel and lifetime economy) to the extent that EP is now recognized as the next generation space technology. The uses of EP systems have though been limited to attitude control of GEO-stationary satellites and scientific missions. Now, the community envisages the use of EP for a variety of other applications as well; such as orbit transfer maneuvers, satellites in low altitudes, space debris removal, cube-sat control, challenging scientific missions close to and far from earth etc. For this we need a platform of EP systems providing much more variety in performance than what classical Hall and Gridded thrusters can provide alone. PEGASES is a gridded thruster that can be an alternative for some new applications in space, in particular for space debris removal. Unlike classical ion thrusters, here positive and negative ions are alternately accelerated to produce thrust. In this presentation we will look at the fundamental aspects of PEGASES. The emphasis will be put on our current understanding, obtained via analytical models, PIC simulations and experimental measurements, of the alternate extraction and acceleration process. We show that at low grid bias frequencies (10 s of kHz), the system can be described as a sequence of negative and positive ions accelerated as packets within a classical DC mode. Here secondary electrons created in the downstream chamber play an important role in the beam space charge compensation. At higher frequencies (100 s of kHz) the transit time of the ions in the grid gap becomes comparable to the bias period, leading to an ``AC acceleration mode.'' Here the beam is fully space charge compensated and the ion energy and current are functions of the applied frequency and waveform. A generalization of the Child-Langmuir space charge limited law is developed for pulsed voltages and allows evaluating the optimal parameter space and performance of PEGASES
Multi-Axis Thrust Measurements of the EO-1 Pulsed Plasma Thruster
Arrington, Lynn A.; Haag, Thomas W.
1999-01-01
Pulsed plasma thrusters are low thrust propulsive devices which have a high specific impulse at low power. A pulsed plasma thruster is currently scheduled to fly as an experiment on NASA's Earth Observing-1 satellite mission. The pulsed plasma thruster will be used to replace one of the reaction wheels. As part of the qualification testing of the thruster it is necessary to determine the nominal thrust as a function of charge energy. These data will be used to determine control algorithms. Testing was first completed on a breadboard pulsed plasma thruster to determine nominal or primary axis thrust and associated propellant mass consumption as a function of energy and then later to determine if any significant off-axis thrust component existed. On conclusion that there was a significant off-axis thrust component with the bread-board in the direction of the anode electrode, the test matrix was expanded on the flight hardware to include thrust measurements along all three orthogonal axes. Similar off-axis components were found with the flight unit.
Particle-in-cell simulations of Hall plasma thrusters
Miranda, Rodrigo; Ferreira, Jose Leonardo; Martins, Alexandre
2016-07-01
Hall plasma thrusters can be modelled using particle-in-cell (PIC) simulations. In these simulations, the plasma is described by a set of equations which represent a coupled system of charged particles and electromagnetic fields. The fields are computed using a spatial grid (i.e., a discretization in space), whereas the particles can move continuously in space. Briefly, the particle and fields dynamics are computed as follows. First, forces due to electric and magnetic fields are employed to calculate the velocities and positions of particles. Next, the velocities and positions of particles are used to compute the charge and current densities at discrete positions in space. Finally, these densities are used to solve the electromagnetic field equations in the grid, which are interpolated at the position of the particles to obtain the acting forces, and restart this cycle. We will present numerical simulations using software for PIC simulations to study turbulence, wave and instabilities that arise in Hall plasma thrusters. We have sucessfully reproduced a numerical simulation of a SPT-100 Hall thruster using a two-dimensional (2D) model. In addition, we are developing a 2D model of a cylindrical Hall thruster. The results of these simulations will contribute to improve the performance of plasma thrusters to be used in Cubesats satellites currenty in development at the Plasma Laboratory at University of Brasília.
Continuous Wheel Momentum Dumping Using Magnetic Torquers and Thrusters
Oh, Hwa-Suk; Choi, Wan-Sik; Eun, Jong-Won
1996-12-01
Two momentum management schemes using magnetic torquers and thrusters are sug-gested. The stability of the momentum dumping logic is proved at a general attitude equilibrium. Both momentum dumping control laws are implemented with Pulse-Width- Pulse-Frequency Modulated on-off control, and shown working equally well with the original continuous and variable strength control law. Thrusters are assummed to be asymmetrically configured as a contingency case. Each thruster is fired following separated control laws rather than paired thrusting. Null torque thrusting control is added on the thrust control calculated from the momentum control law for the gener-ation of positive thrusting force. Both magnetic and thrusting control laws guarantee the momentum dumping, however, the wheel inner loop control is needed for the "wheel speed" dumping, The control laws are simulated on the KOrea Multi-Purpose SATellite (KOMPSAT) model.
Tavakoli, M. M.; Assadian, N.
2018-03-01
The problem of controlling an all-thruster spacecraft in the coupled translational-rotational motion in presence of actuators fault and/or failure is investigated in this paper. The nonlinear model predictive control approach is used because of its ability to predict the future behavior of the system. The fault/failure of the thrusters changes the mapping between the commanded forces to the thrusters and actual force/torque generated by the thruster system. Thus, the basic six degree-of-freedom kinetic equations are separated from this mapping and a set of neural networks are trained off-line to learn the kinetic equations. Then, two neural networks are attached to these trained networks in order to learn the thruster commands to force/torque mappings on-line. Different off-nominal conditions are modeled so that neural networks can detect any failure and fault, including scale factor and misalignment of thrusters. A simple model of the spacecraft relative motion is used in MPC to decrease the computational burden. However, a precise model by the means of orbit propagation including different types of perturbation is utilized to evaluate the usefulness of the proposed approach in actual conditions. The numerical simulation shows that this method can successfully control the all-thruster spacecraft with ON-OFF thrusters in different combinations of thruster fault and/or failure.
Vacuum Chamber Construction and Contamination Study of A Micro Pulsed Plasma Thruster
National Research Council Canada - National Science Library
Debevec, Jacob H
2006-01-01
.... This study examines the deposition profile and rate of particle emission from the thruster so that satellite designers understand any potential contamination issues with sensitive instruments and solar panels...
Colloid Thruster for Attitude Control Systems (ACS) and Tip-off Control Applications, Phase II
National Aeronautics and Space Administration — Busek proposes to develop and deliver a complete engineering model colloid thruster system, capable of thrust levels and lifetimes required for spacecraft...
Pickens, Tim
2012-01-01
An oxygen-methane thruster was conceived with integrated igniter/injector capable of nominal operation on either gaseous or liquid propellants. The thruster was designed to develop 100 lbf (approximately 445 N) thrust at vacuum conditions and use oxygen and methane as propellants. This continued development included refining the design of the thruster to minimize part count and manufacturing difficulties/cost, refining the modeling tools and capabilities that support system design and analysis, demonstrating the performance of the igniter and full thruster assembly with both gaseous and liquid propellants, and acquiring data from this testing in order to verify the design and operational parameters of the thruster. Thruster testing was conducted with gaseous propellants used for the igniter and thruster. The thruster was demonstrated to work with all types of propellant conditions, and provided the desired performance. Both the thruster and igniter were tested, as well as gaseous propellants, and found to provide the desired performance using the various propellant conditions. The engine also served as an injector testbed for MSFC-designed refractory combustion chambers made of rhenium.
Bogorad, A.; Lichtin, D. A.; Bowman, C.; Armenti, J.; Pencil, E.; Sarmiento, C.
1992-01-01
Arcjet thrusters are soon to be used for north/south stationkeeping on commercial communications satellites. A series of tests was performed to evaluate the possible effects of these thrusters on spacecraft charging and the degradation of thermal control material. During the tests the interaction between arcjet plumes and both charged and uncharged surfaces did not cause any significant material degradation. In addition, firing an arcjet thruster benignly reduced the potential of charged surfaces to near zero.
1000 Hours of Testing Completed on 10-kW Hall Thruster
Mason, Lee S.
2001-01-01
Between the months of April and August 2000, a 10-kW Hall effect thruster, designated T- 220, was subjected to a 1000-hr life test evaluation. Hall effect thrusters are propulsion devices that electrostatically accelerate xenon ions to produce thrust. Hall effect propulsion has been in development for many years, and low-power devices (1.35 kW) have been used in space for satellite orbit maintenance. The T-220, shown in the photo, produces sufficient thrust to enable efficient orbital transfers, saving hundreds of kilograms in propellant over conventional chemical propulsion systems. This test is the longest operation ever achieved on a high-power Hall thruster (greater than 4.5 kW) and is a key milestone leading to the use of this technology for future NASA, commercial, and military missions.
Density and velocity measurements of a sheath plasma from MPD thruster
Energy Technology Data Exchange (ETDEWEB)
Ko, J.J.; Cho, T.S.; Choi, M.C.; Choi, E.H.; Cho, G.S.; Uhm, H.S.
1999-07-01
Magnetoplasma is the plasma that the electron and ion orbits are strongly confined by intense magnetic field. Recently, magnetoplasma dynamics (MPD) has been investigated in connection with applications to the rocket thruster in USA, Germany, etc. It can be widely applicable, including modification of satellite position and propulsion of the interplanetary space shuttle. A travel for a long distance journey is possible because a little amount of neutral gases is needed for the plasma source. Besides, this will provide a pollution free engine for future generations. MPD thruster is not a chemical engine. The authors have built a Mather type MPD thruster, which has 1 kV max charging, 10 kA max current flows, and has about 1 ms characteristic operation time. The Paschen curve of this thruster is measured and its minimum breakdown voltage occurs in the pressure range of 0.1 to 1 Torr. Langmuir and double probes are fabricated to diagnose the sheath plasma from the thruster. The temperature and density are calculated to be 2.5 eV and 10{sup 15} cm {sup {minus}3}, respectively, from the probe data. Making use of photo diode, an optical probe is fabricated to measure propagation velocity of the sheath plasma. The sheath plasma from the MPD thruster in the experiment propagates with velocity of 1 cm/{micro}s.
Rarefied gas electro jet (RGEJ) micro-thruster for space propulsion
Blanco, Ariel; Roy, Subrata
2017-11-01
This article numerically investigates a micro-thruster for small satellites which utilizes plasma actuators to heat and accelerate the flow in a micro-channel with rarefied gas in the slip flow regime. The inlet plenum condition is considered at 1 Torr with flow discharging to near vacuum conditions (consumption and the thrust effectiveness of the thruster are predicted based on these results. The ionized gas is modelled using local mean energy approximation. An electrically induced body force and a thermal heating source are calculated based on the space separated charge distribution and the ion Joule heating, respectively. The rarefied gas flow with these electric force and heating source is modelled using density-based compressible flow equations with slip flow boundary conditions. The results show that a significant improvement of specific impulse can be achieved over highly optimized cold gas thrusters using the same propellant.
Mason, Lee; Birchenough, Arthur; Pinero, Luis
2004-01-01
A 2 kW Brayton Power Conversion Unit (PCU) and a xenon ion thruster were integrated with a Power Management and Distribution (PMAD) system as part of a Nuclear Electric Propulsion (NEP) Testbed at NASA's Glenn Research Center. Brayton converters and ion thrusters are potential candidates for use on future high power NEP missions such as the proposed Jupiter Icy Moons Orbiter (JIMO). The use of existing lower power test hardware provided a cost-effective means to investigate the critical electrical interface between the power conversion system and ion propulsion system. The testing successfully demonstrated compatible electrical operations between the converter and the thruster, including end-to-end electric power throughput, high efficiency AC to DC conversion, and thruster recycle fault protection. The details of this demonstration are reported herein.
Hervol, David; Mason, Lee; Birchenough, Art; Pinero, Luis
2004-01-01
A 2kW Brayton Power Conversion Unit (PCU) and a xenon ion thruster were integrated with a Power Management and Distribution (PMAD) system as part of a Nuclear Electric Propulsion (NEP) Testbed at NASA's Glenn Research Center. Brayton Converters and ion thrusters are potential candidates for use on future high power NEP mission such as the proposed Jupiter Icy Moons Orbiter (JIMO). The use of a existing lower power test hardware provided a cost effective means to investigate the critical electrical interface between the power conversion system and the propulsion system. The testing successfully demonstrated compatible electrical operations between the converter and the thruster, including end-to-end electric power throughput, high efficiency AC to DC conversion, and thruster recycle fault protection. The details of this demonstration are reported herein.
Karadag, Burak; Cho, Shinatora; Funaki, Ikkoh
2018-04-01
It is quite a challenge to design low power Hall thrusters with a long lifetime and high efficiency because of the large surface area to volume ratio and physical limits to the magnetic circuit miniaturization. As a potential solution to this problem, we experimentally investigated the external discharge plasma thruster (XPT). The XPT produces and sustains a plasma discharge completely in the open space outside of the thruster structure through a magnetic mirror configuration. It eliminates the very fundamental component of Hall thrusters, discharge channel side walls, and its magnetic circuit consists solely of a pair of hollow cylindrical permanent magnets. Thrust, low frequency discharge current oscillation, ion beam current, and plasma property measurements were conducted to characterize the manufactured prototype thruster for the proof of concept. The thrust performance, propellant ionization, and thruster erosion were discussed. Thrust generated by the XPT was on par with conventional Hall thrusters [stationary plasma thruster (SPT) or thruster with anode layer] at the same power level (˜11 mN at 250 W with 25% anode efficiency without any optimization), and discharge current had SPT-level stability (Δ design and provide a successful proof of concept experiment of the XPT.
Flight demonstration of new thruster and green propellant technology on the PRISMA satellite
Anflo, K.; Möllerberg, R.
2009-11-01
The concept of a storable liquid monopropellant blend for space applications based on ammonium dinitramide (ADN) was invented in 1997, within a co-operation between the Swedish Space Corporation (SSC) and the Swedish Defense Research Agency (FOI). The objective was to develop a propellant which has higher performance and is safer than hydrazine. The work has been performed under contract from the Swedish National Space Board and ESA. The progress of the development has been presented in several papers since 2000. ECAPS, a subsidiary of the Swedish Space Corporation was established in 2000 with the aim to develop and market the novel "high performance green propellant" (HPGP) technology for space applications. The new technology is based on several innovations and patents w.r.t. propellant formulation and thruster design, including a high temperature resistant catalyst and thrust chamber. The first flight demonstration of the HPGP propulsion system will be performed on PRISMA. PRISMA is an international technology demonstration program with Swedish Space Corporation as the Prime Contractor. This paper describes the performance, characteristics, design and verification of the HPGP propulsion system for PRISMA. Compatibility issues related to using a new propellant with COTS components is also discussed. The PRISMA mission includes two satellites in LEO orbit were the focus is on rendezvous and formation flying. One of the satellites will act as a "target" and the main spacecraft performs rendezvous and formation flying maneuvers, where the ECAPS HPGP propulsion system will provide delta-V capability. The PRISMA CDR was held in January 2007. Integration of the flight propulsion system is about to be finalized. The flight opportunity on PRISMA represents a unique opportunity to demonstrate the HPGP propulsion system in space, and thus take a significant step towards its use in future space applications. The launch of PRISMA scheduled to 2009.
15 cm mercury multipole thruster
Longhurst, G. R.; Wilbur, P. J.
1978-01-01
A 15 cm multipole ion thruster was adapted for use with mercury propellant. During the optimization process three separable functions of magnetic fields within the discharge chamber were identified: (1) they define the region where the bulk of ionization takes place, (2) they influence the magnitudes and gradients in plasma properties in this region, and (3) they control impedance between the cathode and main discharge plasmas in hollow cathode thrusters. The mechanisms for these functions are discussed. Data from SERT II and cusped magnetic field thrusters are compared with those measured in the multipole thruster. The performance of this thruster is shown to be similar to that of the other two thrusters. Means of achieving further improvement in the performance of the multipole thruster are suggested.
Ion thruster design and analysis
Kami, S.; Schnelker, D. E.
1976-01-01
Questions concerning the mechanical design of a thruster are considered, taking into account differences in the design of an 8-cm and a 30-cm model. The components of a thruster include the thruster shell assembly, the ion extraction electrode assembly, the cathode isolator vaporizer assembly, the neutralizer isolator vaporizer assembly, ground screen and mask, and the main isolator vaporizer assembly. Attention is given to the materials used in thruster fabrication, the advanced manufacturing methods used, details of thruster performance, an evaluation of thruster life, structural and thermal design considerations, and questions of reliability and quality assurance.
Electronegative Gas Thruster - Direct Thrust Measurement Project
Dankanich, John (Principal Investigator); Aanesland, Ane; Polzin, Kurt; Walker, Mitchell
2015-01-01
This effort is an international collaboration and academic partnership to mature an innovative electric propulsion (EP) thruster concept to TRL 3 through direct thrust measurement. The initial target application is for Small Satellites, but can be extended to higher power. The Plasma propulsion with Electronegative GASES (PEGASES) concept simplifies ion thruster operation, eliminates a neutralizer requirement and should yield longer life capabilities and lower cost implementation over conventional gridded ion engines. The basic proof-of concept has been demonstrated and matured to TRL 2 over the past several years by researchers at the Laboratoire de Physique des Plasma in France. Due to the low maturity of the innovation, there are currently no domestic investments in electronegative gas thrusters anywhere within NASA, industry or academia. The end product of this Center Innovation Fund (CIF) project will be a validation of the proof-of-concept, maturation to TRL 3 and technology assessment report to summarize the potential for the PEGASES concept to supplant the incumbent technology. Information exchange with the foreign national will be one-way with the exception of the test results. Those test results will first go through a standard public release ITAR/export control review, and the results will be presented in a public technical forum, and the results will be presented in a public technical forum.
Szabo, James
2015-01-01
Iodine enables dramatic mass and cost savings for lunar and Mars cargo missions, including Earth escape and near-Earth space maneuvers. The demonstrated throttling ability of iodine is important for a singular thruster that might be called upon to propel a spacecraft from Earth to Mars or Venus. The ability to throttle efficiently is even more important for missions beyond Mars. In the Phase I project, Busek Company, Inc., tested an existing Hall thruster, the BHT-8000, on iodine propellant. The thruster was fed by a high-flow iodine feed system and supported by an existing Busek hollow cathode flowing xenon gas. The Phase I propellant feed system was evolved from a previously demonstrated laboratory feed system. Throttling of the thruster between 2 and 11 kW at 200 to 600 V was demonstrated. Testing showed that the efficiency of iodine fueled BHT-8000 is the same as with xenon, with iodine delivering a slightly higher thrust-to-power (T/P) ratio. In Phase II, a complete iodine-fueled system was developed, including the thruster, hollow cathode, and iodine propellant feed system. The nominal power of the Phase II system is 8 kW; however, it can be deeply throttled as well as clustered to much higher power levels. The technology also can be scaled to greater than 100 kW per thruster to support megawatt-class missions. The target thruster efficiency for the full-scale system is 65 percent at high specific impulse (Isp) (approximately 3,000 s) and 60 percent at high thrust (Isp approximately 2,000 s).
Iodine Hall Thruster Propellant Feed System for a CubeSat
Polzin, Kurt A.
2014-01-01
There has been significant work recently in the development of iodine-fed Hall thrusters for in-space propulsion applications.1 The use of iodine as a propellant provides many advantages over present xenon-gas-fed Hall thruster systems. Iodine is a solid at ambient temperature (no pressurization required) and has no special handling requirements, making it safe for secondary flight opportunities. It has exceptionally high ?I sp (density times specific impulse), making it an enabling technology for small satellite near-term applications and providing system level advantages over mid-term high power electric propulsion options. Iodine provides thrust and efficiency that are comparable to xenonfed Hall thrusters while operating in the same discharge current and voltage regime, making it possible to leverage the development of flight-qualified xenon Hall thruster power processing units for the iodine application. Work at MSFC is presently aimed at designing, integrating, and demonstrating a flight-like iodine feed system suitable for the Hall thruster application. This effort represents a significant advancement in state-of-the-art. Though Iodine thrusters have demonstrated high performance with mission enabling potential, a flight-like feed system has never been demonstrated and iodine compatible components do not yet exist. Presented in this paper is the end-to-end integrated feed system demonstration. The system includes a propellant tank with active feedback-control heating, fill and drain interfaces, latching and proportional flow control valves (PFCV), flow resistors, and flight-like CubeSat power and control electronics. Hardware is integrated into a CubeSat-sized structure, calibrated and tested under vacuum conditions, and operated under under hot-fire conditions using a Busek BHT-200 thruster designed for iodine. Performance of the system is evaluated thorugh accurate measurement of thrust and a calibrated of mass flow rate measurement, which is a function of
Plasma propulsion for geostationary satellites for telecommunication and interplanetary missions
International Nuclear Information System (INIS)
Dudeck, M; Doveil, F; Arcis, N; Zurbach, S
2012-01-01
The advantages of electric propulsion for the orbit maintenance of geostationary satellites for telecommunications are described. Different types of plasma sources for space propulsion are presented. Due to its large performances, one of them, named Hall effect thruster is described in detail and two recent missions in space (Stentor and Smart1) using French Hall thrusters are briefly presented.
The Power Supply And Control Unit For The HEMP Thruster
Brag, Rafael; Lenz, Werner; Huther, Andreas; Herty, Frank
2011-10-01
In the recent years, Astrium GmbH started to develop electronics to control and supply Electric Propulsion systems or corresponding components. One of the developments is a Power Supply and Control Unit (PSCU) for the Thales Electron Devices development "High Efficiency Multistage Plasma Thruster" (HEMP- T). The PSCU is developed, manufactured and tested on the Astrium southern Germany site in Friedrichshafen. The first application is the SGEO Satellite (HISPASAT- 1), where the In-Orbit Demonstration (IOD) of the HEMP Thruster system will prove the success of the product. Astrium conducted several coupling tests during the PSCU development especially concentrated on *Thruster electrical I/F parameters *Neutralizer electrical I/F parameters *Flow Control I/F parameters Results of these tests were used to refine the specification and adapt the PSCU drivers and control algorithms. Furthermore, the tests results gave Thales and Astrium the possibility for a deep understanding of the interaction between the physics and the electronics. The paper presents an overview of the PSCU topology, key features, technical and development logic details as well as a view into the control capabilities of the PSCU.
Advanced laboratory for testing plasma thrusters and Hall thruster measurement campaign
Directory of Open Access Journals (Sweden)
Szelecka Agnieszka
2016-06-01
Full Text Available Plasma engines are used for space propulsion as an alternative to chemical thrusters. Due to the high exhaust velocity of the propellant, they are more efficient for long-distance interplanetary space missions than their conventional counterparts. An advanced laboratory of plasma space propulsion (PlaNS at the Institute of Plasma Physics and Laser Microfusion (IPPLM specializes in designing and testing various electric propulsion devices. Inside of a special vacuum chamber with three performance pumps, an environment similar to the one that prevails in space is created. An innovative Micro Pulsed Plasma Thruster (LμPPT with liquid propellant was built at the laboratory. Now it is used to test the second prototype of Hall effect thruster (HET operating on krypton propellant. Meantime, an improved prototype of krypton Hall thruster is constructed.
Rarefied gas electro jet (RGEJ) micro-thruster for space propulsion
International Nuclear Information System (INIS)
Blanco, Ariel; Roy, Subrata
2017-01-01
This article numerically investigates a micro-thruster for small satellites which utilizes plasma actuators to heat and accelerate the flow in a micro-channel with rarefied gas in the slip flow regime. The inlet plenum condition is considered at 1 Torr with flow discharging to near vacuum conditions (<0.05 Torr). The Knudsen numbers at the inlet and exit planes are ∼0.01 and ∼0.1, respectively. Although several studies have been performed in micro-hallow cathode discharges at constant pressure, to our knowledge, an integrated study of the glow discharge physics and resulting fluid flow of a plasma thruster under these low pressure and low Knudsen number conditions is yet to be reported. Numerical simulations of the charge distribution due to gas ionization processes and the resulting rarefied gas flow are performed using an in-house code. The mass flow rate, thrust, specific impulse, power consumption and the thrust effectiveness of the thruster are predicted based on these results. The ionized gas is modelled using local mean energy approximation. An electrically induced body force and a thermal heating source are calculated based on the space separated charge distribution and the ion Joule heating, respectively. The rarefied gas flow with these electric force and heating source is modelled using density-based compressible flow equations with slip flow boundary conditions. The results show that a significant improvement of specific impulse can be achieved over highly optimized cold gas thrusters using the same propellant. (paper)
Satellite Integration of a PhoneSat-EDSN Bus with a Micro Cathode Arc Thruster
National Aeronautics and Space Administration — NASA Ames Research Center and GWU are investigating applications of Micro-Cathode Arc Thrusters (μCAT) sub-systems for attitude and orbit correction of a PhoneSat...
Optimization of Cylindrical Hall Thrusters
International Nuclear Information System (INIS)
Raitses, Yevgeny; Smirnov, Artem; Granstedt, Erik; Fisch, Nathaniel J.
2007-01-01
The cylindrical Hall thruster features high ionization efficiency, quiet operation, and ion acceleration in a large volume-to-surface ratio channel with performance comparable with the state-of-the-art annular Hall thrusters. These characteristics were demonstrated in low and medium power ranges. Optimization of miniaturized cylindrical thrusters led to performance improvements in the 50-200W input power range, including plume narrowing, increased thruster efficiency, reliable discharge initiation, and stable operation.
Optimization of Cylindrical Hall Thrusters
International Nuclear Information System (INIS)
Raitses, Yevgeny; Smirnov, Artem; Granstedt, Erik; Fi, Nathaniel J.
2007-01-01
The cylindrical Hall thruster features high ionization efficiency, quiet operation, and ion acceleration in a large volume-to-surface ratio channel with performance comparable with the state-of-the-art annular Hall thrusters. These characteristics were demonstrated in low and medium power ranges. Optimization of miniaturized cylindrical thrusters led to performance improvements in the 50-200W input power range, including plume narrowing, increased thruster efficiency, reliable discharge initiation, and stable operation
Real time hardware-in-loop simulation of ESMO satellite attitude control system
Directory of Open Access Journals (Sweden)
Rune Finnset
2006-04-01
Full Text Available This paper studies attitude control of the ESMO satellite using six reaction thrusters. Bang-bang control with dead-zone and Pulse-Width Modulation (PWM for the modulation of the on-time of the thrusters are treated. Closed loop hardware-in-loop simulations, using themicrocontroller unit (MCU Microchip PIC18F452 for implementation of attitude control and MatLab in a standard PC for simulating satellite dynamics, are carried out. Results for real time simulation are compared with autonomous simulations. The controller gives a satisfactory performance in the real time environment.
Cylindrical Hall Thrusters with Permanent Magnets
International Nuclear Information System (INIS)
Raitses, Yevgeny; Merino, Enrique; Fisch, Nathaniel J.
2010-01-01
The use of permanent magnets instead of electromagnet coils for low power Hall thrusters can offer a significant reduction of both the total electric power consumption and the thruster mass. Two permanent magnet versions of the miniaturized cylindrical Hall thruster (CHT) of different overall dimensions were operated in the power range of 50W-300 W. The discharge and plasma plume measurements revealed that the CHT thrusters with permanent magnets and electromagnet coils operate rather differently. In particular, the angular ion current density distribution from the permanent magnet thrusters has an unusual halo shape, with a majority of high energy ions flowing at large angles with respect to the thruster centerline. Differences in the magnetic field topology outside the thruster channel and in the vicinity of the channel exit are likely responsible for the differences in the plume characteristics measured for the CHTs with electromagnets and permanent magnets. It is shown that the presence of the reversing-direction or cusp-type magnetic field configuration inside the thruster channel without a strong axial magnetic field outside the thruster channel does not lead to the halo plasma plume from the CHT.
HG ion thruster component testing
Mantenieks, M. A.
1979-01-01
Cathodes, isolators, and vaporizers are critical components in determining the performance and lifetime of mercury ion thrusters. The results of life tests of several of these components are reported. A 30-cm thruster CIV test in a bell jar has successfully accumulated over 26,000 hours. The cathode has undergone 65 restarts during the life test without requiring any appreciable increases in starting power. Recently, all restarts have been achieved with only the 44 volt keeper supply with no change required in the starting power. Another ongoing 30-cm Hg thruster cathode test has successfully passed the 10,000 hour mark. A solid-insert, 8-cm thruster cathode has accumulated over 4,000 hours of thruster operation. All starts have been achieved without the use of a high voltage ignitor. The results of this test indicate that the solid impregnated insert is a viable neutralizer cathode for the 8-cm thruster.
Szabo, James J.
2015-01-01
This Phase II project is developing a magnesium (Mg) Hall effect thruster system that would open the door for in situ resource utilization (ISRU)-based solar system exploration. Magnesium is light and easy to ionize. For a Mars- Earth transfer, the propellant mass savings with respect to a xenon Hall effect thruster (HET) system are enormous. Magnesium also can be combusted in a rocket with carbon dioxide (CO2) or water (H2O), enabling a multimode propulsion system with propellant sharing and ISRU. In the near term, CO2 and H2O would be collected in situ on Mars or the moon. In the far term, Mg itself would be collected from Martian and lunar regolith. In Phase I, an integrated, medium-power (1- to 3-kW) Mg HET system was developed and tested. Controlled, steady operation at constant voltage and power was demonstrated. Preliminary measurements indicate a specific impulse (Isp) greater than 4,000 s was achieved at a discharge potential of 400 V. The feasibility of delivering fluidized Mg powder to a medium- or high-power thruster also was demonstrated. Phase II of the project evaluated the performance of an integrated, highpower Mg Hall thruster system in a relevant space environment. Researchers improved the medium power thruster system and characterized it in detail. Researchers also designed and built a high-power (8- to 20-kW) Mg HET. A fluidized powder feed system supporting the high-power thruster was built and delivered to Busek Company, Inc.
Enhanced Performance of Cylindrical Hall Thrusters
International Nuclear Information System (INIS)
Raitses, Y.; Smirnov, A.; Fisch, N.J.
2007-01-01
The cylindrical thruster differs significantly in its underlying physical mechanisms from the conventional annular Hall thruster. It features high ionization efficiency, quiet operation, ion acceleration in a large volume-to-surface ratio channel, and performance comparable with the state-of-the-art conventional Hall thrusters. Very significant plume narrowing, accompanied by the increase of the energetic ion fraction and improvement of ion focusing, led to 50-60% increase of the thruster anode efficiency. These improvements were achieved by overrunning the discharge current in the magnetized thruster plasma
International Nuclear Information System (INIS)
Perche, G.E.
1983-07-01
The mercury bombardment electrostatic ion thruster is the most successful electric thruster available today. This work describes a 5 cm diameter ion thruster with 3.000 s specific impulse and 5 mN thrust. The advantages of electric propulsion and the tests that will be performed are also presented. (Author) [pt
Chen, Jun; Li, Guoxiu; Zhang, Tao; Wang, Meng; Yu, Yusong
2016-12-01
Low toxicity ammonium dinitramide (ADN)-based aerospace propulsion systems currently show promise with regard to applications such as controlling satellite attitude. In the present work, the decomposition and combustion processes of an ADN-based monopropellant thruster were systematically studied, using a thermally stable catalyst to promote the decomposition reaction. The performance of the ADN propulsion system was investigated using a ground test system under vacuum, and the physical properties of the ADN-based propellant were also examined. Using this system, the effects of the preheating temperature and feed pressure on the combustion characteristics and thruster performance during steady state operation were observed. The results indicate that the propellant and catalyst employed during this work, as well as the design and manufacture of the thruster, met performance requirements. Moreover, the 1 N ADN thruster generated a specific impulse of 223 s, demonstrating the efficacy of the new catalyst. The thruster operational parameters (specifically, the preheating temperature and feed pressure) were found to have a significant effect on the decomposition and combustion processes within the thruster, and the performance of the thruster was demonstrated to improve at higher feed pressures and elevated preheating temperatures. A lower temperature of 140 °C was determined to activate the catalytic decomposition and combustion processes more effectively compared with the results obtained using other conditions. The data obtained in this study should be beneficial to future systematic and in-depth investigations of the combustion mechanism and characteristics within an ADN thruster.
National Aeronautics and Space Administration — Objective is to design an electrostatic ion thruster that is more efficient, simpler, and lower cost than the current gridded ion thruster. Initial objective is to...
Effects of thruster firings on the shuttle's plasma and electric field environment
International Nuclear Information System (INIS)
Machuzak, J.S.; Burke, W.J.; Retterer, J.M.; Hunton, D.E.; Jasperse, J.R.; Smiddy, M.
1993-01-01
Simultaneous plasma and AC/DC electric field measurements taken during the space shuttle mission STS-4 at times of prolonged thruster firings are analyzed and cross correlated. Depending on the orientation of the shuttle's velocity vector to the magnetic field, ion densities and electric field wave spectra were enhanced or decreased. The systematic picture of interactions within the shuttle's plasma/neutral gas environment of Cairns and Gurnett (1991b) is confirmed and extended. Waves are excited by outgassed and thruster-ejected molecules that ionize in close proximity to the shuttle. On time scales significantly less than an ion gyroperiod, the newly created ions act as beams in the background plasma. These beams are sources of VLF waves that propagate near the shuttle and intensify during thruster firings. Plasma density depletions and/or the shuttle's geometry may hinder wave detection in the payload bay. A modified two-stream analysis indicates that beam components propagating at large angles to the magnetic field are unstable to the growth of lower hybrid waves. The beam-excited, lower hybrid waves heat some electrons to sufficient energies to produce impact ionization. Empirical evidence for other wave-growth mechanisms outside the lower-hybrid band is presented. 42 refs., 15 figs., 3 tabs
Herman, Daniel A.
2010-01-01
The NASA s Evolutionary Xenon Thruster (NEXT) program is tasked with significantly improving and extending the capabilities of current state-of-the-art NSTAR thruster. The service life capability of the NEXT ion thruster is being assessed by thruster wear test and life-modeling of critical thruster components, such as the ion optics and cathodes. The NEXT Long-Duration Test (LDT) was initiated to validate and qualify the NEXT thruster propellant throughput capability. The NEXT thruster completed the primary goal of the LDT; namely to demonstrate the project qualification throughput of 450 kg by the end of calendar year 2009. The NEXT LDT has demonstrated 28,500 hr of operation and processed 466 kg of xenon throughput--more than double the throughput demonstrated by the NSTAR flight-spare. Thruster performance changes have been consistent with a priori predictions. Thruster erosion has been minimal and consistent with the thruster service life assessment, which predicts the first failure mode at greater than 750 kg throughput. The life-limiting failure mode for NEXT is predicted to be loss of structural integrity of the accelerator grid due to erosion by charge-exchange ions.
Satellite Hardware: Stow-and-Go for Space Travel
Pellegrino, Sergio
2012-01-01
Man-made satellites have to fit a lot into a compact package. Protected inside a rocket while blasted through the atmosphere, a satellite is launched into Earth orbit, or beyond, to continue its unmanned mission alone. It uses gyroscopes, altitude thrusters, and magnets to regulate sun exposure and stay pointed in the right direction. Once stable, the satellite depends on solar panels to recharge its internal batteries, mirrors, and lenses for data capture, and antennas for communication back...
A Small Modular Laboratory Hall Effect Thruster
Lee, Ty Davis
Electric propulsion technologies promise to revolutionize access to space, opening the door for mission concepts unfeasible by traditional propulsion methods alone. The Hall effect thruster is a relatively high thrust, moderate specific impulse electric propulsion device that belongs to the class of electrostatic thrusters. Hall effect thrusters benefit from an extensive flight history, and offer significant performance and cost advantages when compared to other forms of electric propulsion. Ongoing research on these devices includes the investigation of mechanisms that tend to decrease overall thruster efficiency, as well as the development of new techniques to extend operational lifetimes. This thesis is primarily concerned with the design and construction of a Small Modular Laboratory Hall Effect Thruster (SMLHET), and its operation on argon propellant gas. Particular attention was addressed at low-cost, modular design principles, that would facilitate simple replacement and modification of key thruster parts such as the magnetic circuit and discharge channel. This capability is intended to facilitate future studies of device physics such as anomalous electron transport and magnetic shielding of the channel walls, that have an impact on thruster performance and life. Preliminary results demonstrate SMLHET running on argon in a manner characteristic of Hall effect thrusters, additionally a power balance method was utilized to estimate thruster performance. It is expected that future thruster studies utilizing heavier though more expensive gases like xenon or krypton, will observe increased efficiency and stability.
Cathode Effects in Cylindrical Hall Thrusters
Energy Technology Data Exchange (ETDEWEB)
Granstedt, E.M.; Raitses, Y.; Fisch, N. J.
2008-09-12
Stable operation of a cylindrical Hall thruster (CHT) has been achieved using a hot wire cathode, which functions as a controllable electron emission source. It is shown that as the electron emission from the cathode increases with wire heating, the discharge current increases, the plasma plume angle reduces, and the ion energy distribution function shifts toward higher energies. The observed effect of cathode electron emission on thruster parameters extends and clarifies performance improvements previously obtained for the overrun discharge current regime of the same type of thruster, but using a hollow cathode-neutralizer. Once thruster discharge current saturates with wire heating, further filament heating does not affect other discharge parameters. The saturated values of thruster discharge parameters can be further enhanced by optimal placement of the cathode wire with respect to the magnetic field.
Anode sheath in Hall thrusters
International Nuclear Information System (INIS)
Dorf, L.; Semenov, V.; Raitses, Y.
2003-01-01
A set of hydrodynamic equations is used to describe quasineutral plasma in ionization and acceleration regions of a Hall thruster. The electron distribution function and Poisson equation are invoked for description of a near-anode region. Numerical solutions suggest that steady-state operation of a Hall thruster can be achieved at different anode sheath regimes. It is shown that the anode sheath depends on the thruster operating conditions, namely the discharge voltage and the mass flow rate
Low power arcjet thruster pulse ignition
Sarmiento, Charles J.; Gruber, Robert P.
1987-01-01
An investigation of the pulse ignition characteristics of a 1 kW class arcjet using an inductive energy storage pulse generator with a pulse width modulated power converter identified several thruster and pulse generator parameters that influence breakdown voltage including pulse generator rate of voltage rise. This work was conducted with an arcjet tested on hydrogen-nitrogen gas mixtures to simulate fully decomposed hydrazine. Over all ranges of thruster and pulser parameters investigated, the mean breakdown voltages varied from 1.4 to 2.7 kV. Ignition tests at elevated thruster temperatures under certain conditions revealed occasional breakdowns to thruster voltages higher than the power converter output voltage. These post breakdown discharges sometimes failed to transition to the lower voltage arc discharge mode and the thruster would not ignite. Under the same conditions, a transition to the arc mode would occur for a subsequent pulse and the thruster would ignite. An automated 11 600 cycle starting and transition to steady state test demonstrated ignition on the first pulse and required application of a second pulse only two times to initiate breakdown.
Krypton Ion Thruster Performance
Patterson, Michael J.; Williams, George J.
1992-01-01
Preliminary data were obtained from a 30 cm ion thruster operating on krypton propellant over the input power range of 0.4 to 5.5 kW. The data presented are compared and contrasted to the data obtained with xenon propellant over the same input power envelope. Typical krypton thruster efficiency was 70 percent at a specific impulse of approximately 5000 s, with a maximum demonstrated thrust to power ratio of approximately 42 mN/kW at 2090 s specific impulse and 1580 watts input power. Critical thruster performance and component lifetime issues were evaluated. Order of magnitude power throttling was demonstrated using a simplified power-throttling strategy.
Oxygen-Methane Thruster, Phase I
National Aeronautics and Space Administration — Orion Propulsion, Inc. proposes to develop an Oxygen and Methane RCS Thruster to advance the technology of alternate fuels. A successful Oxygen/CH4 RCS Thruster will...
Kaufman, H. R.; Robinson, R. S.
1980-01-01
Some advances in component technology for inert gas thrusters are described. The maximum electron emission of a hollow cathode with Ar was increased 60-70% by the use of an enclosed keeper configuration. Operation with Ar, but without emissive oxide, was also obtained. A 30 cm thruster operated with Ar at moderate discharge voltages give double-ion measurements consistent with a double ion correlation developed previously using 15 cm thruster data. An attempt was made to reduce discharge losses by biasing anodes positive of the discharge plasma. The reason this attempt was unsuccessful is not yet clear. The performance of a single-grid ion-optics configuration was evaluated. The ion impingement on the single grid accelerator was found to approach the value expected from the projected blockage when the sheath thickness next to the accelerator was 2-3 times the aperture diameter.
Parametric Investigation of Miniaturized Cylindrical and Annular Hall Thrusters
International Nuclear Information System (INIS)
Smirnov, A.; Raitses, Y.; Fisch, N.J.
2002-01-01
Conventional annular Hall thrusters become inefficient when scaled to low power. An alternative approach, a 2.6-cm miniaturized cylindrical Hall thruster with a cusp-type magnetic field distribution, was developed and studied. Its performance was compared to that of a conventional annular thruster of the same dimensions. The cylindrical thruster exhibits discharge characteristics similar to those of the annular thruster, but it has a much higher propellant ionization efficiency. Significantly, a large fraction of multi-charged xenon ions might be present in the outgoing ion flux generated by the cylindrical thruster. The operation of the cylindrical thruster is quieter than that of the annular thruster. The characteristic peak in the discharge current fluctuation spectrum at 50-60 kHz appears to be due to ionization instabilities. In the power range 50-300 W, the cylindrical and annular thrusters have comparable efficiencies (15-32%) and thrusts (2.5-12 mN). For the annular configuration, a voltage less than 200 V was not sufficient to sustain the discharge at low propellant flow rates. The cylindrical thruster can operate at voltages lower than 200 V, which suggests that a cylindrical thruster can be designed to operate at even smaller power
Scale Model Thruster Acoustic Measurement Results
Vargas, Magda; Kenny, R. Jeremy
2013-01-01
The Space Launch System (SLS) Scale Model Acoustic Test (SMAT) is a 5% scale representation of the SLS vehicle, mobile launcher, tower, and launch pad trench. The SLS launch propulsion system will be comprised of the Rocket Assisted Take-Off (RATO) motors representing the solid boosters and 4 Gas Hydrogen (GH2) thrusters representing the core engines. The GH2 thrusters were tested in a horizontal configuration in order to characterize their performance. In Phase 1, a single thruster was fired to determine the engine performance parameters necessary for scaling a single engine. A cluster configuration, consisting of the 4 thrusters, was tested in Phase 2 to integrate the system and determine their combined performance. Acoustic and overpressure data was collected during both test phases in order to characterize the system's acoustic performance. The results from the single thruster and 4- thuster system are discussed and compared.
Q-Thruster Breadboard Campaign Project
White, Harold
2014-01-01
Dr. Harold "Sonny" White has developed the physics theory basis for utilizing the quantum vacuum to produce thrust. The engineering implementation of the theory is known as Q-thrusters. During FY13, three test campaigns were conducted that conclusively demonstrated tangible evidence of Q-thruster physics with measurable thrust bringing the TRL up from TRL 2 to early TRL 3. This project will continue with the development of the technology to a breadboard level by leveraging the most recent NASA/industry test hardware. This project will replace the manual tuning process used in the 2013 test campaign with an automated Radio Frequency (RF) Phase Lock Loop system (precursor to flight-like implementation), and will redesign the signal ports to minimize RF leakage (improves efficiency). This project will build on the 2013 test campaign using the above improvements on the test implementation to get ready for subsequent Independent Verification and Validation testing at Glenn Research Center (GRC) and Jet Propulsion Laboratory (JPL) in FY 2015. Q-thruster technology has a much higher thrust to power than current forms of electric propulsion (7x Hall thrusters), and can significantly reduce the total power required for either Solar Electric Propulsion (SEP) or Nuclear Electric Propulsion (NEP). Also, due to the high thrust and high specific impulse, Q-thruster technology will greatly relax the specific mass requirements for in-space nuclear reactor systems. Q-thrusters can reduce transit times for a power-constrained architecture.
One-millipound mercury ion thruster
Hyman, J., Jr.; Dulgeroff, C. R.; Kami, S.; Williamson, W. S.
1975-01-01
A mercury ion thruster has been developed for efficient operation at the nominal 1-mlb thrust level with a specific impulse of about 3,000 sec and a total power consumption of about 120 W. At a beam voltage of 1,200 V and beam current of 72 mA, the discharge chamber operates with a propellant efficiency of 93.8% at an ion-generation energy of 276 eV/ion. The 8-cm diameter thruster advances proven component technology to assure the capability for thruster operation over an accumulated beam-on time in excess of 20,000 hours with a capability for 10,000 on-off duty cycles. Discharge chamber optimization has combined stable current-voltage characteristics with high performance efficiency by careful placement of the discharge cathode near the location of a magnetic-field zero just upstream of the thruster endplate.
Hardware in the Loop Testing of an Iodine-Fed Hall Thruster
Polzin, Kurt A.; Peeples, Steven R.; Cecil, Jim; Lewis, Brandon L.; Molina Fraticelli, Jose C.; Clark, James P.
2015-01-01
CUBESATS are relatively new spacecraft platforms that are typically deployed from a launch vehicle as a secondary payload,1 providing low-cost access to space for a wide range of end-users. These satellites are comprised of building blocks having dimensions of 10x10x10 cm cu and a mass of 1.33 kg (a 1-U size). While providing low-cost access to space, a major operational limitation is the lack of a propulsion system that can fit within a CubeSat and is capable of executing high delta v maneuvers. This makes it difficult to use CubeSats on missions requiring certain types of maneuvers (i.e. formation flying, spacecraft rendezvous). Recently, work has been performed investigating the use of iodine as a propellant for Hall-effect thrusters (HETs) 2 that could subsequently be used to provide a high specific impulse path to CubeSat propulsion. Iodine stores as a dense solid at very low pressures, making it acceptable as a propellant on a secondary payload. It has exceptionally high ?Isp (density times specific impulse), making it an enabling technology for small satellite near-term applications and providing the potential for systems-level advantages over mid-term high power electric propulsion options. Iodine flow can also be thermally regulated, subliming at relatively low temperature ( less than100 C) to yield I2 vapor at or below 50 torr. At low power, the measured performance of an iodine-fed HET is very similar to that of a state-of-the-art xenon-fed thruster. Just as importantly, the current-voltage discharge characteristics of low power iodine-fed and xenon-fed thrusters are remarkably similar, potentially reducing development and qualifications costs by making it possible to use an already-qualified xenon-HET PPU in an iodine-fed system. Finally, a cold surface can be installed in a vacuum test chamber on which expended iodine propellant can deposit. In addition, the temperature doesn't have to be extremely cold to maintain a low vapor pressure in the vacuum
Electrostatic ion thrusters - towards predictive modeling
Energy Technology Data Exchange (ETDEWEB)
Kalentev, O.; Matyash, K.; Duras, J.; Lueskow, K.F.; Schneider, R. [Ernst-Moritz-Arndt Universitaet Greifswald, D-17489 (Germany); Koch, N. [Technische Hochschule Nuernberg Georg Simon Ohm, Kesslerplatz 12, D-90489 Nuernberg (Germany); Schirra, M. [Thales Electronic Systems GmbH, Soeflinger Strasse 100, D-89077 Ulm (Germany)
2014-02-15
The development of electrostatic ion thrusters so far has mainly been based on empirical and qualitative know-how, and on evolutionary iteration steps. This resulted in considerable effort regarding prototype design, construction and testing and therefore in significant development and qualification costs and high time demands. For future developments it is anticipated to implement simulation tools which allow for quantitative prediction of ion thruster performance, long-term behavior and space craft interaction prior to hardware design and construction. Based on integrated numerical models combining self-consistent kinetic plasma models with plasma-wall interaction modules a new quality in the description of electrostatic thrusters can be reached. These open the perspective for predictive modeling in this field. This paper reviews the application of a set of predictive numerical modeling tools on an ion thruster model of the HEMP-T (High Efficiency Multi-stage Plasma Thruster) type patented by Thales Electron Devices GmbH. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Kamhawi, Hani; Dankanich, John; Martinez, Andres; Petro, Andrew
2015-01-01
The Iodine Satellite (iSat) spacecraft will be the first CubeSat to demonstrate high change in velocity from a primary propulsion system by using Hall thruster technology and iodine as a propellant. The mission will demonstrate CubeSat maneuverability, including plane change, altitude change and change in its closest approach to Earth to ensure atmospheric reentry in less than 90 days. The mission is planned for launch in fall 2017. Hall thruster technology is a type of electric propulsion. Electric propulsion uses electricity, typically from solar panels, to accelerate the propellant. Electric propulsion can accelerate propellant to 10 times higher velocities than traditional chemical propulsion systems, which significantly increases fuel efficiency. To enable the success of the propulsion subsystem, iSat will also demonstrate power management and thermal control capabilities well beyond the current state-of-the-art for spacecraft of its size. This technology is a viable primary propulsion system that can be used on small satellites ranging from about 22 pounds (10 kilograms) to more than 1,000 pounds (450 kilograms). iSat's fuel efficiency is ten times greater and its propulsion per volume is 100 times greater than current cold-gas systems and three times better than the same system operating on xenon. iSat's iodine propulsion system consists of a 200 watt (W) Hall thruster, a cathode, a tank to store solid iodine, a power processing unit (PPU) and the feed system to supply the iodine. This propulsion system is based on a 200 W Hall thruster developed by Busek Co. Inc., which was previously flown using xenon as the propellant. Several improvements have been made to the original system to include a compact PPU, targeting greater than 80 percent reduction in mass and volume of conventional PPU designs. The cathode technology is planned to enable heaterless cathode conditioning, significantly increasing total system efficiency. The feed system has been designed to
Characteristics of a non-volatile liquid propellant in liquid-fed ablative pulsed plasma thrusters
Ling, William Yeong Liang; Schönherr, Tony; Koizumi, Hiroyuki
2017-02-01
In the past several decades, the use of electric propulsion in spacecraft has experienced tremendous growth. With the increasing adoption of small satellites in the kilogram range, suitable propulsion systems will be necessary in the near future. Pulsed plasma thrusters (PPTs) were the first form of electric propulsion to be deployed in orbit, and are highly suitable for small satellites due to their inherent simplicity. However, their lifetime is limited by disadvantages such as carbon deposition leading to thruster failure, and complicated feeding systems required due to the conventional use of solid propellants (usually polytetrafluoroethylene (PTFE)). A promising alternative to solid propellants has recently emerged in the form of non-volatile liquids that are stable in vacuum. This study presents a broad comparison of the non-volatile liquid perfluoropolyether (PFPE) and solid PTFE as propellants on a PPT with a common design base. We show that liquid PFPE can be successfully used as a propellant, and exhibits similar plasma discharge properties to conventional solid PTFE, but with a mass bit that is an order of magnitude higher for an identical ablation area. We also demonstrate that the liquid PFPE propellant has exceptional resistance to carbon deposition, completely negating one of the major causes of thruster failure, while solid PTFE exhibited considerable carbon build-up. Energy dispersive X-ray spectroscopy was used to examine the elemental compositions of the surface deposition on the electrodes and the ablation area of the propellant (or PFPE encapsulator). The results show that based on its physical characteristics and behavior, non-volatile liquid PFPE is an extremely promising propellant for use in PPTs, with an extensive scope available for future research and development.
NASA HERMeS Hall Thruster Electrical Configuration Characterization
Peterson, Peter; Kamhawi, Hani; Huang, Wensheng; Yim, John; Herman, Daniel; Williams, George; Gilland, James; Hofer, Richard
2016-01-01
NASAs Hall Effect Rocket with Magnetic Shielding (HERMeS) 12.5 kW Technology Demonstration Unit-1 (TDU-1) Hall thruster has been the subject of extensive technology maturation in preparation for development into a flight ready propulsion system. Part of the technology maturation was to test the TDU-1 thruster in several ground based electrical configurations to assess the thruster robustness and suitability to successful in-space operation. The ground based electrical configuration testing has recently been demonstrated as an important step in understanding and assessing how a Hall thruster may operate differently in space compared to ground based testing, and to determine the best configuration to conduct development and qualification testing. This presentation will cover the electrical configuration testing of the TDU-1 HERMeS Hall thruster in NASA Glenn Research Centers Vacuum Facility 5. The three electrical configurations examined are the thruster body tied to facility ground, thruster floating, and finally the thruster body electrically tied to cathode common. The TDU-1 HERMeS was configured with two different exit plane boundary conditions, dielectric and conducting, to examine the influence on the electrical configuration characterization.
Miniaturized Lightweight Monopropellant Feed System for Nano- and Micro-satellites, Phase I
National Aeronautics and Space Administration — There is a need for viable and practical solutions for utilizing chemical thrusters operating with green monopropellants on small- and micro-satellites and cubesats...
Ferreira, Jose Leonardo; Martins, Alexandre; Cerda, Rodrigo
2016-07-01
The Plasma Physics Laboratory of UnB has been developing a Permanent Magnet Hall Thruster (PHALL) for the UNIESPAÇO program, part of the Space Activities Program conducted by AEB- The Brazillian Space Agency since 2004. Electric propulsion is now a very successful method for primary and secondary propulsion systems. It is essential for several existing geostationary satellite station keeping systems and for deep space long duration solar system missions, where the thrusting system can be designed to be used on orbit transfer maneuvering and/or for satellite attitude control in long term space missions. Applications of compact versions of Permanent Magnet Hall Thrusters on future brazillian space missions are needed and foreseen for the coming years beginning with the use of small divergent cusp field (DCFH) Hall Thrusters type on CUBESATS ( 5-10 kg , 1W-5 W power consumption) and on Micro satellites ( 50- 100 kg, 10W-100W). Brazillian (AEB) and German (DLR) space agencies and research institutions are developing a new rocket dedicated to small satellite launching. The VLM- Microsatellite Launch Vehicle. The development of PHALL compact versions can also be important for the recently proposed SBG system, a future brazillian geostationary satellite system that is already been developed by an international consortium of brazillian and foreign space industries. The exploration of small bodies in the Solar System with spacecraft has been done by several countries with increasing frequency in these past twenty five years. Since their historical beginning on the sixties, most of the Solar System missions were based on gravity assisted trajectories very much depended on planet orbit positioning relative to the Sun and the Earth. The consequence was always the narrowing of the mission launch window. Today, the need for Solar System icy bodies in situ exploration requires less dependence on gravity assisted maneuvering and new high precision low thrust navigation methods
Laser injection of ultra-short electron bursts for the diagnosis of Hall thruster plasma
International Nuclear Information System (INIS)
Albarede, L; Gibert, T; Lazurenko, A; Bouchoule, A
2006-01-01
The present developments of Hall thrusters for satellite control and space mission technologies represent a new step towards their routine use in place of conventional thermal thrusters. In spite of their long R and D history, the complex physics of the E x B discharge at work in these structures has prevented, up to now, the availability of predictive simulations. The electron transport in the accelerating layers of these thrusters is one of the remaining challenges in this direction. From the experimental point of view, any diagnostics of electron transport and electric field in this critical layer would be welcome for comparison with code predictions. Appropriate diagnostics are difficult, due to the very aggressive local plasma conditions. This paper presents the first step in the development of a new tool for characterization of the plasma electric field in the very near exhaust thruster plume and comparison with simulation code predictions. The main idea is to use very short bursts of electrons, probing local electron dynamics in this critical plume area. Such bursts can be obtained through photoelectric emission induced by a UV pulsed laser beam on a convenient target. A specific study, devoted to the characterization of the electron burst emission, is presented in the first section of the paper; the implementation and testing of the injection of electrons in the critical layer of Hall thruster plasma is described in the second section. The design and testing of a fast and sensitive system for characterizing the transport of injected bursts will be the next step of this program. It requires a preliminary evaluation of electron trajectories which was achieved by using simulation code. Simulation data are presented in the last section of the paper, with the full diagnostic design to be tested in the near future, when runs will be available in the renewed PIVOINE facility. The same electron burst injection could also be a valuable input in the present
Development of the Multiple Use Plug Hybrid for Nanosats (MUPHyN) miniature thruster
Eilers, Shannon
The Multiple Use Plug Hybrid for Nanosats (MUPHyN) prototype thruster incorporates solutions to several major challenges that have traditionally limited the deployment of chemical propulsion systems on small spacecraft. The MUPHyN thruster offers several features that are uniquely suited for small satellite applications. These features include 1) a non-explosive ignition system, 2) non-mechanical thrust vectoring using secondary fluid injection on an aerospike nozzle cooled with the oxidizer flow, 3) a non-toxic, chemically-stable combination of liquid and inert solid propellants, 4) a compact form factor enabled by the direct digital manufacture of the inert solid fuel grain. Hybrid rocket motors provide significant safety and reliability advantages over both solid composite and liquid propulsion systems; however, hybrid motors have found only limited use on operational vehicles due to 1) difficulty in modeling the fuel flow rate 2) poor volumetric efficiency and/or form factor 3) significantly lower fuel flow rates than solid rocket motors 4) difficulty in obtaining high combustion efficiencies. The features of the MUPHyN thruster are designed to offset and/or overcome these shortcomings. The MUPHyN motor design represents a convergence of technologies, including hybrid rocket regression rate modeling, aerospike secondary injection thrust vectoring, multiphase injector modeling, non-pyrotechnic ignition, and nitrous oxide regenerative cooling that address the traditional challenges that limit the use of hybrid rocket motors and aerospike nozzles. This synthesis of technologies is unique to the MUPHyN thruster design and no comparable work has been published in the open literature.
Hall Thruster Thermal Modeling and Test Data Correlation
Myers, James; Kamhawi, Hani; Yim, John; Clayman, Lauren
2016-01-01
The life of Hall Effect thrusters are primarily limited by plasma erosion and thermal related failures. NASA Glenn Research Center (GRC) in cooperation with the Jet Propulsion Laboratory (JPL) have recently completed development of a Hall thruster with specific emphasis to mitigate these limitations. Extending the operational life of Hall thursters makes them more suitable for some of NASA's longer duration interplanetary missions. This paper documents the thermal model development, refinement and correlation of results with thruster test data. Correlation was achieved by minimizing uncertainties in model input and recognizing the relevant parameters for effective model tuning. Throughout the thruster design phase the model was used to evaluate design options and systematically reduce component temperatures. Hall thrusters are inherently complex assemblies of high temperature components relying on internal conduction and external radiation for heat dispersion and rejection. System solutions are necessary in most cases to fully assess the benefits and/or consequences of any potential design change. Thermal model correlation is critical since thruster operational parameters can push some components/materials beyond their temperature limits. This thruster incorporates a state-of-the-art magnetic shielding system to reduce plasma erosion and to a lesser extend power/heat deposition. Additionally a comprehensive thermal design strategy was employed to reduce temperatures of critical thruster components (primarily the magnet coils and the discharge channel). Long term wear testing is currently underway to assess the effectiveness of these systems and consequently thruster longevity.
High Accuracy Positioning using Jet Thrusters for Quadcopter
Directory of Open Access Journals (Sweden)
Pi ChenHuan
2018-01-01
Full Text Available A quadcopter is equipped with four additional jet thrusters on its horizontal plane and vertical to each other in order to improve the maneuverability and positioning accuracy of quadcopter. A dynamic model of the quadcopter with jet thrusters is derived and two controllers are implemented in simulation, one is a dual loop state feedback controller for pose control and another is an auxiliary jet thruster controller for accurate positioning. Step response simulations showed that the jet thruster can control the quadcopter with less overshoot compared to the conventional one. Over 10s loiter simulation with disturbance, the quadcopter with jet thruster decrease 85% of RMS error of horizontal disturbance compared to a conventional quadcopter with only a dual loop state feedback controller. The jet thruster controller shows the possibility for further accurate in the field of quadcopter positioning.
Temperature Gradient in Hall Thrusters
International Nuclear Information System (INIS)
Staack, D.; Raitses, Y.; Fisch, N.J.
2003-01-01
Plasma potentials and electron temperatures were deduced from emissive and cold floating probe measurements in a 2 kW Hall thruster, operated in the discharge voltage range of 200-400 V. An almost linear dependence of the electron temperature on the plasma potential was observed in the acceleration region of the thruster both inside and outside the thruster. This result calls into question whether secondary electron emission from the ceramic channel walls plays a significant role in electron energy balance. The proportionality factor between the axial electron temperature gradient and the electric field is significantly smaller than might be expected by models employing Ohmic heating of electrons
Coaxial plasma thrusters for high specific impulse propulsion
Schoenberg, Kurt F.; Gerwin, Richard A.; Barnes, Cris W.; Henins, Ivars; Mayo, Robert; Moses, Ronald, Jr.; Scarberry, Richard; Wurden, Glen
1991-01-01
A fundamental basis for coaxial plasma thruster performance is presented and the steady-state, ideal MHD properties of a coaxial thruster using an annular magnetic nozzle are discussed. Formulas for power usage, thrust, mass flow rate, and specific impulse are acquired and employed to assess thruster performance. The performance estimates are compared with the observed properties of an unoptimized coaxial plasma gun. These comparisons support the hypothesis that ideal MHD has an important role in coaxial plasma thruster dynamics.
Performance and flow characteristics of MHD seawater thruster
Energy Technology Data Exchange (ETDEWEB)
Doss, E.D.
1990-01-01
The main goal of the research is to investigate the effects of strong magnetic fields on the electrical and flow fields inside MHD thrusters. The results of this study is important in the assessment of the feasibility of MHD seawater propulsion for the Navy. To accomplish this goal a three-dimensional fluid flow computer model has been developed and applied to study the concept of MHD seawater propulsion. The effects of strong magnetic fields on the current and electric fields inside the MHD thruster and their interaction with the flow fields, particularly those in the boundary layers, have been investigated. The results of the three-dimensional computations indicate that the velocity profiles are flatter over the sidewalls of the thruster walls in comparison to the velocity profiles over the electrode walls. These nonuniformities in the flow fields give rise to nonuniform distribution of the skin friction along the walls of the thrusters, where higher values are predicted over the sidewalls relative to those over the electrode walls. Also, a parametric study has been performed using the three-dimensional MHD flow model to analyze the performance of continuous electrode seawater thrusters under different operating parameters. The effects of these parameters on the fluid flow characteristics, and on the thruster efficiency have been investigated. Those parameters include the magnetic field (10--20 T), thruster diameter, surface roughness, flow velocity, and the electric load factor. The results show also that the thruster performance improves with the strength of the magnetic field and thruster diameter, and the efficiency decreases with the flow velocity and surface roughness.
Nozzle fabrication for Micro Propulsion of a Micro-Satellite
Louwerse, M.C.; Jansen, Henricus V.; Groenendijk, M.N.W.; Elwenspoek, Michael Curt
2008-01-01
To enable formation flying of micro satellites, small sized propulsion systems are required. Our research focuses on the miniaturization of a feeding and thruster system by means of micro system technology (MST). Three fabrication methods have been investigated to make a conical converging-diverging
Iodine Small Satellite Propulsion Demonstration - iSAT
Jehle, MAJ; L., Alexander
2017-01-01
NASA’s Iodine Satellite (iSAT) is a small satellite demonstration mission designed and built at NASA’s Marshall Spaceflight Center (MSFC). Previously expected to launch late 2nd quarter of fiscal year ’18, iSAT’s flight effort has temporarily stood-down as of May 2017 to allow for the propulsion system to mature. Once launched, iSAT will demonstrate and characterize the efficiency of BUSEK’s 200 Watt Hall effect thruster utilizing iodine as a propellant in low Earth orbit. This paper covers i...
Status of the J-series 30-cm mercury ion thruster
Kami, S.; Dulgeroff, C. R.; Bechtel, R. T.
1982-01-01
This paper describes the status of the 30-cm J-series mercury ion thruster. This thruster was baselined for the Solar Electric Propulsion System (SEPS) vehicle. This thruster is described and several modifications plus suggested modifications are presented. Some of the modifications resulted from tests performed with the thruster. The operational characteristics of eight J-series thrusters are presented. Isolator contamination and flake formation are also discussed.
Los Alamos NEP research in advanced plasma thrusters
Schoenberg, Kurt; Gerwin, Richard
1991-01-01
Research was initiated in advanced plasma thrusters that capitalizes on lab capabilities in plasma science and technology. The goal of the program was to examine the scaling issues of magnetoplasmadynamic (MPD) thruster performance in support of NASA's MPD thruster development program. The objective was to address multi-megawatt, large scale, quasi-steady state MPD thruster performance. Results to date include a new quasi-steady state operating regime which was obtained at space exploration initiative relevant power levels, that enables direct coaxial gun-MPD comparisons of thruster physics and performance. The radiative losses are neglible. Operation with an applied axial magnetic field shows the same operational stability and exhaust plume uniformity benefits seen in MPD thrusters. Observed gun impedance is in close agreement with the magnetic Bernoulli model predictions. Spatial and temporal measurements of magnetic field, electric field, plasma density, electron temperature, and ion/neutral energy distribution are underway. Model applications to advanced mission logistics are also underway.
Particle simulation of grid system for krypton ion thrusters
Directory of Open Access Journals (Sweden)
Maolin CHEN
2018-04-01
Full Text Available The transport processes of plasmas in grid systems of krypton (Kr ion thrusters at different acceleration voltages were simulated with a 3D-PIC model, and the result was compared with xenon (Xe ion thrusters. The variation of the screen grid transparency, the accelerator grid current ratio and the divergence loss were explored. It is found that the screen grid transparency increases with the acceleration voltage and decreases with the beam current, while the accelerator grid current ratio and divergence loss decrease first and then increase with the beam current. This result is the same with Xe ion thrusters. Simulation results also show that Kr ion thrusters have more advantages than Xe ion thrusters, such as higher screen grid transparency, smaller accelerator grid current ratio, larger cut-off current threshold, and better divergence loss characteristic. These advantages mean that Kr ion thrusters have the ability of operating in a wide range of current. Through comprehensive analyses, it can be concluded that using Kr as propellant is very suitable for a multi-mode ion thruster design. Keywords: Grid system, Ion thrusters, Krypton, Particle in cell method, Plasma
Ion thruster performance model
International Nuclear Information System (INIS)
Brophy, J.R.
1984-01-01
A model of ion thruster performance is developed for high flux density cusped magnetic field thruster designs. This model is formulated in terms of the average energy required to produce an ion in the discharge chamber plasma and the fraction of these ions that are extracted to form the beam. The direct loss of high energy (primary) electrons from the plasma to the anode is shown to have a major effect on thruster performance. The model provides simple algebraic equations enabling one to calculate the beam ion energy cost, the average discharge chamber plasma ion energy cost, the primary electron density, the primary-to-Maxwellian electron density ratio and the Maxwellian electron temperature. Experiments indicate that the model correctly predicts the variation in plasma ion energy cost for changes in propellant gas (Ar, Kr, and Xe), grid transparency to neutral atoms, beam extraction area, discharge voltage, and discharge chamber wall temperature
Pressure History Measurement in a Microwave Beaming Thruster
International Nuclear Information System (INIS)
Oda, Yasuhisa; Ushio, Masato; Komurasaki, Kimiya; Takahashi, Koji; Kasugai, Atsushi; Sakamoto, Keishi
2006-01-01
In a microwave beaming thruster with a 1-dimensional nozzle, plasma and shock wave propagates in the nozzle absorbing microwave power. In this study, pressure histories in the thruster are measured using pressure gauges. Measured pressure history at the thruster wall shows constant pressure during plasma propagation in the nozzle. The result of measurement of the propagating velocities of shock wave and plasma shows that both propagate in the same velocity. These result shows that thrust producing model of analogy of pulse detonation engine is successful for the 1D thruster
Investigations of Probe Induced Perturbations in a Hall Thruster
International Nuclear Information System (INIS)
D. Staack; Y. Raitses; N.J. Fisch
2002-01-01
An electrostatic probe used to measure spatial plasma parameters in a Hall thruster generates perturbations of the plasma. These perturbations are examined by varying the probe material, penetration distance, residence time, and the nominal thruster conditions. The study leads us to recommendations for probe design and thruster operating conditions to reduce discharge perturbations, including metal shielding of the probe insulator and operation of the thruster at lower densities
A Numerical Study on Hydrodynamic Interactions between Dynamic Positioning Thrusters
Energy Technology Data Exchange (ETDEWEB)
Jin, Doo Hwa; Lee, Sang Wook [University of Ulsan, Ulsan (Korea, Republic of)
2017-06-15
In this study, we conducted computational fluid dynamics (CFD) simulations for the unsteady hydrodynamic interaction of multiple thrusters by solving Reynolds averaged Navier-Stokes equations. A commercial CFD software, STAR-CCM+ was used for all simulations by employing a ducted thruster model with combination of a propeller and No. 19a duct. A sliding mesh technique was used to treat dynamic motion of propeller rotation and non-conformal hexahedral grid system was considered. Four different combinations in tilting and azimuth angles of the thrusters were considered to investigate the effects on the propulsion performance. We could find that thruster-hull and thruster-thruster interactions has significant effect on propulsion performance and further study will be required for the optimal configurations with the best tilting and relative azimuth angle between thrusters.
Magnetically enhanced vacuum arc thruster
International Nuclear Information System (INIS)
Keidar, Michael; Schein, Jochen; Wilson, Kristi; Gerhan, Andrew; Au, Michael; Tang, Benjamin; Idzkowski, Luke; Krishnan, Mahadevan; Beilis, Isak I
2005-01-01
A hydrodynamic model of the vacuum arc thruster and its plume is described. Primarily an effect of the magnetic field on the plume expansion and plasma generation is considered. Two particular examples are investigated, namely the magnetically enhanced co-axial vacuum arc thruster (MVAT) and the vacuum arc thruster with ring electrodes (RVAT). It is found that the magnetic field significantly decreases the plasma plume radial expansion under typical conditions. Predicted plasma density profiles in the plume of the MVAT are compared with experimental profiles, and generally a good agreement is found. In the case of the RVAT the influence of the magnetic field leads to plasma jet deceleration, which explains the non-monotonic dependence of the ion current density, on an axial magnetic field observed experimentally
Magnetically enhanced vacuum arc thruster
Energy Technology Data Exchange (ETDEWEB)
Keidar, Michael [University of Michigan, Ann Arbor 48109 MI (United States); Schein, Jochen [Alameda Applied Science Corporation, San Leandro, CA 94577 (United States); Wilson, Kristi [Alameda Applied Science Corporation, San Leandro, CA 94577 (United States); Gerhan, Andrew [Alameda Applied Science Corporation, San Leandro, CA 94577 (United States); Au, Michael [Alameda Applied Science Corporation, San Leandro, CA 94577 (United States); Tang, Benjamin [Alameda Applied Science Corporation, San Leandro, CA 94577 (United States); Idzkowski, Luke [Alameda Applied Science Corporation, San Leandro, CA 94577 (United States); Krishnan, Mahadevan [Alameda Applied Science Corporation, San Leandro, CA 94577 (United States); Beilis, Isak I [Tel Aviv University, Tel Aviv (Israel)
2005-11-01
A hydrodynamic model of the vacuum arc thruster and its plume is described. Primarily an effect of the magnetic field on the plume expansion and plasma generation is considered. Two particular examples are investigated, namely the magnetically enhanced co-axial vacuum arc thruster (MVAT) and the vacuum arc thruster with ring electrodes (RVAT). It is found that the magnetic field significantly decreases the plasma plume radial expansion under typical conditions. Predicted plasma density profiles in the plume of the MVAT are compared with experimental profiles, and generally a good agreement is found. In the case of the RVAT the influence of the magnetic field leads to plasma jet deceleration, which explains the non-monotonic dependence of the ion current density, on an axial magnetic field observed experimentally.
Keefer, Dennis; Rhodes, Robert
1993-05-01
Electrically powered arc jets which produce thrust at high specific impulse could provide a substantial cost reduction for orbital transfer and station keeping missions. There is currently a limited understanding of the complex, nonlinear interactions in the plasma propellant which has hindered the development of high efficiency arc jet thrusters by making it difficult to predict the effect of design changes and to interpret experimental results. A computational model developed at the University of Tennessee Space Institute (UTSI) to study laser powered thrusters and radio frequency gas heaters has been adapted to provide a tool to help understand the physical processes in arc jet thrusters. The approach is to include in the model those physical and chemical processes which appear to be important, and then to evaluate our judgement by the comparison of numerical simulations with experimental data. The results of this study have been presented at four technical conferences. The details of the work accomplished in this project are covered in the individual papers included in the appendix of this report. We present a brief description of the model covering its most important features followed by a summary of the effort.
Thermal-environmental testing of a 30-cm engineering model thruster
Mirtich, M. J.
1976-01-01
An experimental test program was carried out to document all 30-cm electron bombardment Hg ion bombardment thruster functions and characteristics over the thermal environment of several proposed missions. An engineering model thruster was placed in a thermal test facility equipped with -196 C walls and solar simulation. The thruster was cold soaked and exposed to simulated eclipses lasting in duration from 17 to 72 minutes. The thruster was operated at quarter, to full beam power in various thermal configurations which simulated multiple thruster operation, and was also exposed to 1 and 2 suns solar simulation. Thruster control characteristics and constraints; performance, including thrust magnitude and direction; and structural integrity were evaluated over the range of thermal environments tested.
Performance of a Permanent-Magnet Cylindrical Hall-Effect Thruster
Polzin, K. A.; Sooby, E. S.; Kimberlin, A. C.; Raites, Y.; Merino, E.; Fisch, N. J.
2009-01-01
The performance of a low-power cylindrical Hall thruster, which more readily lends itself to miniaturization and low-power operation than a conventional (annular) Hall thruster, was measured using a planar plasma probe and a thrust stand. The field in the cylindrical thruster was produced using permanent magnets, promising a power reduction over previous cylindrical thruster iterations that employed electromagnets to generate the required magnetic field topology. Two sets of ring-shaped permanent magnets are used, and two different field configurations can be produced by reorienting the poles of one magnet relative to the other. A plasma probe measuring ion flux in the plume is used to estimate the current utilization for the two magnetic topologies. The measurements indicate that electron transport is impeded much more effectively in one configuration, implying higher thrust efficiency. Thruster performance measurements on this configuration were obtained over a power range of 70-350 W and with the cathode orifice located at three different axial positions relative to the thruster exit plane. The thrust levels over this power range were 1.25-6.5 mN, with anode efficiencies and specific impulses spanning 4-21% and 400-1950 s, respectively. The anode efficiency of the permanent-magnet thruster compares favorable with the efficiency of the electromagnet thruster when the power consumed by the electromagnets is taken into account.
Thermal Modeling for Pulsed Inductive FRC Plasmoid Thrusters
Pfaff, Michael
Due to the rising importance of space based infrastructure, long-range robotic space missions, and the need for active attitude control for spacecraft, research into Electric Propulsion is becoming increasingly important. Electric Propulsion (EP) systems utilize electric power to accelerate ions in order to produce thrust. Unlike traditional chemical propulsion, this means that thrust levels are relatively low. The trade-off is that EP thrusters have very high specific impulses (Isp), and can therefore make do with far less onboard propellant than cold gas, monopropellant, or bipropellant engines. As a consequence of the high power levels used to accelerate the ionized propellant, there is a mass and cost penalty in terms of solar panels and a power processing unit. Due to the large power consumption (and waste heat) from electric propulsion thrusters, accurate measurements and predictions of thermal losses are needed. Excessive heating in sensitive locations within a thruster may lead to premature failure of vital components. Between the fixed cost required to purchase these components, as well as the man-hours needed to assemble (or replace) them, attempting to build a high-power thruster without reliable thermal modeling can be expensive. This paper will explain the usage of FEM modeling and experimental tests in characterizing the ElectroMagnetic Plasmoid Thruster (EMPT) and the Electrodeless Lorentz Force (ELF) thruster at the MSNW LLC facility in Redmond, Washington. The EMPT thruster model is validated using an experimental setup, and steady state temperatures are predicted for vacuum conditions. Preliminary analysis of the ELF thruster indicates possible material failure in absence of an active cooling system for driving electronics and for certain power levels.
Comparisons in Performance of Electromagnet and Permanent-Magnet Cylindrical Hall-Effect Thrusters
Polzin, K. A.; Raitses, Y.; Gayoso, J. C.; Fisch, N. J.
2010-01-01
Three different low-power cylindrical Hall thrusters, which more readily lend themselves to miniaturization and low-power operation than a conventional (annular) Hall thruster, are compared to evaluate the propulsive performance of each. One thruster uses electromagnet coils to produce the magnetic field within the discharge channel while the others use permanent magnets, promising power reduction relative to the electromagnet thruster. A magnetic screen is added to the permanent magnet thruster to improve performance by keeping the magnetic field from expanding into space beyond the exit of the thruster. The combined dataset spans a power range from 50-350 W. The thrust levels over this range were 1.3-7.3 mN, with thruster efficiencies and specific impulses spanning 3.5-28.7% and 400-1940 s, respectively. The efficiency is generally higher for the permanent magnet thruster with the magnetic screen, while That thruster s specific impulse as a function of discharge voltage is comparable to the electromagnet thruster.
Mechanical design of SERT 2 thruster system
Zavesky, R. J.; Hurst, E. B.
1972-01-01
The mechanical design of the mercury bombardment thruster that was tested on SERT is described. The report shows how the structural, thermal, electrical, material compatibility, and neutral mercury coating considerations affected the design and integration of the subsystems and components. The SERT 2 spacecraft with two thrusters was launched on February 3, 1970. One thruster operated for 3782 hours and the other for 2011 hours. A high voltage short resulting from buildup of loose eroded material was believed to be the cause of failure.
Modeling an Iodine Hall Thruster Plume in the Iodine Satellite (ISAT)
Choi, Maria
2016-01-01
An iodine-operated 200-W Hall thruster plume has been simulated using a hybrid-PIC model to predict the spacecraft surface-plume interaction for spacecraft integration purposes. For validation of the model, the plasma potential, electron temperature, ion current flux, and ion number density of xenon propellant were compared with available measurement data at the nominal operating condition. To simulate iodine plasma, various collision cross sections were found and used in the model. While time-varying atomic iodine species (i.e., I, I+, I2+) information is provided by HPHall simulation at the discharge channel exit, the molecular iodine species (i.e., I2, I2+) are introduced as Maxwellian particles at the channel exit. Simulation results show that xenon and iodine plasma plumes appear to be very similar under the assumptions of the model. Assuming a sticking coefficient of unity, iodine deposition rate is estimated.
Studies of Non-Conventional Configuration Closed Electron Drift Thrusters
International Nuclear Information System (INIS)
Y. Raitses; D. Staack; A. Smirnov; A.A. Litvak; L.A. Dorf; T. Graves; N.J. Fisch
2001-01-01
In this paper, we review recent results obtained for segmented electrode and cylindrical Hall thrusters. A low sputtering graphite segmented electrode, placed at the exit of the annular thruster, is shown to affect the plasma potential distribution in the ceramic channel. This effect appears to be correlated with an observed plume reduction compared to a conventional, nonsegmented thruster. In preliminary experiments a 3-cm thruster was operated in the 50-200 W power range. Two operating regimes, stable and oscillating, were observed and investigated
High-Power Ion Thruster Technology
Beattie, J. R.; Matossian, J. N.
1996-01-01
Performance data are presented for the NASA/Hughes 30-cm-diam 'common' thruster operated over the power range from 600 W to 4.6 kW. At the 4.6-kW power level, the thruster produces 172 mN of thrust at a specific impulse of just under 4000 s. Xenon pressure and temperature measurements are presented for a 6.4-mm-diam hollow cathode operated at emission currents ranging from 5 to 30 A and flow rates of 4 sccm and 8 sccm. Highly reproducible results show that the cathode temperature is a linear function of emission current, ranging from approx. 1000 C to 1150 C over this same current range. Laser-induced fluorescence (LIF) measurements obtained from a 30-cm-diam thruster are presented, suggesting that LIF could be a valuable diagnostic for real-time assessment of accelerator-arid erosion. Calibration results of laminar-thin-film (LTF) erosion badges with bulk molybdenum are presented for 300-eV xenon, krypton, and argon sputtering ions. Facility-pressure effects on the charge-exchange ion current collected by 8-cm-diam and 30-cm-diam thrusters operated on xenon propellant are presented to show that accel current is nearly independent of facility pressure at low pressures, but increases rapidly under high-background-pressure conditions.
Effect of Anode Dielectric Coating on Hall Thruster Operation
International Nuclear Information System (INIS)
Dorf, L.; Raitses, Y.; Fisch, N.J.; Semenov, V.
2003-01-01
An interesting phenomenon observed in the near-anode region of a Hall thruster is that the anode fall changes from positive to negative upon removal of the dielectric coating, which is produced on the anode surface during the normal course of Hall thruster operation. The anode fall might affect the thruster lifetime and acceleration efficiency. The effect of the anode coating on the anode fall is studied experimentally using both biased and emissive probes. Measurements of discharge current oscillations indicate that thruster operation is more stable with the coated anode
Levchenko, Igor; Bazaka, Kateryna; Ding, Yongjie; Raitses, Yevgeny; Mazouffre, Stéphane; Henning, Torsten; Klar, Peter J.; Shinohara, Shunjiro; Schein, Jochen; Garrigues, Laurent; Kim, Minkwan; Lev, Dan; Taccogna, Francesco; Boswell, Rod W.; Charles, Christine; Koizumi, Hiroyuki; Shen, Yan; Scharlemann, Carsten; Keidar, Michael; Xu, Shuyan
2018-03-01
Rapid evolution of miniaturized, automatic, robotized, function-centered devices has redefined space technology, bringing closer the realization of most ambitious interplanetary missions and intense near-Earth space exploration. Small unmanned satellites and probes are now being launched in hundreds at a time, resurrecting a dream of satellite constellations, i.e., wide, all-covering networks of small satellites capable of forming universal multifunctional, intelligent platforms for global communication, navigation, ubiquitous data mining, Earth observation, and many other functions, which was once doomed by the extraordinary cost of such systems. The ingression of novel nanostructured materials provided a solid base that enabled the advancement of these affordable systems in aspects of power, instrumentation, and communication. However, absence of efficient and reliable thrust systems with the capacity to support precise maneuvering of small satellites and CubeSats over long periods of deployment remains a real stumbling block both for the deployment of large satellite systems and for further exploration of deep space using a new generation of spacecraft. The last few years have seen tremendous global efforts to develop various miniaturized space thrusters, with great success stories. Yet, there are critical challenges that still face the space technology. These have been outlined at an inaugural International Workshop on Micropropulsion and Cubesats, MPCS-2017, a joint effort between Plasma Sources and Application Centre/Space Propulsion Centre (Singapore) and the Micropropulsion and Nanotechnology Lab, the G. Washington University (USA) devoted to miniaturized space propulsion systems, and hosted by CNR-Nanotec—P.Las.M.I. lab in Bari, Italy. This focused review aims to highlight the most promising developments reported at MPCS-2017 by leading world-reputed experts in miniaturized space propulsion systems. Recent advances in several major types of small
Development and control of a three-axis satellite simulator for the bifocal relay mirror initiative
Chernesky, Vincent S.
2001-01-01
The Three Axis Satellite Simulator (TASS) is a 4-foot diameter octagonal platform supported on a spherical air bearing. The platform hosts several satellite subsystems, including rate gyros, reaction wheels, thrusters, sun sensors, and an onboard control computer. This free-floating design allows for realistic emulation of satellite attitude dynamics in a laboratory environment. The bifocal relay mirror spacecraft system is composed of two optically coupled telescopes used to redirect the las...
Retrofit and verification test of a 30-cm ion thruster
Dulgeroff, C. R.; Poeschel, R. L.
1980-01-01
Twenty modifications were found to be necessary and were approved by design review. These design modifications were incorporated in the thruster documents (drawings and procedures) to define the J series thruster. Sixteen of the design revisions were implemented in a 900 series thruster by retrofit modification. A standardized set of test procedures was formulated, and the retrofit J series thruster design was verified by test. Some difficulty was observed with the modification to the ion optics assembly, but the overall effect of the design modification satisfies the design objectives. The thruster was tested over a wide range of operating parameters to demonstrate its capabilities.
Advanced electrostatic ion thruster for space propulsion
Masek, T. D.; Macpherson, D.; Gelon, W.; Kami, S.; Poeschel, R. L.; Ward, J. W.
1978-01-01
The suitability of the baseline 30 cm thruster for future space missions was examined. Preliminary design concepts for several advanced thrusters were developed to assess the potential practical difficulties of a new design. Useful methodologies were produced for assessing both planetary and earth orbit missions. Payload performance as a function of propulsion system technology level and cost sensitivity to propulsion system technology level are among the topics assessed. A 50 cm diameter thruster designed to operate with a beam voltage of about 2400 V is suggested to satisfy most of the requirements of future space missions.
Experimental test of 200 W Hall thruster with titanium wall
Ding, Yongjie; Sun, Hezhi; Peng, Wuji; Xu, Yu; Wei, Liqiu; Li, Hong; Li, Peng; Su, Hongbo; Yu, Daren
2017-05-01
We designed a 200 W Hall thruster based on the technology of pushing down a magnetic field with two permanent magnetic rings. Boron nitride (BN) is an important insulating wall material for Hall thrusters. The discharge characteristics of the designed Hall thruster were studied by replacing BN with titanium (Ti). Experimental results show that the designed Hall thruster can discharge stably for a long time under a Ti channel. Experiments were performed to determine whether the channel and cathode are electrically connected. When the channel wall and cathode are insulated, the divergence angle of the plume increases, but the performance of the Hall thruster is improved in terms of thrust, specific impulse, anode efficiency, and thrust-to-power ratio. Ti exhibits a powerful antisputtering capability, a low emanation rate of gas, and a large structural strength, making it a potential candidate wall material in the design of low-power Hall thrusters.
Pulsed Electrogasdynamic Thruster for Attitude Control and Orbit Maneuver, Phase I
National Aeronautics and Space Administration — A new pulsed electric thruster, named "pulsed electrogasdynamic thruster," for attitude control and orbit maneuver is proposed. In this thruster, propellant gas is...
Energy Technology Data Exchange (ETDEWEB)
Nakamura, M; Koterayama, W [Kyushu Univ., Fukuoka (Japan). Research Inst. for Applied Mechanics; Kajiwara, H [Kyushu Institute of Technology, Kitakyushu (Japan). Faculty of Computer Science and System Engineering; Hyakudome, T [Kyushu University, Fukuoka (Japan)
1997-12-31
Described herein are dynamics and model experiments of the system in which positioning of a floating marine structure by mooring is combined with thruster-controlled positioning. Coefficients of dynamic forces acting on a floating structure model are determined experimentally and by the three-dimensional singularity distribution method, and the controller is designed by the PID, LQI and H{infinity} control theories. A model having a scale ratio of 1/100 was used for the experiments, where 2 thrusters were arranged in a diagonal line, one on the X-axis. It is found that the LQI and H{infinity} controllers of the thruster can control long-cycle rolling of the floating structure. They allow thruster control which is insensitive to wave cycle motion, and efficiently reduce positioning energy. The H{infinity} control regulates frequency characteristics of a closed loop more finely than the LQI control, and exhibits better controllability. 25 refs., 25 figs.
Energy Technology Data Exchange (ETDEWEB)
Nakamura, M.; Koterayama, W. [Kyushu Univ., Fukuoka (Japan). Research Inst. for Applied Mechanics; Kajiwara, H. [Kyushu Institute of Technology, Kitakyushu (Japan). Faculty of Computer Science and System Engineering; Hyakudome, T. [Kyushu University, Fukuoka (Japan)
1996-12-31
Described herein are dynamics and model experiments of the system in which positioning of a floating marine structure by mooring is combined with thruster-controlled positioning. Coefficients of dynamic forces acting on a floating structure model are determined experimentally and by the three-dimensional singularity distribution method, and the controller is designed by the PID, LQI and H{infinity} control theories. A model having a scale ratio of 1/100 was used for the experiments, where 2 thrusters were arranged in a diagonal line, one on the X-axis. It is found that the LQI and H{infinity} controllers of the thruster can control long-cycle rolling of the floating structure. They allow thruster control which is insensitive to wave cycle motion, and efficiently reduce positioning energy. The H{infinity} control regulates frequency characteristics of a closed loop more finely than the LQI control, and exhibits better controllability. 25 refs., 25 figs.
50 KW Class Krypton Hall Thruster Performance
Jacobson, David T.; Manzella, David H.
2003-01-01
The performance of a 50-kilowatt-class Hall thruster designed for operation on xenon propellant was measured using kryton propellant. The thruster was operated at discharge power levels ranging from 6.4 to 72.5 kilowatts. The device produced thrust ranging from 0.3 to 2.5 newtons. The thruster was operated at discharge voltages between 250 and 1000 volts. At the highest anode mass flow rate and discharge voltage and assuming a 100 percent singly charged condition, the discharge specific impulse approached the theoretical value. Discharge specific impulse of 4500 seconds was demonstrated at a discharge voltage of 1000 volts. The peak discharge efficiency was 64 percent at 650 volts.
Weisheng, CUI; Wenzheng, LIU; Jia, TIAN; Xiuyang, CHEN
2018-02-01
At present, spark plugs are used to trigger discharge in pulsed plasma thrusters (PPT), which are known to be life-limiting components due to plasma corrosion and carbon deposition. A strong electric field could be formed in a cathode triple junction (CTJ) to achieve a trigger function under vacuum conditions. We propose an induction-triggered electrode structure on the basis of the CTJ trigger principle. The induction-triggered electrode structure could increase the electric field strength of the CTJ without changing the voltage between electrodes, contributing to a reduction in the electrode breakdown voltage. Additionally, it can maintain the plasma generation effect when the breakdown voltage is reduced in the discharge experiments. The induction-triggered electrode structure could ensure an effective trigger when the ablation distance of Teflon increases, and the magnetic field produced by the discharge current could further improve the plasma density and propagation velocity. The induction-triggered coaxial PPT we propose has a simplified trigger structure, and it is an effective attempt to optimize the micro-satellite thruster.
Garner, Charles E.; Jorns, Benjamin A.; van Derventer, Steven; Hofer, Richard R.; Rickard, Ryan; Liang, Raymond; Delgado, Jorge
2015-01-01
Hall thruster systems based on commercial product lines can potentially lead to lower cost electric propulsion (EP) systems for deep space science missions. A 4.5-kW SPT-140 Hall thruster presently under qualification testing by SSL leverages the substantial heritage of the SPT-100 being flown on Russian and US commercial satellites. The Jet Propulsion Laboratory is exploring the use of commercial EP systems, including the SPT-140, for deep space science missions, and initiated a program to evaluate the SPT-140 in the areas of low power operation and thruster operating life. A qualification model SPT-140 designated QM002 was evaluated for operation and plasma properties along channel centerline, from 4.5 kW to 0.8 kW. Additional testing was performed on a development model SPT-140 designated DM4 to evaluate operation with a Moog proportional flow control valve (PFCV). The PFCV was commanded by an SSL engineering model PPU-140 Power Processing Unit (PPU). Performance measurements on QM002 at 0.8 kW discharge power were 50 mN of thrust at a total specific impulse of 1250 s, a total thruster efficiency of 0.38, and discharge current oscillations of under 3% of the mean current. Steady-state operation at 0.8 kW was demonstrated during a 27 h firing. The SPT-140 DM4 was operated in closed-loop control of the discharge current with the PFCV and PPU over discharge power levels of 0.8-4.5 kW. QM002 and DM4 test data indicate that the SPT-140 design is a viable candidate for NASA missions requiring power throttling down to low thruster input power.
Magnetoelectrostatic thruster physical geometry tests
Ramsey, W. D.
1981-01-01
Inert gas tests are conducted with several magnetoelectrostatic containment discharge chamber geometries. The configurations tested include three discharge chamber lengths; three boundary magnet patterns; two different flux density magnet materials; hemispherical and conical shaped thrusters having different surface-to-volume ratios; and two and three grid ion optics. Argon mass utilizations of 60 to 79% are attained at 210 to 280 eV/ion in different test configurations. Short hemi thruster configurations are found to produce 70 to 92% xenon mass utilization at 185 to 220 eV/ion.
Anode Fall Formation in a Hall Thruster
International Nuclear Information System (INIS)
Dorf, Leonid A.; Raitses, Yevgeny F.; Smirnov, Artem N.; Fisch, Nathaniel J.
2004-01-01
As was reported in our previous work, accurate, nondisturbing near-anode measurements of the plasma density, electron temperature, and plasma potential performed with biased and emissive probes allowed the first experimental identification of both electron-repelling (negative anode fall) and electron-attracting (positive anode fall) anode sheaths in Hall thrusters. An interesting new phenomenon revealed by the probe measurements is that the anode fall changes from positive to negative upon removal of the dielectric coating, which appears on the anode surface during the course of Hall thruster operation. As reported in the present work, energy dispersion spectroscopy analysis of the chemical composition of the anode dielectric coating indicates that the coating layer consists essentially of an oxide of the anode material (stainless steel). However, it is still unclear how oxygen gets into the thruster channel. Most importantly, possible mechanisms of anode fall formation in a Hall thruster with a clean and a coated anodes are analyzed in this work; practical implication of understanding the general structure of the electron-attracting anode sheath in the case of a coated anode is also discussed
Polzin, Kurt A.
2016-01-01
CUBESATS are relatively new spacecraft platforms that are typically deployed from a launch vehicle as a secondary payload, providing low-cost access to space for a wide range of end-users. These satellites are comprised of building blocks having dimensions of 10x10x10 cu cm and a mass of 1.33 kg (a 1-U size). While providing low-cost access to space, a major operational limitation is the lack of a propulsion system that can fit within a CubeSat and is capable of executing high (Delta)v maneuvers. This makes it difficult to use CubeSats on missions requiring certain types of maneuvers (i.e. formation flying, spacecraft rendezvous). Recently, work has been performed investigating the use of iodine as a propellant for Hall-effect thrusters (HETs) 2 that could subsequently be used to provide a high specific impulse path to CubeSat propulsion. 3, 4 Iodine stores as a dense solid at very low pressures, making it acceptable as a propellant on a secondary payload. It has exceptionally high ?Isp (density times specific impulse), making it an enabling technology for small satellite near-term applications and providing the potential for systems-level advantages over mid-term high power electric propulsion options. Iodine flow can also be thermally regulated, subliming at relatively low temperature (engineering model propellant feed system for iSAT (see Fig. 1). The feed system is based around an iodine propellant reservoir and two proportional control valves (PFCVs) that meter the iodine flow to the cathode and anode. The flow is split upstream of the PFCVs to both components can be fed from a common reservoir. Testing of the reservoir is reported to demonstrate that the design is capable of delivering the required propellant flow rates to operate the thruster. The tubing and reservoir are fabricated from hastelloy to resist corrosion by the heated gaseous iodine propellant. The reservoir, tubing, and PFCVs are heated to ensure the sublimed propellant will not re
Stability test and analysis of the Space Shuttle Primary Reaction Control Subsystem thruster
Applewhite, John; Hurlbert, Eric; Krohn, Douglas; Arndt, Scott; Clark, Robert
1992-01-01
The results are reported of a test program conducted on the Space Shuttle Primary Reaction Control Subsystem thruster in order to investigate the effects of trapped helium bubbles and saturated propellants on stability, determine if thruster-to-thruster stability variations are significant, and determine stability under STS-representative conditions. It is concluded that the thruster design is highly reliable in flight and that burn-through has not occurred. Significantly unstable thrusters are screened out, and wire wrap is found to protect against chamber burn-throughs and to provide a fail-safe thruster for this situation.
MPD thruster research issues, activities, strategies
1991-01-01
The following activities and plans in the MPD thruster development are summarized: (1) experimental and theoretical research (magnetic nozzles at present and high power levels, MPD thrusters with applied fields extending into the thrust chamber, and improved electrode performance); and (2) tools (MACH2 code for MPD and nozzle flow calculation, laser diagnostics and spectroscopy for non-intrusive measurements of flow conditions, and extension to higher power). National strategies are also outlined.
Drag-Free Motion Control of Satellite for High-Precision Gravity Field Mapping
DEFF Research Database (Denmark)
Ziegler, Bent Lindvig; Blanke, Mogens
2002-01-01
High precision mapping of the geoid and the Earth's gravity field are of importance to a wide range of ongoing studies in areas like ocean circulation, solid Earth physics and ice sheet dynamics. Using a satellite in orbit around the Earth gives the opportunity to map the Earth's gravity field in 3...... will compromise measurement accuracy, unless they are accurately compensated by on-board thrusters. The paper concerns the design of a control system to performing such delicate drag compensation. A six degrees-of-freedom model for the satellite is developed with the model including dynamics of the satellite...
Low Frequency Plasma Oscillations in a 6-kW Magnetically Shielded Hall Thruster
Jorns, Benjamin A.; Hofery, Richard R.
2013-01-01
The oscillations from 0-100 kHz in a 6-kW magnetically shielded thruster are experimen- tally characterized. Changes in plasma parameters that result from the magnetic shielding of Hall thrusters have the potential to significantly alter thruster transients. A detailed investigation of the resulting oscillations is necessary both for the purpose of determin- ing the underlying physical processes governing time-dependent behavior in magnetically shielded thrusters as well as for improving thruster models. In this investigation, a high speed camera and a translating ion saturation probe are employed to examine the spatial extent and nature of oscillations from 0-100 kHz in the H6MS thruster. Two modes are identified at 8 kHz and 75-90 kHz. The low frequency mode is azimuthally uniform across the thruster face while the high frequency oscillation is concentrated close to the thruster centerline with an m = 1 azimuthal dependence. These experimental results are discussed in the context of wave theory as well as published observations from an unshielded variant of the H6MS thruster.
Effects of Enhanced Eathode Electron Emission on Hall Thruster Operation
International Nuclear Information System (INIS)
Raitses, Y.; Smirnov, A.; Fisch, N.J.
2009-01-01
Interesting discharge phenomena are observed that have to do with the interaction between the magnetized Hall thruster plasma and the neutralizing cathode. The steadystate parameters of a highly ionized thruster discharge are strongly influenced by the electron supply from the cathode. The enhancement of the cathode electron emission above its self-sustained level affects the discharge current and leads to a dramatic reduction of the plasma divergence and a suppression of large amplitude, low frequency discharge current oscillations usually related to an ionization instability. These effects correlate strongly with the reduction of the voltage drop in the region with the fringing magnetic field between the thruster channel and the cathode. The measured changes of the plasma properties suggest that the electron emission affects the electron cross-field transport in the thruster discharge. These trends are generalized for Hall thrusters of various configurations.
Thermo-mechanical design aspects of mercury bombardment ion thrusters.
Schnelker, D. E.; Kami, S.
1972-01-01
The mechanical design criteria are presented as background considerations for solving problems associated with the thermomechanical design of mercury ion bombardment thrusters. Various analytical procedures are used to aid in the development of thruster subassemblies and components in the fields of heat transfer, vibration, and stress analysis. Examples of these techniques which provide computer solutions to predict and control stress levels encountered during launch and operation of thruster systems are discussed. Computer models of specific examples are presented.
Design and Testing of a Hall Effect Thruster with Additively Manufactured Components
Hopping, Ethan
The UAH-78AM is a low-power Hall effect thruster developed at the University of Alabama in Huntsville to study the application of low-cost additive manufacturing in the design and fabrication of Hall thrusters. The goal of this project is to assess the feasibility of using unconventional materials to produce a low-cost functioning Hall effect thruster and consider how additive manufacturing can expand the design space and provide other benefits. The thruster features channel walls and a propellant distributor that were manufactured using 3D printing with a variety of materials including ABS, ULTEM, and glazed ceramic. A version of the thruster was tested at NASA Glenn Research Center to obtain performance metrics and to validate the ability of the thruster to produce thrust and sustain a discharge. The design of the thruster and the transient performance measurements are presented here. Measured thrust ranged from 17.2 mN to 30.4 mN over a discharge power of 280 W to 520 W with an anode Isp range of 870 s to 1450 s. Temperature limitations of materials used for the channel walls and propellant distributor limit the ability to run the thruster at thermal steady-state. While the current thruster design is not yet ready for continuous operation, revisions to the device that could enable longer duration tests are discussed.
High Power MPD Thruster Development at the NASA Glenn Research Center
LaPointe, Michael R.; Mikellides, Pavlos G.; Reddy, Dhanireddy (Technical Monitor)
2001-01-01
Propulsion requirements for large platform orbit raising, cargo and piloted planetary missions, and robotic deep space exploration have rekindled interest in the development and deployment of high power electromagnetic thrusters. Magnetoplasmadynamic (MPD) thrusters can effectively process megawatts of power over a broad range of specific impulse values to meet these diverse in-space propulsion requirements. As NASA's lead center for electric propulsion, the Glenn Research Center has established an MW-class pulsed thruster test facility and is refurbishing a high-power steady-state facility to design, build, and test efficient gas-fed MPD thrusters. A complimentary numerical modeling effort based on the robust MACH2 code provides a well-balanced program of numerical analysis and experimental validation leading to improved high power MPD thruster performance. This paper reviews the current and planned experimental facilities and numerical modeling capabilities at the Glenn Research Center and outlines program plans for the development of new, efficient high power MPD thrusters.
Electron Cross-field Transport in a Miniaturized Cylindrical Hall Thruster
International Nuclear Information System (INIS)
Smirnov Artem; Raitses Yevgeny; Fisch Nathaniel J
2005-01-01
Conventional annular Hall thrusters become inefficient when scaled to low power. Cylindrical Hall thrusters, which have lower surface-to-volume ratio, are more promising for scaling down. They presently exhibit performance comparable with conventional annular Hall thrusters. The present paper gives a review of the experimental and numerical investigations of electron crossfield transport in the 2.6 cm miniaturized cylindrical Hall thruster (100 W power level). We show that, in order to explain the discharge current observed for the typical operating conditions, the electron anomalous collision frequency ν b has to be on the order of the Bohm value, ν B ∼ ω c /16. The contribution of electron-wall collisions to cross-field transport is found to be insignificant. The optimal regimes of thruster operation at low background pressure (below 10 -5 Torr) in the vacuum tank appear to be different from those at higher pressure (∼ 10 -4 Torr)
Fault-Tolerant Region-Based Control of an Underwater Vehicle with Kinematically Redundant Thrusters
Directory of Open Access Journals (Sweden)
Zool H. Ismail
2014-01-01
Full Text Available This paper presents a new control approach for an underwater vehicle with a kinematically redundant thruster system. This control scheme is derived based on a fault-tolerant decomposition for thruster force allocation and a region control scheme for the tracking objective. Given a redundant thruster system, that is, six or more pairs of thrusters are used, the proposed redundancy resolution and region control scheme determine the number of thruster faults, as well as providing the reference thruster forces in order to keep the underwater vehicle within the desired region. The stability of the presented control law is proven in the sense of a Lyapunov function. Numerical simulations are performed with an omnidirectional underwater vehicle and the results of the proposed scheme illustrate the effectiveness in terms of optimizing the thruster forces.
Plasma Characterization of Hall Thruster with Active and Passive Segmented Electrodes
International Nuclear Information System (INIS)
Raitses, Y.; Staack, D.; Fisch, N.J.
2002-01-01
Non-emissive electrodes and ceramic spacers placed along the Hall thruster channel are shown to affect the plasma potential distribution and the thruster operation. These effects are associated with physical properties of the electrode material and depend on the electrode configuration, geometry and the magnetic field distribution. An emissive segmented electrode was able to maintain thruster operation by supplying an additional electron flux to sustain the plasma discharge between the anode and cathode neutralizer. These results indicate the possibility of new configurations for segmented electrode Hall thruster
The FAST (FRC Acceleration Space Thruster) Experiment
Martin, Adam; Eskridge, R.; Lee, M.; Richeson, J.; Smith, J.; Thio, Y. C. F.; Slough, J.; Rodgers, Stephen L. (Technical Monitor)
2001-01-01
The Field Reverse Configuration (FRC) is a magnetized plasmoid that has been developed for use in magnetic confinement fusion. Several of its properties suggest that it may also be useful as a thruster for in-space propulsion. The FRC is a compact toroid that has only poloidal field, and is characterized by a high plasma beta = (P)/(B (sup 2) /2Mu0), the ratio of plasma pressure to magnetic field pressure, so that it makes efficient use of magnetic field to confine a plasma. In an FRC thruster, plasmoids would be repetitively formed and accelerated to high velocity; velocities of = 250 km/s (Isp = 25,000s) have already been achieved in fusion experiments. The FRC is inductively formed and accelerated, and so is not subject to the problem of electrode erosion. As the plasmoid may be accelerated over an extended length, it can in principle be made very efficient. And the achievable jet powers should be scalable to the MW range. A 10 kW thruster experiment - FAST (FRC Acceleration Space Thruster) has just started at the Marshall Space Flight Center. The design of FAST and the status of construction and operation will be presented.
Experimental and theoretical studies of cylindrical Hall thrusters
International Nuclear Information System (INIS)
Smirnov, Artem; Raitses, Yegeny; Fisch, Nathaniel J.
2007-01-01
The Hall thruster is a mature electric propulsion device that holds considerable promise in terms of the propellant saving potential. The annular design of the conventional Hall thruster, however, does not naturally scale to low power. The efficiency tends to be lower and the lifetime issues are more aggravated. Cylindrical geometry Hall thrusters have lower surface-to-volume ratio than conventional thrusters and, thus, seem to be more promising for scaling down. The cylindrical Hall thruster (CHT) is fundamentally different from the conventional design in the way the electrons are confined and the ion space charge is neutralized. The performances of both the large (9-cm channel diameter, 600-1000 W) and miniaturized (2.6-cm channel diameter, 50-300 W) CHTs are comparable with those of the state-of-the-art conventional (annular) design Hall thrusters of similar sizes. A comprehensive experimental and theoretical study of the CHT physics has been conducted, addressing the questions of electron cross-field transport, propellant ionization, plasma-wall interaction, and formation of the electron distribution function. Probe measurements in the harsh plasma environment of the microthruster were performed. Several interesting effects, such as the unusually high ionization efficiency and enhanced electron transport, were observed. Kinetic simulations suggest the existence of the strong fluctuation-enhanced electron diffusion and predict the non-Maxwellian shape of the electron distribution function. Through the acquired understanding of the new physics, ways for further optimization of this means for low-power space propulsion are suggested. Substantial flexibility in the magnetic field configuration of the CHT is the key tool in achieving the high-efficiency operation
Greenberg, J. S.
1986-01-01
An economic evaluation and planning procedure which assesses the effects of various policies on fixed satellite business ventures is described. The procedure is based on a stochastic financial simulation model, the Domsat II, which evaluates spacecraft reliability, market performance, and cost uncertainties. The application of the Domsat II model to the assessment of NASA's ion thrusters for on-orbit propulsion and GaAs solar cell technology is discussed. The effects of insurance rates and the self-insurance option on the financial performance of communication satellite business ventures are investigated. The selection of a transportation system for placing the satellites into GEO is analyzed.
Theoretical and experimental study of a thruster discharging a weight
Michaels, Dan; Gany, Alon
2014-06-01
An innovative concept for a rocket type thruster that can be beneficial for spacecraft trajectory corrections and station keeping was investigated both experimentally and theoretically. It may also be useful for divert and attitude control systems (DACS). The thruster is based on a combustion chamber discharging a weight through an exhaust tube. Calculations with granular double-base propellant and a solid ejected weight reveal that a specific impulse based on the propellant mass of well above 400 s can be obtained. An experimental thruster was built in order to demonstrate the new idea and validate the model. The thruster impulse was measured both directly with a load cell and indirectly by using a pressure transducer and high speed photography of the weight as it exits the tube, with both ways producing very similar total impulse measurement. The good correspondence between the computations and the measured data validates the model as a useful tool for studying and designing such a thruster.
Mission and System Advantages of Iodine Hall Thrusters
Dankanich, John W.; Szabo, James; Pote, Bruce; Oleson, Steve; Kamhawi, Hani
2014-01-01
The exploration of alternative propellants for Hall thrusters continues to be of interest to the community. Investments have been made and continue for the maturation of iodine based Hall thrusters. Iodine testing has shown comparable performance to xenon. However, iodine has a higher storage density and resulting higher ?V capability for volume constrained systems. Iodine's vapor pressure is low enough to permit low-pressure storage, but high enough to minimize potential adverse spacecraft-thruster interactions. The low vapor pressure also means that iodine does not condense inside the thruster at ordinary operating temperatures. Iodine is safe, it stores at sub-atmospheric pressure, and can be stored unregulated for years on end; whether on the ground or on orbit. Iodine fills a niche for both low power (10kW) electric propulsion regimes. A range of missions have been evaluated for direct comparison of Iodine and Xenon options. The results show advantages of iodine Hall systems for both small and microsatellite application and for very large exploration class missions.
Optimization of a coaxial electron cyclotron resonance plasma thruster with an analytical model
Energy Technology Data Exchange (ETDEWEB)
Cannat, F., E-mail: felix.cannat@onera.fr, E-mail: felix.cannat@gmail.com; Lafleur, T. [Physics and Instrumentation Department, Onera -The French Aerospace Lab, Palaiseau, Cedex 91123 (France); Laboratoire de Physique des Plasmas, CNRS, Sorbonne Universites, UPMC Univ Paris 06, Univ Paris-Sud, Ecole Polytechnique, 91128 Palaiseau (France); Jarrige, J.; Elias, P.-Q.; Packan, D. [Physics and Instrumentation Department, Onera -The French Aerospace Lab, Palaiseau, Cedex 91123 (France); Chabert, P. [Laboratoire de Physique des Plasmas, CNRS, Sorbonne Universites, UPMC Univ Paris 06, Univ Paris-Sud, Ecole Polytechnique, 91128 Palaiseau (France)
2015-05-15
A new cathodeless plasma thruster currently under development at Onera is presented and characterized experimentally and analytically. The coaxial thruster consists of a microwave antenna immersed in a magnetic field, which allows electron heating via cyclotron resonance. The magnetic field diverges at the thruster exit and forms a nozzle that accelerates the quasi-neutral plasma to generate a thrust. Different thruster configurations are tested, and in particular, the influence of the source diameter on the thruster performance is investigated. At microwave powers of about 30 W and a xenon flow rate of 0.1 mg/s (1 SCCM), a mass utilization of 60% and a thrust of 1 mN are estimated based on angular electrostatic probe measurements performed downstream of the thruster in the exhaust plume. Results are found to be in fair agreement with a recent analytical helicon thruster model that has been adapted for the coaxial geometry used here.
Numerical simulation of SMART-1 Hall-thruster plasma interactions
Tajmar, Martin; Sedmik, René; Scharlemann, Carsten
2009-01-01
SMART-1 has been the first European mission using a Hall thruster to reach the moon. An onboard plasma diagnostic package allowed a detailed characterization of the thruster exhaust plasma and its interactions with the spacecraft. Analysis of in-flight data revealed, amongst others, an unpredicted
Performance prediction of electrohydrodynamic thrusters by the perturbation method
International Nuclear Information System (INIS)
Shibata, H.; Watanabe, Y.; Suzuki, K.
2016-01-01
In this paper, we present a novel method for analyzing electrohydrodynamic (EHD) thrusters. The method is based on a perturbation technique applied to a set of drift-diffusion equations, similar to the one introduced in our previous study on estimating breakdown voltage. The thrust-to-current ratio is generalized to represent the performance of EHD thrusters. We have compared the thrust-to-current ratio obtained theoretically with that obtained from the proposed method under atmospheric air conditions, and we have obtained good quantitative agreement. Also, we have conducted a numerical simulation in more complex thruster geometries, such as the dual-stage thruster developed by Masuyama and Barrett [Proc. R. Soc. A 469, 20120623 (2013)]. We quantitatively clarify the fact that if the magnitude of a third electrode voltage is low, the effective gap distance shortens, whereas if the magnitude of the third electrode voltage is sufficiently high, the effective gap distance lengthens.
Experimental Studies of Anode Sheath Phenomena in a Hall Thruster Discharge
International Nuclear Information System (INIS)
Dorf, L.; Raitses, Y.; Fisch, N.J.
2004-01-01
Both electron-repelling and electron-attracting anode sheaths in a Hall thruster were characterized by measuring the plasma potential with biased and emissive probes [L. Dorf, Y. Raitses, V. Semenov, and N.J. Fisch, Appl. Phys. Let. 84 (2004) 1070]. In the present work, two-dimensional structures of the plasma potential, electron temperature, and plasma density in the near-anode region of a Hall thruster with clean and dielectrically coated anodes are identified. Possible mechanisms of anode sheath formation in a Hall thruster are analyzed. The path for current closure to the anode appears to be the determining factor in the anode sheath formation process. The main conclusion of this work is that the anode sheath formation in Hall thrusters differs essentially from that in the other gas discharge devices, like a glow discharge or a hollow anode, because the Hall thruster utilizes long electron residence times to ionize rather than high neutral pressures
Operation of a Segmented Hall Thruster with Low-sputtering Carbon-velvet Electrodes
International Nuclear Information System (INIS)
Raitses, Y.; Staack, D.; Dunaevsky, A.; Fisch, N.J.
2005-01-01
Carbon fiber velvet material provides exceptional sputtering resistance properties exceeding those for graphite and carbon composite materials. A 2 kW Hall thruster with segmented electrodes made of this material was operated in the discharge voltage range of 200-700 V. The arcing between the floating velvet electrodes and the plasma was visually observed, especially, during the initial conditioning time, which lasted for about 1 h. The comparison of voltage versus current and plume characteristics of the Hall thruster with and without segmented electrodes indicates that the magnetic insulation of the segmented thruster improves with the discharge voltage at a fixed magnetic field. The observations reported here also extend the regimes wherein the segmented Hall thruster can have a narrower plume than that of the conventional nonsegmented thruster
Thermal stability of the krypton Hall effect thruster
Directory of Open Access Journals (Sweden)
Szelecka Agnieszka
2017-03-01
Full Text Available The Krypton Large IMpulse Thruster (KLIMT ESA/PECS project, which has been implemented in the Institute of Plasma Physics and Laser Microfusion (IPPLM and now is approaching its final phase, was aimed at incremental development of a ~500 W class Hall effect thruster (HET. Xenon, predominantly used as a propellant in the state-of-the-art HETs, is extremely expensive. Krypton has been considered as a cheaper alternative since more than fifteen years; however, to the best knowledge of the authors, there has not been a HET model especially designed for this noble gas. To address this issue, KLIMT has been geared towards operation primarily with krypton. During the project, three subsequent prototype versions of the thruster were designed, manufactured and tested, aimed at gradual improvement of each next exemplar. In the current paper, the heat loads in new engine have been discussed. It has been shown that thermal equilibrium of the thruster is gained within the safety limits of the materials used. Extensive testing with both gases was performed to compare KLIMT’s thermal behaviour when supplied with krypton and xenon propellants.
Parametric studies of the Hall Thruster at Soreq
International Nuclear Information System (INIS)
Ashkenazy, J.; Rattses, Y.; Appelbaum, G.
1997-01-01
An electric propulsion program was initiated at Soreq a few years ago, aiming at the research and development of advanced Hall thrusters for various space applications. The Hall thruster accelerates a plasma jet by an axial electric field and an applied radial magnetic field in an annular ceramic channel. A relatively large current density (> 0.1 A/cm 2 ) can be obtained, since the acceleration mechanism is not limited by space charge effects. Such a device can be used as a small rocket engine onboard spacecraft with the advantage of a large jet velocity compared with conventional rocket engines (10,000-30,000 m/s vs. 2,000-4,800 m/s). An experimental Hall thruster was constructed at Soreq and operated under a broad range of operating conditions and under various configurational variations. Electrical, magnetic and plasma diagnostics, as well as accurate thrust and gas flow rate measurements, have been used to investigate the dependence of thruster behavior on the applied voltage, gas flow rate, magnetic field, channel geometry and wall material. Representative results highlighting the major findings of the studies conducted so far are presented
Performance of a Cylindrical Hall-Effect Thruster Using Permanent Magnets
Polzin, Kurt A.; Raitses, Y.; Merino, E.; Fisch, N. J.
2009-01-01
While annular Hall thrusters can operate at high efficiency at kW power levels, it is difficult to construct one that operates over a broad envelope from 1 kW down to 100 W while maintaining an efficiency of 45-55%. Scaling to low power while holding the main dimensionless parameters constant requires a decrease in the thruster channel size and an increase in the magnetic field strength. Increasing the magnetic field becomes technically challenging since the field can saturate the miniaturized inner components of the magnetic circuit and scaling down the magnetic circuit leaves very little room for magnetic pole pieces and heat shields. In addition, the central magnetic pole piece defining the interior wall of the annular channel can experience excessive heat loads in a miniaturized Hall thruster, with the temperature eventually exceeding the Curie temperature of the material and in extreme circumstances leading to accelerated erosion of the channel wall. An alternative approach is to employ a cylindrical Hall thruster (CHT) geometry. Laboratory model CHTs have operated at power levels ranging from 50 W up to 1 kW. These thrusters exhibit performance characteristics that are comparable to conventional, annular Hall thrusters of similar size. Compared to the annular Hall thruster, the CHTs insulator surface area to discharge chamber volume ratio is lower. Consequently, there is the potential for reduced wall losses in the channel of a CHT, and any reduction in wall losses should translate into lower channel heating rates and reduced erosion, making the CHT geometry promising for low-power applications. This potential for high performance in the low-power regime has served as the impetus for research and development efforts aimed at understanding and improving CHT performance. Recently, a 2.6 cm channel diameter permanent magnet CHT (shown in Fig. 1) was tested. This thruster has the promise of reduced power consumption over previous CHT iterations that employed
Benet, Charles A.; Hofman, Henry; Williams, Thomas E.; Olney, Dave; Zaleski, Ronald
2011-01-01
Launched on April 4, 1983 onboard STS 6 (Space Shuttle Challenger), the First Tracking and Data Relay Satellite (TDRS 1) was retired above the Geosynchronous Orbit (GEO) on June 27, 2010 after having provided real-time communications with a variety of low-orbiting spacecraft over a 26-year period. To meet NASA requirements limiting orbital debris 1, a team of experts was assembled to conduct an End-Of-Mission (EOM) procedure to raise the satellite 350 km above the GEO orbit. Following the orbit raising via conventional station change maneuvers, the team was confronted with having to deplete the remaining propellant and passivate all energy storage or generation sources. To accomplish these tasks within the time window, communications (telemetry and control links), electrical power, propulsion, and thermal constraints, a spacecraft originally designed as a three-axis stabilized satellite was turned into a spinner. This paper (a companion paper to Innovative Approach Enabled the Retirement of TDRS 1, paper # 1699, IEEE 2011 Aerospace Conference, March 5-12, 2011 sup 2) focuses on the challenges of maintaining an acceptable spinning dynamics, while repetitively firing thrusters. Also addressed are the effects of thruster firings on the orbit characteristics and how they were mitigated by a careful scheduling of the fuel depletion operations. Periodic thruster firings for spin rate adjustment, nutation damping, and precession of the momentum vector were also required in order to maintain effective communications with the satellite. All operations were thoroughly rehearsed and supported by simulations thus lending a high level of confidence in meeting the NASA EOM goals.
Attitude Model of a Reaction Wheel/Fixed Thruster Based Satellite Using Telemetry Data
National Research Council Canada - National Science Library
Smith, Jason E
2005-01-01
.... While there are a multitude of ways to determine a satellite's orientation, very little research has been done on determining if the attitude of a satellite can be determined directly from telemetry...
Satellite cluster flight using on-off cyclic control
Zhang, Hao; Gurfil, Pini
2015-01-01
Nano-satellite clusters and disaggregated satellites are new concepts in the realm of distributed satellite systems, which require complex cluster management - mainly regulating the maximal and minimal inter-satellite distances on time scales of years - while utilizing simple on-off propulsion systems. The simple actuators and long time scales require judicious astrodynamical modeling coupled with specialized orbit control. This paper offers a satellite cluster orbit control law which works for long time scales in a perturbed environment while utilizing fixed-magnitude thrusters. The main idea is to design a distributed controller which balances the fuel consumption among the satellites, thus mitigating the effect of differential drag perturbations. The underlying methodology utilizes a cyclic control algorithm based on a mean orbital elements feedback. Stability properties of the closed-loop cyclic control system do not adhere to the classical Lyapunov stability theory, so an effort is made to define and implement a suitable stability theory of noncompact equilibria sets. A state selection scheme is proposed for efficiently establishing a low Earth orbit cluster. Several simulations, including a real mission study, and several comparative investigations, are performed to show the strengths of the proposed control law.
Prediction of plasma properties in mercury ion thrusters
Longhurst, G. R.
1978-01-01
A simplified theoretical model was developed which obtains to first order the plasma properties in the discharge chamber of a mercury ion thruster from basic thruster design and controllable operating parameters. The basic operation and design of ion thrusters is discussed, and the important processes which influence the plasma properties are described in terms of the design and control parameters. The conservation for mass, charge and energy were applied to the ion production region, which was defined as the region of the discharge chamber having as its outer boundary the surface of revolution of the innermost field line to intersect the anode. Mass conservation and the equations describing the various processes involved with mass addition and removal from the ion production region are satisfied by a Maxwellian electron density spatial distribution in that region.
Study on Endurance and Performance of Impregnated Ruthenium Catalyst for Thruster System.
Kim, Jincheol; Kim, Taegyu
2018-02-01
Performance and endurance of the Ru catalyst were studied for nitrous oxide monopropellant thruster system. The thermal decomposition of N2O requires a considerably high temperature, which make it difficult to be utilized as a thruster propellant, while the propellant decomposition temperature can be reduced by using the catalyst through the decomposition reaction with the propellant. However, the catalyst used for the thruster was frequently exposed to high temperature and high-pressure environment. Therefore, the state change of the catalyst according to the thruster operation was analyzed. Characterization of catalyst used in the operation condition of the thruster was performed using FE-SEM and EDS. As a result, performance degradation was occurred due to the volatilization of Ru catalyst and reduction of the specific surface area according to the phase change of Al2O3.
Oxygen-Methane Thruster, Phase II
National Aeronautics and Space Administration — Two main innovations will be developed in the Phase II effort that are fundamentally associated with our gaseous oxygen/gaseous methane RCS thruster. The first...
Kamhawi, Hani; Huang, Wensheng; Haag, Thomas; Yim, John; Herman, Daniel; Williams, George; Gilland, James; Peterson, Peter; Hofer, Richard; Mikellides, Ioannis
2016-01-01
NASAs Hall Effect Rocket with Magnetic Shielding (HERMeS) 12.5 kW Technology Demonstration Unit-1 (TDU-1) Hall thruster has been the subject of extensive technology maturation in preparation for flight system development. Part of the technology maturation effort included experimental evaluation of the TDU-1 thruster with conducting and dielectric front pole cover materials in two different electrical configurations. A graphite front pole cover thruster configuration with the thruster body electrically tied to cathode and an alumina front pole cover thruster configuration with the thruster body floating were evaluated. Both configurations were also evaluated at different facility background pressure conditions to evaluate background pressure effects on thruster operation. Performance characterization tests found that higher thruster performance was attained with the graphite front pole cover configuration with the thruster electrically tied to cathode. A total thrust efficiency of 68 and a total specific impulse of 2,820 s was demonstrated at a discharge voltage of 600 V and a discharge power of 12.5 kW. Thruster stability regimes were characterized with respect to the thruster discharge current oscillations and with maps of the current-voltage-magnetic field (IVB). Analysis of TDU-1 discharge current waveforms found that lower normalized discharge current peak-to-peak and root mean square magnitudes were attained when the thruster was electrically floated with alumina front pole covers. Background pressure effects characterization tests indicated that the thruster performance and stability was mostly invariant to changes in the facility background pressure for vacuum chamber pressure below 110-5 Torr-Xe (for thruster flow rate above 8 mgs). Power spectral density analysis of the discharge current waveform showed that increasing the vacuum chamber background pressure resulted in a higher discharge current dominant frequency. Finally the IVB maps of the TDU-1
H infinity controller design to a rigid-flexible satellite with two vibration modes
International Nuclear Information System (INIS)
De Souza, A G; De Souza, L C G
2015-01-01
The satellite attitude control system (ACS) design becomes more complex when the satellite structure has components like, flexible solar panels, antennas and mechanical manipulators. These flexible structures can interact with the satellite rigid parts during translational and/or rotational manoeuvre damaging the ACS pointing accuracy. Although, a well-designed controller can suppress such disturbances quickly, the controller error pointing may be limited by the minimum time necessary to suppress such disturbances thus affecting the satellite attitude acquisition. This paper deals with the rigid-flexible satellite ACS design using the H infinity method. The rigid-flexible satellite is represented by a beam connected to a central rigid hub at one end and free at the other one. The equations of motions are obtained considering small flexible deformations and the Euler-Bernoulli hypothesis. The results of the simulations have shown that the H-infinity controller was able to control the rigid motion and suppress the vibrations. (paper)
Low-Cost, High-Performance Hall Thruster Support System
Hesterman, Bryce
2015-01-01
Colorado Power Electronics (CPE) has built an innovative modular PPU for Hall thrusters, including discharge, magnet, heater and keeper supplies, and an interface module. This high-performance PPU offers resonant circuit topologies, magnetics design, modularity, and a stable and sustained operation during severe Hall effect thruster current oscillations. Laboratory testing has demonstrated discharge module efficiency of 96 percent, which is considerably higher than current state of the art.
Thermal Environmental Testing of NSTAR Engineering Model Ion Thrusters
Rawlin, Vincent K.; Patterson, Michael J.; Becker, Raymond A.
1999-01-01
NASA's New Millenium program will fly a xenon ion propulsion system on the Deep Space 1 Mission. Tests were conducted under NASA's Solar Electric Propulsion Technology Applications Readiness (NSTAR) Program with 3 different engineering model ion thrusters to determine thruster thermal characteristics over the NSTAR operating range in a variety of thermal environments. A liquid nitrogen-cooled shroud was used to cold-soak the thruster to -120 C. Initial tests were performed prior to a mature spacecraft design. Those results and the final, severe, requirements mandated by the spacecraft led to several changes to the basic thermal design. These changes were incorporated into a final design and tested over a wide range of environmental conditions.
NSTAR Ion Thruster and Breadboard Power Processor Functional Integration Test Results
Hamley, John A.; Pinero, Luis R.; Rawlin, Vincent K.; Miller, John R.; Myers, Roger M.; Bowers, Glen E.
1996-01-01
A 2.3 kW Breadboard Power Processing Unit (BBPPU) was developed as part of the NASA Solar Electric Propulsion Technology Application Readiness (NSTAR) Program. The NSTAR program will deliver an electric propulsion system based on a 30 cm xenon ion thruster to the New Millennium (NM) program for use as the primary propulsion system for the initial NM flight. The final development test for the BBPPU, the Functional Integration Test, was carried out to demonstrate all aspects of BBPPU operation with an Engineering Model Thruster. Test objectives included: (1) demonstration and validation of automated thruster start procedures, (2) demonstration of stable closed loop control of the thruster beam current, (3) successful response and recovery to thruster faults, and (4) successful safing of the system during simulated spacecraft faults. These objectives were met over the specified 80-120 VDC input voltage range and 0.5-2.3 output power capability of the BBPPU. Two minor anomalies were noted in discharge and neutralizer keeper current. These anomalies did not affect the stability of the system and were successfully corrected.
Development of HAN-based Liquid Propellant Thruster
Hisatsune, K.; Izumi, J.; Tsutaya, H.; Furukawa, K.
2004-10-01
Many of propellants that are applied to the conventional spacecraft propulsion system are toxic propellants. Because of its toxicity, considering the environmental pollution or safety on handling, it will be necessary to apply the "green" propellant to the spacecraft propulsion system. The purpose of this study is to apply HAN based liquid propellant (LP1846) to mono propellant thruster. Compared to the hydrazine that is used in conventional mono propellant thruster, HAN based propellant is not only lower toxic but also can obtain higher specific impulse. Moreover, HAN based propellant can be decomposed by the catalyst. It means there are the possibility of applying to the mono propellant thruster that can leads to the high reliability of the propulsion system.[1],[2] However, there are two technical subjects, to apply HAN based propellant to the mono propellant thruster. One is the high combustion temperature. The catalyst will be damaged under high temperature condition. The other is the low catalytic activity. It is the serious problem on application of HAN based propellant to the mono propellant thruster that is used for attitude control of spacecraft. To improve the catalytic activity of HAN based propellant, it is necessary to screen the best catalyst for HAN based propellant. The adsorption analysis is conducted by Monte Carlo Simulation to screen the catalyst metal for HAN and TEAN. The result of analysis shows the Iridium is the best catalyst metal for HAN and TEAN. Iridium is the catalyst metal that is used at conventional mono propellant thruster catalyst Shell405. Then, to confirm the result of analysis, the reaction test about catalyst is conducted. The result of this test is the same as the result of adsorption analysis. That means the adsorption analysis is effective in screening the catalyst metal. At the evaluating test, the various types of carrier of catalyst are also compared to Shell 405 to improve catalytic activity. The test result shows the
Retrofit and acceptance test of 30-cm ion thrusters
Poeschel, R. L.
1981-01-01
Six 30 cm mercury thrusters were modified to the J-series design and evaluated using standardized test procedures. The thruster performance meets the design objectives (lifetime objective requires verification), and documentation (drawings, etc.) for the design is completed and upgraded. The retrofit modifications are described and the test data for the modifications are presented and discussed.
Optical Diagnostic Characterization of High-Power Hall Thruster Wear and Operation
Williams, George J., Jr.; Soulas, George C.; Kamhawi, Hani
2012-01-01
Optical emission spectroscopy is employed to correlate BN insulator erosion with high-power Hall thruster operation. Specifically, actinometry leveraging excited xenon states is used to normalize the emission spectra of ground state boron as a function of thruster operating condition. Trends in the strength of the boron signal are correlated with thruster power, discharge voltage, and discharge current. In addition, the technique is demonstrated on metallic coupons embedded in the walls of the HiVHAc EM thruster. The OES technique captured the overall trend in the erosion of the coupons which boosts credibility in the method since there are no data to which to calibrate the erosion rates of high-power Hall thrusters. The boron signals are shown to trend linearly with discharge voltage for a fixed discharge current as expected. However, the boron signals of the higher-power NASA 300M and NASA 457Mv2 trend with discharge current and show an unexpectedly weak to inverse dependence on discharge voltage. Electron temperatures measured optically in the near-field plume of the thruster agree well with Langmuir probe data. However, the optical technique used to determine Te showed unacceptable sensitivity to the emission intensities. Near-field, single-frequency imaging of the xenon neutrals is also presented as a function of operating condition for the NASA 457 Mv2.
The Plasmoid Thruster Experiment (PTX)
Eskridge, Richard; Martin, Adam; Koelfgen, Syri; Lee, Mike; Smith, James W.
2003-01-01
A plasmoid is a compact plasma structure with an integral magnetic field. They have been studied extensively in controlled fusion research and are categorized according to the relative strength of the poloidal and toroidal magnetic field (B(phi), and B(tau), respectively). An object with B(phi)/B(tau) >> 1 is classified as a Field Reverse Configuration (FRC); if B(phi) = B(tau), it is called a Spheromak. There are a number of possible advantages to using accelerated plasmoids for in-space propulsion. A thruster based on this concept would operate by repetitively producing plasmoids and ejecting them from the device at high velocity. The plasmoid is formed inside of a single turn conical theta-pinch coil; as this process is inductive, there are no life-limiting electrodes. Similar experiments have yielded plasmoid velocities of at least 50 km/s (l), and calculations indicate that velocities in excess of 100 km/s are possible. A thruster based on this concept would be capable of producing an I(sp) in the range of 5,000 - 10,OOO s, with thrust densities of order 10(exp 5) N/m(exp 2). The current experiment is designed to produce jet powers in the range of 5-10 kW, although the concept should be scalable to higher power. The purpose of this experiment is to determine the feasibility of this plasma propulsion concept. To accomplish this, it will be necessary to determine: a.) specific impulse and thrust, b.) efficiency and mass utilization, c.) which type of plasmoid (FRC-like or Spheromak-like) gives the best performance, and d.) the characteristics required of actual thruster components (i.e., switch and capacitor technology). The plasmoid mass and velocity will be measured with a variety of diagnostics, including internal and external B-dot probes, flux loops, Langmuir probes, high-speed cameras, and an interferometer. Simulations of the plasmoid thruster using MOQUI, a time dependent MHD code, will be carried out concurrently with experimental testing. The PTX
DESIGN AND DEVELOPMENT OF AUTO DEPTH CONTROL OF REMOTELY OPERATED VEHICLE USING THRUSTER SYSTEM
Directory of Open Access Journals (Sweden)
F.A. Ali
2014-12-01
Full Text Available Remotely Operated Vehicles are underwater robots designed specifically for surveillance, monitoring and collecting data for underwater activities. In the underwater vehicle industries, the thruster is an important part in controlling the direction, depth and speed of the ROV. However, there are some ROVs that cannot be maintained at the specified depth for a long time because of disturbance. This paper proposes an auto depth control using a thruster system. A prototype of a thruster with an auto depth control is developed and attached to the previously fabricated UTeM ROV. This paper presents the operation of auto depth control as well as thrusters for submerging and emerging purposes and maintaining the specified depth. The thruster system utilizes a microcontroller as its brain, a piezoresistive strain gauge pressure sensor and a DC brushless motor to run the propeller. Performance analysis of the auto depth control system is conducted to identify the sensitivity of the pressure sensor, and the accuracy and stability of the system. The results show that the thruster system performs well in maintaining a specified depth as well as stabilizing itself when a disturbanceoccurs even with a simple proportional controller used to control the thruster, where the thruster is an important component of the ROV.
Electric arc discharge damage to ion thruster grids
Beebe, D. D.; Nakanishi, S.; Finke, R. C.
1974-01-01
Arcs representative of those occurring between the grids of a mercury ion thruster were simulated. Parameters affecting an arc and the resulting damage were studied. The parameters investigated were arc energy, arc duration, and grid geometry. Arc attenuation techniques were also investigated. Potentially serious damage occurred at all energy levels representative of actual thruster operating conditions. Of the grids tested, the lowest open-area configuration sustained the least damage for given conditions. At a fixed energy level a long duration discharge caused greater damage than a short discharge. Attenuation of arc current using various impedances proved to be effective in reducing arc damage. Faults were also deliberately caused using chips of sputtered materials formed during the operation of an actual thruster. These faults were cleared with no serious grid damage resulting using the principles and methods developed in this study.
Performance Test Results of the NASA-457M v2 Hall Thruster
Soulas, George C.; Haag, Thomas W.; Herman, Daniel A.; Huang, Wensheng; Kamhawi, Hani; Shastry, Rohit
2012-01-01
Performance testing of a second generation, 50 kW-class Hall thruster labeled NASA-457M v2 was conducted at the NASA Glenn Research Center. This NASA-designed thruster is an excellent candidate for a solar electric propulsion system that supports human exploration missions. Thruster discharge power was varied from 5 to 50 kW over discharge voltage and current ranges of 200 to 500 V and 15 to 100 A, respectively. Anode efficiencies varied from 0.56 to 0.71. The peak efficiency was similar to that of other state-of-the-art high power Hall thrusters, but outperformed these thrusters at lower discharge voltages. The 0.05 to 0.18 higher anode efficiencies of this thruster compared to its predecessor were primarily due to which of two stable discharge modes the thruster was operated. One stable mode was at low magnetic field strengths, which produced high anode efficiencies, and the other at high magnetic fields where its predecessor was operated. Cathode keeper voltages were always within 2.1 to 6.2 V and cathode voltages were within 13 V of tank ground during high anode efficiency operation. However, during operation at high magnetic fields, cathode-to-ground voltage magnitudes increased dramatically, exceeding 30 V, due to the high axial magnetic field strengths in the immediate vicinity of the centrally-mounted cathode. The peak thrust was 2.3 N and this occurred at a total thruster input power of 50.0 kW at a 500 V discharge voltage. The thruster demonstrated a thrust-to-power range of 76.4 mN/kW at low power to 46.1 mN/kW at full power, and a specific impulse range of 1420 to 2740 s. For a discharge voltage of 300 V, where specific impulses would be about 2000 s, thrust efficiencies varied from 0.57 to 0.63.
Analysis of state-of-the-art single-thruster attitude control techniques for spinning penetrator
Raus, Robin; Gao, Yang; Wu, Yunhua; Watt, Mark
2012-07-01
The attitude dynamics and manoeuvre survey in this paper is performed for a mission scenario involving a penetrator-type spacecraft: an axisymmetric prolate spacecraft spinning around its minor axis of inertia performing a 90° spin axis reorientation manoeuvre. In contrast to most existing spacecraft only one attitude control thruster is available, providing a control torque perpendicular to the spin axis. Having only one attitude thruster on a spinning spacecraft could be preferred for spacecraft simplicity (lower mass, lower power consumption etc.), or it could be imposed in the context of redundancy/contingency operations. This constraint does yield restrictions on the thruster timings, depending on the ratio of minor to major moments of inertia among other parameters. The Japanese Lunar-A penetrator spacecraft proposal is a good example of such a single-thruster spin-stabilised prolate spacecraft. The attitude dynamics of a spinning rigid body are first investigated analytically, then expanded for the specific case of a prolate and axisymmetric rigid body and finally a cursory exploration of non-rigid body dynamics is made. Next two well-known techniques for manoeuvring a spin-stabilised spacecraft, the Half-cone/Multiple Half-cone and the Rhumb line slew, are compared with two new techniques, the Sector-Arc Slew developed by Astrium Satellites and the Dual-cone developed at Surrey Space Centre. Each technique is introduced and characterised by means of simulation results and illustrations based on the penetrator mission scenario and a brief robustness analysis is performed against errors in moments of inertia and spin rate. Also, the relative benefits of each slew algorithm are discussed in terms of slew accuracy, energy (propellant) efficiency and time efficiency. For example, a sequence of half-cone manoeuvres (a Multi-half-cone manoeuvre) tends to be more energy-efficient than one half-cone for the same final slew angle, but more time-consuming. As another
Effects of cusped field thruster on the performance of drag-free control system
Cui, K.; Liu, H.; Jiang, W. J.; Sun, Q. Q.; Hu, P.; Yu, D. R.
2018-03-01
With increased measurement tasks of space science, more requirements for the spacecraft environment have been put forward. Those tasks (e.g. the measurement of Earth's steady state gravity field anomalies) lead to the desire for developing drag-free control. Higher requirements for the thruster performance are made due to the demand for the drag-free control system and real-time compensation for non-conservative forces. Those requirements for the propulsion system include wide continuous throttling ability, high resolution, rapid response, low noise and so on. As a promising candidate, the cusped field thruster has features such as the high working stability, the low erosion rate, a long lifetime and the simple structure, so that it is chosen as the thruster to be discussed in this paper. Firstly, the performance of a new cusped field thruster is tested and analyzed. Then a drag-free control scheme based on the cusped field thruster is designed to evaluate the performance of this thruster. Subsequently, the effects of the thrust resolution, transient response time and thrust uncertainty on the controller are calculated respectively. Finally, the performance of closed-loop system is analyzed, and the simulation results verify the feasibility of applying cusped field thruster to drag-free flight in the space science measurement tasks.
Satellite Attitude Control System Simulator
Directory of Open Access Journals (Sweden)
G.T. Conti
2008-01-01
Full Text Available Future space missions will involve satellites with great autonomy and stringent pointing precision, requiring of the Attitude Control Systems (ACS with better performance than before, which is function of the control algorithms implemented on board computers. The difficulties for developing experimental ACS test is to obtain zero gravity and torque free conditions similar to the SCA operate in space. However, prototypes for control algorithms experimental verification are fundamental for space mission success. This paper presents the parameters estimation such as inertia matrix and position of mass centre of a Satellite Attitude Control System Simulator (SACSS, using algorithms based on least square regression and least square recursive methods. Simulations have shown that both methods have estimated the system parameters with small error. However, the least square recursive methods have performance more adequate for the SACSS objectives. The SACSS platform model will be used to do experimental verification of fundamental aspects of the satellite attitude dynamics and design of different attitude control algorithm.
The radiofrequency ion thruster assembly (RITA) intended for service aboard the new Artemis communications satellite will operate for three hours twice a day, in order to furnish orbital position adjustments that keep antennas accurately pointed toward the earth. These engines are, despite such frequent and sustained use, projected to eject no more than 30 kG of Xe over the course of a decade. RITA operation is also extremely reliable and, due to its very low propellant consumption, is the basis of a long satellite service life. RITA will be among the 15 experiments that are to be performed by ESA's Eureca research satellite.
Plasma property and performance prediction for mercury ion thrusters
Longhurst, G. R.; Wilbur, P. J.
1979-01-01
The discharge chambers of mercury ion thrusters are modelled so the principal effects and processes which govern discharge plasma properties and thruster performance are described. The conservation relations for mass, charge and energy when applied to the Maxwellian electron population in the ion production region yield equations which may be made one-dimensional by the proper choice of coordinates. Solutions to these equations with the appropriate boundary conditions give electron density and temperature profiles which agree reasonably well with measurements. It is then possible to estimate plasma properties from thruster design data and those operating parameters which are directly controllable. By varying the operating parameter inputs to the computer code written to solve these equations, perfromance curves are obtained which agree quite well with measurements.
Ion ejection from a permanent-magnet mini-helicon thruster
Energy Technology Data Exchange (ETDEWEB)
Chen, Francis F. [Electrical Engineering Department, University of California, Los Angeles 90095-1594 (United States)
2014-09-15
A small helicon source, 5 cm in diameter and 5 cm long, using a permanent magnet (PM) to create the DC magnetic field B, is investigated for its possible use as an ion spacecraft thruster. Such ambipolar thrusters do not require a separate electron source for neutralization. The discharge is placed in the far-field of the annular PM, where B is fairly uniform. The plasma is ejected into a large chamber, where the ion energy distribution is measured with a retarding-field energy analyzer. The resulting specific impulse is lower than that of Hall thrusters but can easily be increased to relevant values by applying to the endplate of the discharge a small voltage relative to spacecraft ground.
An evaluation of krypton propellant in Hall thrusters
Linnell, Jesse Allen
Due to its high specific impulse and low price, krypton has long sparked interest as an alternate Hall thruster propellant. Unfortunately at the moment, krypton's relatively poor performance precludes it as a legitimate option. This thesis presents a detailed investigation into krypton operation in Hall thrusters. These findings suggest that the performance gap can be decreased to 4% and krypton can finally become a realistic propellant option. Although krypton has demonstrated superior specific impulse, the xenon-krypton absolute efficiency gap ranges between 2 and 15%. A phenomenological performance model indicates that the main contributors to the efficiency gap are propellant utilization and beam divergence. Propellant utilization and beam divergence have relative efficiency deficits of 5 and 8%, respectively. A detailed characterization of internal phenomena is conducted to better understand the xenon-krypton efficiency gap. Krypton's large beam divergence is found to be related to a defocusing equipotential structure and a weaker magnetic field topology. Ionization processes are shown to be linked to the Hall current, the magnetic mirror topology, and the perpendicular gradient of the magnetic field. Several thruster design and operational suggestions are made to optimize krypton efficiency. Krypton performance is optimized for discharge voltages above 500 V and flow rates corresponding to an a greater than 0.015 mg/(mm-s), where alpha is a function of flow rate and discharge channel dimensions (alpha = m˙alphab/Ach). Performance can be further improved by increasing channel length or decreasing channel width for a given flow rate. Also, several magnetic field design suggestions are made to enhance ionization and beam focusing. Several findings are presented that improve the understanding of general Hall thruster physics. Excellent agreement is shown between equipotential lines and magnetic field lines. The trim coil is shown to enhance beam focusing
Integrated Stirling Convertor and Hall Thruster Test Conducted
Mason, Lee S.
2002-01-01
An important aspect of implementing Stirling Radioisotope Generators on future NASA missions is the integration of the generator and controller with potential spacecraft loads. Some recent studies have indicated that the combination of Stirling Radioisotope Generators and electric propulsion devices offer significant trip time and payload fraction benefits for deep space missions. A test was devised to begin to understand the interactions between Stirling generators and electric thrusters. An electrically heated RG- 350 (350-W output) Stirling convertor, designed and built by Stirling Technology Company of Kennewick, Washington, under a NASA Small Business Innovation Research agreement, was coupled to a 300-W SPT-50 Hall-effect thruster built for NASA by the Moscow Aviation Institute (RIAME). The RG-350 and the SPT-50 shown, were installed in adjacent vacuum chamber ports at NASA Glenn Research Center's Electric Propulsion Laboratory, Vacuum Facility 8. The Stirling electrical controller interfaced directly with the Hall thruster power-processing unit, both of which were located outside of the vacuum chamber. The power-processing unit accepted the 48 Vdc output from the Stirling controller and distributed the power to all the loads of the SPT-50, including the magnets, keeper, heater, and discharge. On February 28, 2001, the Glenn test team successfully operated the Hall-effect thruster with the Stirling convertor. This is the world's first known test of a dynamic power source with electric propulsion. The RG-350 successfully managed the transition from the purely resistive load bank within the Stirling controller to the highly capacitive power-processing unit load. At the time of the demonstration, the Stirling convertor was operating at a hot temperature of 530 C and a cold temperature of -6 C. The linear alternator was producing approximately 250 W at 109 Vac, while the power-processing unit was drawing 175 W at 48 Vdc. The majority of power was delivered to the
Zeng, Hui; Ou, Dongbin; Chen, Lianzhong; Li, Fei; Yu, Xilong
2018-02-01
Nonintrusive temperature measurements for a real ammonium dinitramide (ADN)-based thruster by using tunable diode laser absorption spectroscopy and monochromatic radiation thermometry are proposed. The ADN-based thruster represents a promising future space propulsion employing green, nontoxic propellant. Temperature measurements in the chamber enable quantitative thermal analysis for the thruster, providing access to evaluate thermal properties of the thruster and optimize thruster design. A laser-based sensor measures temperature of combustion gas in the chamber, while a monochromatic thermometry system based on thermal radiation is utilized to monitor inner wall temperature in the chamber. Additional temperature measurements of the outer wall temperature are conducted on the injector, catalyst bed, and combustion chamber of the thruster by using thermocouple, respectively. An experimental ADN thruster is redesigned with optimizing catalyst bed length of 14 mm and steady-state firing tests are conducted under various feed pressures over the range from 5 to 12 bar at a typical ignition temperature of 200°C. A threshold of feed pressure higher than 8 bar is required for the thruster's normal operation and upstream movement of the heat release zone is revealed in the combustion chamber out of temperature evolution in the chamber.
The development of the micro-solid propellant thruster array with improved repeatability
International Nuclear Information System (INIS)
Seo, Daeban; Kwon, Sejin; Lee, Jongkwang
2012-01-01
This paper presents the development of a micro-solid propellant thruster array with improved repeatability. The repeatability and low performance variation of each thruster unit with a high ignition success rate is essential in micro-solid propellant thruster array. To date, the study on the improvement of the repeatability has not yet been reported. As the first step for this study, we propose a new type of micro igniter, using a glass wafer called the heater-contact micro igniter. This igniter is also designed to improve the ignition characteristics of a glass-based micro igniter. The prototype of the igniter array is designed and fabricated to establish its fabrication process and to conduct its performance evaluation. Through the firing test, the performance of the heater-contact micro igniter is verified. The 5 × 5 sized micro-solid propellant thruster array is designed and fabricated applying the developed heater-contact igniter. The measured average thrust of each thruster unit is 2.542 N, and calculated standard deviation is 0.369 N. The calculated average total impulse and its standard deviation are 0.182 and 0.04 mNs, respectively. Based on these results, the improvement of repeatability is verified. Finally, the ignition control system of the micro-thruster array is developed. (paper)
Improvement of Flow Characteristics for an Advanced Plasma Thruster
International Nuclear Information System (INIS)
Inutake, M.; Hosokawa, Y.; Sato, R.; Ando, A.; Tobari, H.; Hattori, K.
2005-01-01
A higher specific impulse and a larger thrust are required for a manned interplanetary space thruster. Until the realization of a fusion-plasma thruster, a magneto-plasma-dynamic arcjet (MPDA) powered by a fission reactor is one of the promising candidates for a manned Mars space thruster. The MPDA plasma is accelerated axially by a self-induced j x B force. Thrust performance of the MPDA is expected to increase by applying a magnetic nozzle instead of a solid nozzle. In order to get a much higher thruster performance, two methods have been investigated in the HITOP device, Tohoku University. One is to use a magnetic Laval nozzle in the vicinity of the MPDA muzzle for converting the high ion thermal energy to the axial flow energy. The other is to heat ions by use of an ICRF antenna in the divergent magnetic nozzle. It is found that by use of a small-sized Laval-type magnetic nozzle, the subsonic flow near the muzzle is converted to be supersonic through the magnetic Laval nozzle. A fast-flowing plasma is successfully heated by use of an ICRF antenna in the magnetic beach configuration
Brayton-Cycle Power-Conversion Unit Tested With Ion Thruster
Hervol, David S.
2005-01-01
Nuclear electric propulsion has been identified as an enabling technology for future NASA space science missions, such as the Jupiter Icy Moons Orbiter (JIMO) now under study. An important element of the nuclear electric propulsion spacecraft is the power conversion system, which converts the reactor heat to electrical power for use by the ion propulsion system and other spacecraft loads. The electrical integration of the power converter and ion thruster represents a key technical challenge in making nuclear electric propulsion technology possible. This technical hurdle was addressed extensively on December 1, 2003, when a closed- Brayton-cycle power-conversion unit was tested with a gridded ion thruster at the NASA Glenn Research Center. The test demonstrated end-to-end power throughput and marked the first-ever coupling of a Brayton turbo alternator and a gridded ion thruster, both of which are candidates for use on JIMO-type missions. The testing was conducted at Glenn's Vacuum Facility 6, where the Brayton unit was installed in the 3-m-diameter vacuum test port and the ion thruster was installed in the 7.6-m-diameter main chamber.
Empirical electron cross-field mobility in a Hall effect thruster
International Nuclear Information System (INIS)
Garrigues, L.; Perez-Luna, J.; Lo, J.; Hagelaar, G. J. M.; Boeuf, J. P.; Mazouffre, S.
2009-01-01
Electron transport across the magnetic field in Hall effect thrusters is still an open question. Models have so far assumed 1/B 2 or 1/B scaling laws for the 'anomalous' electron mobility, adjusted to reproduce the integrated performance parameters of the thruster. We show that models based on such mobility laws predict very different ion velocity distribution functions (IVDF) than measured by laser induced fluorescence (LIF). A fixed spatial mobility profile, obtained by analysis of improved LIF measurements, leads to much better model predictions of thruster performance and IVDF than 1/B 2 or 1/B mobility laws for discharge voltages in the 500-700 V range.
Carbon Nanotube Based Electric Propulsion Thruster with Low Power Consumption, Phase I
National Aeronautics and Space Administration — This SBIR project is to develop field emission electric propulsion (FEEP) thruster using carbon nanotubes (CNT) integrated anode. FEEP thrusters have gained...
Pulsed inductive thruster performance data base for megawatt-class engine applications
International Nuclear Information System (INIS)
Dailey, C.L.; Lovberg, R.H.
1993-01-01
The pulsed inductive thruster (PIT) is an electrodeless plasma accelerator employing a large (1m diameter) spiral coil energized by a capacitor bank discharge. The bank can be repetitively recharged by a nuclear electric generator for continuous MW level operation. The coil can be designed as a transformer that permits thruster operation at the generator voltage, which results in a low thruster specific mass. Specific impulse (I sp ) can be readily altered by changing the propellant valve plenum pressure. Performance curves generated from mesausred impulse, injected mass and capacitor bank energy are presented for argon, ammonia, hydrazine, carbon dioxide and helium. The highest performance measured to date is 48% efficiency at 4000 seconds I sp with ammonia. The development of a theoretical model of the thruster, which assumes a fully ionized plasma, is presented in an appendix
Testing of an Arcjet Thruster with Capability of Direct-Drive Operation
Martin, Adam K.; Polzin, Kurt A.; Eskridge, Richard H.; Smith, James W.; Schoenfeld, Michael P.; Riley, Daniel P.
2015-01-01
Electric thrusters typically require a power processing unit (PPU) to convert the spacecraft provided power to the voltage-current that a thruster needs for operation. Testing has been initiated to study whether an arcjet thruster can be operated directly with the power produced by solar arrays without any additional conversion. Elimination of the PPU significantly reduces system-level complexity of the propulsion system, and lowers developmental cost and risk. The work aims to identify and address technical questions related to power conditioning and noise suppression in the system and heating of the thruster in long-duration operation. The apparatus under investigation has a target power level from 400-1,000 W. However, the proposed direct-drive arcjet is potentially a highly scalable concept, applicable to solar-electric spacecraft with up to 100's of kW and beyond. A direct-drive electric propulsion system would be comprised of a thruster that operates with the power supplied directly from the power source (typically solar arrays) with no further power conditioning needed between those two components. Arcjet thrusters are electric propulsion devices, with the power supplied as a high current at low voltage; of all the different types of electric thruster, they are best suited for direct drive from solar arrays. One advantage of an arcjet over Hall or gridded ion thrusters is that for comparable power the arcjet is a much smaller device and can provide more thrust and orders of magnitude higher thrust density (approximately 1-10 N/sq m), albeit at lower I(sub sp) (approximately 800-1000 s). In addition, arcjets are capable of operating on a wide range of propellant options, having been demonstrated on H2, ammonia, N2, Ar, Kr, Xe, while present SOA Hall and ion thrusters are primarily limited to Xe propellant. Direct-drive is often discussed in terms of Hall thrusters, but they require 250-300 V for operation, which is difficult even with high-voltage solar
Mathematical Modeling of Liquid-fed Pulsed Plasma Thruster
Directory of Open Access Journals (Sweden)
Kaartikey Misra
2018-01-01
Full Text Available Liquid propellants are fast becoming attractive for pulsed plasma thrusters due to their high efficiency and low contamination issues. However, the complete plasma interaction and acceleration processes are still not very clear. Present paper develops a multi-layer numerical model for liquid propellant PPTs (pulsed plasma thrusters. The model is based on a quasi-steady flow assumption. The model proposes a possible acceleration mechanism for liquid-fed pulsed plasma thrusters and accurately predicts the propellant utilization capabilities and estimations for the fraction of propellant gas that is completely ionized and accelerated to high exit velocities. Validation of the numerical model and the assumptions on which the model is based on is achieved by comparing the experimental results and the simulation results for two different liquid-fed thrusters developed at the University of Tokyo. Simulation results shows that up-to 50 % of liquid propellant injected is completely ionized and accelerated to high exit velocities (>50 Km/s, whereas, neutral gas contribute to only 7 % of the total specific impulse and accelerated to low exit velocity (<4 Km/s. The model shows an accuracy up-to 92 % . Optimization methods are briefly discussed to ensure efficient propellant utilization and performance. The model acts as a tool to understand the background physics and to optimize the performance for liquid-fed PPTs.
Electromagnetic Spacecraft Propulsion Motor and a Permanent Magnet (PM-Drive) Thruster
Ahmadov, B. A.
2018-04-01
Ion thrusters are designed to be used for realization of a Mars Sample Return mission. The competing technologies with ion thrusters are electromagnetic spacecraft propulsion motors. I'm an engineer and engage in the creation of the new electromagnetic propulsion motors.
ExB Measurements of a 200 W Xenon Hall Thruster (Preprint)
National Research Council Canada - National Science Library
Ekholm, Jared M; Hargus, Jr, William A
2007-01-01
Angularly resolved ion species fractions of Xe+1, Xe+2, and Xe+3 in a low power xenon Hall thruster Busek BHT-200 plume were measured using an ExB probe under a variety of thruster operating conditions and background pressures...
Analysis and design of ion thruster for large space systems
Poeschel, R. L.; Kami, S.
1980-01-01
Design analyses showed that an ion thruster of approximately 50 cm in diameter will be required to produce a thrust of 0.5 N using xenon or argon as propellants, and operating the thruster at a specific impulse of 3530 sec or 6076 sec respectively. A multipole magnetic confinement discharge chamber was specified.
Effects of facility backpressure on the performance and plume of a Hall thruster
Walker, Mitchell Louis Ronald
2005-07-01
This dissertation presents research aimed at understanding the relationship between facility background pressure, Hall thruster performance, and plume characteristics. Due to the wide range of facilities used in Hall thruster testing, it is difficult for researchers to make adequate comparisons between data sets because of both dissimilar instrumentation and backpressures. The differences in the data sets are due to the ingestion of background gas into the Hall thruster discharge channel and charge-exchange collisions in the plume. Thus, this research aims to understand facility effects and to develop the tools needed to allow researchers to obtain relevant plume and performance data for a variety of chambers and backpressures. The first portion of this work develops a technique for calibrating a vacuum chamber in terms of pressure to account for elevated backpressures while testing Hall thrusters. Neutral gas background pressure maps of the Large Vacuum Test Facility are created at a series of cold anode flow rates and one hot flow rate at two UM/AFRL P5 5 kW Hall thruster operating conditions. These data show that a cold flow pressure map can be used to approximate the neutral background pressure in the chamber with the thruster in operation. In addition, the data are used to calibrate a numerical model that accurately predicts facility backpressure within a vacuum chamber of specified geometry and pumping speed. The second portion of this work investigates how facility backpressure influences the plume, plume diagnostics, and performance of the P5 Hall thruster. Measurements of the plume and performance characteristics over a wide range of pressures show that ingestion, a decrease in the downstream plasma potential, and broadening of the ion energy distribution function cause the increase in thrust with backpressure. Furthermore, a magnetically-filtered Faraday probe accurately measures ion current density at elevated operating pressures. The third portion of
Electronegative Gas Thruster - Direct Thrust Measurement
National Aeronautics and Space Administration — This effort is an international collaboration and academic partnership to mature an innovative electric propulsion (EP) thruster concept to TRL 3 through direct...
Facility Effect Characterization Test of NASA's HERMeS Hall Thruster
Huang, Wensheng; Kamhawi, Hani; Haag, Thomas W.; Ortega, Alejandro Lopez; Mikellides, Ioannis G.
2016-01-01
A test to characterize the effect of varying background pressure on NASA's 12.5-kW Hall Effect Rocket with Magnetic Shielding had being completed. This thruster is the baseline propulsion system for the Solar Electric Propulsion Technology Demonstration Mission (SEP TDM). Potential differences in thruster performance and oscillation characteristics when in ground facilities versus on-orbit are considered a primary risk for the propulsion system of the Asteroid Redirect Robotic Mission, which is a candidate for SEP TDM. The first primary objective of this test was to demonstrate that the tools being developed to predict the zero-background-pressure behavior of the thruster can provide self-consistent results. The second primary objective of this test was to provide data for refining a physics-based model of the thruster plume that will be used in spacecraft interaction studies. Diagnostics deployed included a thrust stand, Faraday probe, Langmuir probe, retarding potential analyzer, Wien filter spectrometer, and high-speed camera. From the data, a physics-based plume model was refined. Comparisons of empirical data to modeling results are shown.
Electric field measurement in microwave discharge ion thruster with electro-optic probe.
Ise, Toshiyuki; Tsukizaki, Ryudo; Togo, Hiroyoshi; Koizumi, Hiroyuki; Kuninaka, Hitoshi
2012-12-01
In order to understand the internal phenomena in a microwave discharge ion thruster, it is important to measure the distribution of the microwave electric field inside the discharge chamber, which is directly related to the plasma production. In this study, we proposed a novel method of measuring a microwave electric field with an electro-optic (EO) probe based on the Pockels effect. The probe, including a cooling system, contains no metal and can be accessed in the discharge chamber with less disruption to the microwave distribution. This method enables measurement of the electric field profile under ion beam acceleration. We first verified the measurement with the EO probe by a comparison with a finite-difference time domain numerical simulation of the microwave electric field in atmosphere. Second, we showed that the deviations of the reflected microwave power and the beam current were less than 8% due to inserting the EO probe into the ion thruster under ion beam acceleration. Finally, we successfully demonstrated the measurement of the electric-field profile in the ion thruster under ion beam acceleration. These measurements show that the electric field distribution in the thruster dramatically changes in the ion thruster under ion beam acceleration as the propellant mass flow rate increases. These results indicate that this new method using an EO probe can provide a useful guide for improving the propulsion of microwave discharge ion thrusters.
Magnetic Field Effects on the Plume of a Diverging Cusped-Field Thruster
Matlock, Taylor
2010-07-25
The Diverging Cusped-Field Thruster (DCFT) uses three permanent ring magnets of alternating polarity to create a unique magnetic topology intended to reduce plasma losses to the discharge chamber surfaces. The magnetic field strength within the DCFT discharge chamber (up to 4 kG on axis) is much higher than in thrusters of similar geometry, which is believed to be a driving factor in the high measured anode efficiencies. The field strength in the near plume region is large as well, which may bear on the high beam divergences measured, with peaks in ion current found at angles of around 30-35 from the thruster axis. Characterization of the DCFT has heretofore involved only one magnetic topology. It is then the purpose of this study to investigate changes to the near-field plume caused by altering the shape and strength of the magnetic field. A thick magnetic collar, encircling the thruster body, is used to lower the field strength outside of the discharge chamber and thus lessen any effects caused by the external field. Changes in the thruster plume with field topology are monitored by the use of normal Langmuir and emissive probes interrogating the near-field plasma. Results are related to other observations that suggest a unified conceptual framework for the important near-exit region of the thruster.
Development of a 30-cm ion thruster thermal-vacuum power processor
Herron, B. G.
1976-01-01
The 30-cm Hg electron-bombardment ion thruster presently under development has reached engineering model status and is generally accepted as the prime propulsion thruster module to be used on the earliest solar electric propulsion missions. This paper presents the results of a related program to develop a transistorized 3-kW Thermal-Vacuum Breadboard (TVBB) Power Processor for this thruster. Emphasized in the paper are the implemented electrical and mechanical designs as well as the resultant system performance achieved over a range of test conditions. In addition, design modifications affording improved performance are identified and discussed.
Overview of NASA GRCs Green Propellant Infusion Mission Thruster Testing and Plume Diagnostics
Deans, Matthew C.; Reed, Brian D.; Yim, John T.; Arrington, Lynn A.; Williams, George J.; Kojima, Jun J.; McLean, Christopher H.
2014-01-01
The Green Propellant Infusion Mission (GPIM) is sponsored by NASA's Space Technology Mission Directorate (STMD) Technology Demonstration Mission (TDM) office. The goal of GPIM is to advance the technology readiness level of a green propulsion system, specifically, one using the monopropellant, AF-M315E, by demonstrating ground handling, spacecraft processing, and on-orbit operations. One of the risks identified for GPIM is potential contamination of sensitive spacecraft surfaces from the effluents in the plumes of AF-M315E thrusters. NASA Glenn Research Center (GRC) is conducting activities to characterize the effects of AF-M315E plume impingement and deposition. GRC has established individual plume models of the 22-N and 1-N thrusters that will be used on the GPIM spacecraft. The models describe the pressure, temperature, density, Mach number, and species concentration of the AF-M315E thruster exhaust plumes. The models are being used to assess the impingement effects of the AF-M315E thrusters on the GPIM spacecraft. The model simulations will be correlated with plume measurement data from Laboratory and Engineering Model 22-N, AF-M315E thrusters. The thrusters will be tested in a small rocket, altitude facility at NASA GRC. The GRC thruster testing will be conducted at duty cycles representatives of the planned GPIM maneuvers. A suite of laser-based diagnostics, including Raman spectroscopy, Rayleigh spectroscopy, Schlieren imaging, and physical probes will be used to acquire plume measurements of AFM315E thrusters. Plume data will include temperature, velocity, relative density, and species concentration. The plume measurement data will be compared to the corresponding simulations of the plume model. The GRC effort will establish a data set of AF-M315E plume measurements and a plume model that can be used for future AF-M315E applications.
Power Dependence of the Electron Mobility Profile in a Hall Thruster
Jorns, Benjamin A.; Hofery, Richard H.; Mikellides, Ioannis G.
2014-01-01
The electron mobility profile is estimated in a 4.5 kW commercial Hall thruster as a function of discharge power. Internal measurements of plasma potential and electron temperature are made in the thruster channel with a high-speed translating probe. These measurements are presented for a range of throttling conditions from 150 - 400 V and 0.6 - 4.5 kW. The fluid-based solver, Hall2De, is used in conjunction with these internal plasma parameters to estimate the anomalous collision frequency profile at fixed voltage, 300 V, and three power levels. It is found that the anomalous collision frequency profile does not change significantly upstream of the location of the magnetic field peak but that the extent and magnitude of the anomalous collision frequency downstream of the magnetic peak does change with thruster power. These results are discussed in the context of developing phenomenological models for how the collision frequency profile depends on thruster operating conditions.
Modeling of physical processes in radio-frequency plasma thrusters
Tian, Bin
2017-01-01
This Thesis presents an investigation of the plasma-wave interaction in Helicon Plasma Thrusters (HPT). The HPT is a new concept of electric space propulsion, which generates plasmas with RF heating and provides thrust by the electrodeless acceleration of plasmas in a magnetic nozzle. An in-depth and extensive literature review of the state of the art of the models and experiments of plasma-wave interaction in helicon plasma sources and thrusters is carried out. Then, a theoret...
Integration of an ion engine on the Communications Technology Satellite.
Payne, W. F.; Finke, R. C.
1972-01-01
An ion engine subsystem intended for satellite stationkeeping tasks is described. Ion thrusters are chosen to perform the task because the specific impulse is at least an order of magnitude higher than the commonly used reaction control jets. The higher the value of specific impulse, the greater the total impulse that can be attained for a given weight of propellant, hence cost benefits result. The integration, subsystem testing, and the operating plans for the ion engine experiment to be flown in 1975 on the Canadian Communications Technology Satellite (CTS) are described. The subsystem is designed to demonstrate north-south stationkeeping, attitude control by means of thrust vectoring, long-term space storage and restart capability, and compatibility with a high powered communications transponder.
Characteristics of the LeRC/Hughes J-series 30-cm engineering model thruster
Collett, C. R.; Poeschel, R. L.; Kami, S.
1981-01-01
As a consequence of endurance and structural tests performed on 900-series engineering model thrusters (EMT), several modifications in design were found to be necessary for achieving performance goals. The modified thruster is known as the J-series EMT. The most important of the design modifications affect the accelerator grid, gimbal mount, cathode polepiece, and wiring harness. The paper discusses the design modifications incorporated, the condition(s) they corrected, and the characteristics of the modified thruster.
Thruster allocation for dynamical positioning
Poppe, K.; van den Berg, J.B.; Blank, E.; Archer, C.; Redeker, M.; Kutter, M.; Hemker, P.
2010-01-01
Positioning a vessel at a fixed position in deep water is of great importance when working offshore. In recent years a Dynamical Positioning (DP) system was developed at Marin [2]. After the measurement of the current position and external forces (like waves, wind etc.), each thruster of the vessel
Micropulsed Plasma Thrusters for Attitude Control of a Low-Earth-Orbiting CubeSat
Gatsonis, Nikolaos A.; Lu, Ye; Blandino, John; Demetriou, Michael A.; Paschalidis, Nicholas
2016-01-01
This study presents a 3-Unit CubeSat design with commercial-off-the-shelf hardware, Teflon-fueled micropulsed plasma thrusters, and an attitude determination and control approach. The micropulsed plasma thruster is sized by the impulse bit and pulse frequency required for continuous compensation of expected maximum disturbance torques at altitudes between 400 and 1000 km, as well as to perform stabilization of up to 20 deg /s and slew maneuvers of up to 180 deg. The study involves realistic power constraints anticipated on the 3-Unit CubeSat. Attitude estimation is implemented using the q method for static attitude determination of the quaternion using pairs of the spacecraft-sun and magnetic-field vectors. The quaternion estimate and the gyroscope measurements are used with an extended Kalman filter to obtain the attitude estimates. Proportional-derivative control algorithms use the static attitude estimates in order to calculate the torque required to compensate for the disturbance torques and to achieve specified stabilization and slewing maneuvers or combinations. The controller includes a thruster-allocation method, which determines the optimal utilization of the available thrusters and introduces redundancy in case of failure. Simulation results are presented for a 3-Unit CubeSat under detumbling, pointing, and pointing and spinning scenarios, as well as comparisons between the thruster-allocation and the paired-firing methods under thruster failure.
In-Situ Measurement of Hall Thruster Erosion Using a Fiber Optic Regression Probe
Polzin, Kurt; Korman, Valentin
2009-01-01
One potential life-limiting mechanism in a Hall thruster is the erosion of the ceramic material comprising the discharge channel. This is especially true for missions that require long thrusting periods and can be problematic for lifetime qualification, especially when attempting to qualify a thruster by analysis rather than a test lasting the full duration of the mission. In addition to lifetime, several analytical and numerical models include electrode erosion as a mechanism contributing to enhanced transport properties. However, there is still a great deal of dispute over the importance of erosion to transport in Hall thrusters. The capability to perform an in-situ measurement of discharge channel erosion is useful in addressing both the lifetime and transport concerns. An in-situ measurement would allow for real-time data regarding the erosion rates at different operating points, providing a quick method for empirically anchoring any analysis geared towards lifetime qualification. Erosion rate data over a thruster s operating envelope would also be useful in the modeling of the detailed physics inside the discharge chamber. There are many different sensors and techniques that have been employed to quantify discharge channel erosion in Hall thrusters. Snapshots of the wear pattern can be obtained at regular shutdown intervals using laser profilometry. Many non-intrusive techniques of varying complexity and sensitivity have been employed to detect the time-varying presence of erosion products in the thruster plume. These include the use quartz crystal microbalances, emission spectroscopy, laser induced flourescence, and cavity ring-down spectroscopy. While these techniques can provide a very accurate picture of the level of eroded material in the thruster plume, it is more difficult to use them to determine the location from which the material was eroded. Furthermore, none of the methods cited provide a true in-situ measure of erosion at the channel surface while
Directory of Open Access Journals (Sweden)
Amelia eGreig
2015-10-01
Full Text Available A spatiotemporal study of neutral gas temperature during the first 100 s of operation for a radio-frequency electrothermal plasma micro-thruster operating on nitrogen at 60 W and 1.5 Torr is performed to identify the heating mechanisms involved. Neutral gas temperature is estimated from rovibrational band fitting of the nitrogen second positive system. A set of baffles are used to restrict the optical image and separate the heating mechanisms occurring in the central bulk discharge region and near the thruster walls.For each spatial region there are three distinct gas heating mechanisms being fast heating from ion-neutral collisions with timescales of tens of milliseconds, intermediate heating with timescales of 10 s from ion bombardment on the inner thruster tube surface creating wall heating, and slow heating with timescales of 100 s from gradual warming of the entire thruster housing. The results are discussed in relation to optimising the thermal properties of future thruster designs.
Integration Testing of a Modular Discharge Supply for NASA's High Voltage Hall Accelerator Thruster
Pinero, Luis R.; Kamhawi, hani; Drummond, Geoff
2010-01-01
NASA s In-Space Propulsion Technology Program is developing a high performance Hall thruster that can fulfill the needs of future Discovery-class missions. The result of this effort is the High Voltage Hall Accelerator thruster that can operate over a power range from 0.3 to 3.5 kW and a specific impulse from 1,000 to 2,800 sec, and process 300 kg of xenon propellant. Simultaneously, a 4.0 kW discharge power supply comprised of two parallel modules was developed. These power modules use an innovative three-phase resonant topology that can efficiently supply full power to the thruster at an output voltage range of 200 to 700 V at an input voltage range of 80 to 160 V. Efficiencies as high as 95.9 percent were measured during an integration test with the NASA103M.XL thruster. The accuracy of the master/slave current sharing circuit and various thruster ignition techniques were evaluated.
Global Linear Stability Analysis of the Spoke Oscillation in Hall Effect Thrusters
2014-07-15
meνeχ 2 nTe qex (4.1f) ddc dx = 2cpl vix ≡ γ (4.1g) where x is the axial coordinate along the thruster channel; e, me and mi are the electron charge...mi ) P − ( 5 2 Te mi nvex + qex mi ) 1 dc ddc dξ (4.25i) ddc dξ = Pγ (4.25j) Distribution A: Approved for public release; distribution is unlimited...Thruster. PhD thesis, Standford University , 2011. [128] D. Liu, R.E. Huffman, R.D. Branam, and W.A. Hargus. Ultrahigh-speed imaging of hall-thruster
Post-Test Inspection of Nasa's Evolutionary Xenon Thruster Long Duration Test Hardware: Ion Optics
Soulas, George C.; Shastry, Rohit
2016-01-01
A Long Duration Test (LDT) was initiated in June 2005 as a part of NASAs Evolutionary Xenon Thruster (NEXT) service life validation approach. Testing was voluntarily terminated in February 2014, with the thruster accumulating 51,184 hours of operation, processing 918 kg of xenon propellant, and delivering 35.5 MN-s of total impulse. This presentation will present the post-test inspection results to date for the thrusters ion optics.
Chaotic waves in Hall thruster plasma
International Nuclear Information System (INIS)
Peradzynski, Zbigniew; Barral, S.; Kurzyna, J.; Makowski, K.; Dudeck, M.
2006-01-01
The set of hyperbolic equations of the fluid model describing the acceleration of plasma in a Hall thruster is analyzed. The characteristic feature of the flow is the existence of a trapped characteristic; i.e. there exists a characteristic line, which never intersects the boundary of the flow region in the thruster. To study the propagation of short wave perturbations, the approach of geometrical optics (like WKB) can be applied. This can be done in a linear as well as in a nonlinear version. The nonlinear version describes the waves of small but finite amplitude. As a result of such an approach one obtains so called transport equation, which are governing the wave amplitude. Due to the existence of trapped characteristics this transport equation appears to have chaotic (turbulent) solutions in both, linear and nonlinear versions
The Green Propellant Infusion Mission Thruster Performance Testing for Plume Diagnostics
Deans, Matthew C.; Reed, Brian D.; Arrington, Lynn A.; Williams, George J.; Kojima, Jun J.; Kinzbach, McKenzie I.; McLean, Christopher H.
2014-01-01
The Green Propellant Infusion Mission (GPIM) is sponsored by NASA's Space Technology Mission Directorate (STMD) Technology Demonstration Mission (TDM) office. The goal of GPIM is to advance the technology readiness level of a green propulsion system, specifically, one using the monopropellant, AF-M315E, by demonstrating ground handling, spacecraft processing, and on-orbit operations. One of the risks identified for GPIM is potential contamination of sensitive spacecraft surfaces from the effluents in the plumes of AF-M315E thrusters. NASA Glenn Research Center (GRC) is conducting activities to characterize the effects of AF-M315E plume impingement and deposition. GRC has established individual plume models of the 22-N and 1-N thrusters that will be used on the GPIM spacecraft. The model simulations will be correlated with plume measurement data from Laboratory and Engineering Model 22-N, AF-M315E thrusters. The thrusters are currently being tested in a small rocket, altitude facility at NASA GRC. A suite of diagnostics, including Raman spectroscopy, Rayleigh spectroscopy, and Schlieren imaging are being used to acquire plume measurements of AF-M315E thrusters. Plume data will include temperature, velocity, relative density, and species concentration. The plume measurement data will be compared to the corresponding simulations of the plume model. The GRC effort will establish a data set of AF-M315E plume measurements and a plume model that can be used for future AF-M315E applications.
Micro-cathode Arc Thruster PhoneSat Experiment
National Aeronautics and Space Administration — The Micro-cathode Arc Thruster Phonesat Experiment was a joint project between George Washington University and NASA Ames Research Center that successfully...
Hot-Fire Testing of a 1N AF-M315E Thruster
Burnside, Christopher G.; Pedersen, Kevin; Pierce, Charles W.
2015-01-01
This hot-fire test continues NASA investigation of green propellant technologies for future missions. To show the potential for green propellants to replace some hydrazine systems in future spacecraft, NASA Marshall Space Flight Center (MSFC) is continuing to embark on hot-fire test campaigns with various green propellant blends. NASA completed a hot-fire test of a 1N AF-M315E monopropellant thruster at the Marshall Space Flight Center in the small altitude test stand located in building 4205. The thruster is a ground test article used for basic performance determination and catalyst studies. The purpose of the hot-fire testing was for performance determination of a 1N size thruster and form a baseline from which to study catalyst performance and life with follow-on testing to be conducted at a later date. The thruster performed as expected. The result of the hot-fire testing are presented in this paper and presentation.
Plasma simulation in space propulsion : the helicon plasma thruster
Navarro Cavallé, Jaume
2017-01-01
The Helicon Plasma Thruster (HPT) is an electrodynamic rocket proposed in the early 2000s. It matches an Helicon Plasma Source (HPS), which ionizes the neutral gas and heats up the plasma, with aMagneticNozzle (MN),where the plasma is supersonically accelerated resulting in thrust. Although the core of this thruster inherits the knowledge on Helicon Plasma sources, dated from the seventies, the HPT technology is still not developed and remains below TRL 4. A deep review of the HPT State-of-ar...
Performance optimization of 20 cm xenon ion thruster discharge chamber
International Nuclear Information System (INIS)
Chen Juanjuan; Zhang Tianping; Jia Yanhui; Li Xiaoping
2012-01-01
This paper describes the performance of the LIPS-200 ion thruster discharge chamber which was developed by Lanzhou Institute of Physics. Based on the discharge chamber geometric configuration and magnetic field, the completely self-consistent analytical model is utilized to discuss performance optimization of the discharge chamber of the LIPS-200. The thrust is enhanced from 40 mN up to 60 mN at rated impulse and efficiency. The results show that the 188.515 W/A beam ion production cost at a propellant flow rate of 2.167 × 10 17 m -3 requires that the thruster runs at a discharge current of 6.9 A to produce 1.2 A ion beam current. Also, during the process of LIPS-200 ion thruster discharge chamber performance optimization, the sheath potential is always within 3.80 ∼ 6.65 eV. (authors)
Mode transition of a Hall thruster discharge plasma
International Nuclear Information System (INIS)
Hara, Kentaro; Sekerak, Michael J.; Boyd, Iain D.; Gallimore, Alec D.
2014-01-01
A Hall thruster is a cross-field plasma device used for spacecraft propulsion. An important unresolved issue in the development of Hall thrusters concerns the effect of discharge oscillations in the range of 10–30 kHz on their performance. The use of a high speed Langmuir probe system and ultra-fast imaging of the discharge plasma of a Hall thruster suggests that the discharge oscillation mode, often called the breathing mode, is strongly correlated to an axial global ionization mode. Stabilization of the global oscillation mode is achieved as the magnetic field is increased and azimuthally rotating spokes are observed. A hybrid-direct kinetic simulation that takes into account the transport of electronically excited atoms is used to model the discharge plasma of a Hall thruster. The predicted mode transition agrees with experiments in terms of the mean discharge current, the amplitude of discharge current oscillation, and the breathing mode frequency. It is observed that the stabilization of the global oscillation mode is associated with reduced electron transport that suppresses the ionization process inside the channel. As the Joule heating balances the other loss terms including the effects of wall loss and inelastic collisions, the ionization oscillation is damped, and the discharge oscillation stabilizes. A wide range of the stable operation is supported by the formation of a space charge saturated sheath that stabilizes the electron axial drift and balances the Joule heating as the magnetic field increases. Finally, it is indicated from the numerical results that there is a strong correlation between the emitted light intensity and the discharge current.
Svatos, Adam Ladislav
This thesis describes the author's contributions to three separate projects. The bus of the NORSAT-2 satellite was developed by the Space Flight Laboratory (SFL) for the Norwegian Space Centre (NSC) and Space Norway. The author's contributions to the mission were performing unit tests for the components of all the spacecraft subsystems as well as designing and assembling the flatsat from flight spares. Gedex's Vector Gravimeter for Asteroids (VEGA) is an accelerometer for spacecraft. The author's contributions to this payload were modifying the instrument computer board schematic, designing the printed circuit board, developing and applying test software, and performing thermal acceptance testing of two instrument computer boards. The SFL's cylindrical Hall effect thruster combines the cylindrical configuration for a Hall thruster and uses permanent magnets to achieve miniaturization and low power consumption, respectively. The author's contributions were to design, build, and test an engineering model power processing unit.
Meyer, Michael L.; Arrington, Lynn A.; Kleinhenz, Julie E.; Marshall, William M.
2012-01-01
A relocated rocket engine test facility, the Altitude Combustion Stand (ACS), was activated in 2009 at the NASA Glenn Research Center. This facility has the capability to test with a variety of propellants and up to a thrust level of 2000 lbf (8.9 kN) with precise measurement of propellant conditions, propellant flow rates, thrust and altitude conditions. These measurements enable accurate determination of a thruster and/or nozzle s altitude performance for both technology development and flight qualification purposes. In addition the facility was designed to enable efficient test operations to control costs for technology and advanced development projects. A liquid oxygen-liquid methane technology development test program was conducted in the ACS from the fall of 2009 to the fall of 2010. Three test phases were conducted investigating different operational modes and in addition, the project required the complexity of controlling propellant inlet temperatures over an extremely wide range. Despite the challenges of a unique propellant (liquid methane) and wide operating conditions, the facility performed well and delivered up to 24 hot fire tests in a single test day. The resulting data validated the feasibility of utilizing this propellant combination for future deep space applications.
Guo, Jing; Xu, Xiaolong; Zhao, Qile; Liu, Jingnan
2016-02-01
This contribution summarizes the strategy used by Wuhan University (WHU) to determine precise orbit and clock products for Multi-GNSS Experiment (MGEX) of the International GNSS Service (IGS). In particular, the satellite attitude, phase center corrections, solar radiation pressure model developed and used for BDS satellites are addressed. In addition, this contribution analyzes the orbit and clock quality of the quad-constellation products from MGEX Analysis Centers (ACs) for a common time period of 1 year (2014). With IGS final GPS and GLONASS products as the reference, Multi-GNSS products of WHU (indicated by WUM) show the best agreement among these products from all MGEX ACs in both accuracy and stability. 3D Day Boundary Discontinuities (DBDs) range from 8 to 27 cm for Galileo-IOV satellites among all ACs' products, whereas WUM ones are the largest (about 26.2 cm). Among three types of BDS satellites, MEOs show the smallest DBDs from 10 to 27 cm, whereas the DBDs for all ACs products are at decimeter to meter level for GEOs and one to three decimeter for IGSOs, respectively. As to the satellite laser ranging (SLR) validation for Galileo-IOV satellites, the accuracy evaluated by SLR residuals is at the one decimeter level with the well-known systematic bias of about -5 cm for all ACs. For BDS satellites, the accuracy could reach decimeter level, one decimeter level, and centimeter level for GEOs, IGSOs, and MEOs, respectively. However, there is a noticeable bias in GEO SLR residuals. In addition, systematic errors dependent on orbit angle related to mismodeled solar radiation pressure (SRP) are present for BDS GEOs and IGSOs. The results of Multi-GNSS combined kinematic PPP demonstrate that the best accuracy of position and fastest convergence speed have been achieved using WUM products, particularly in the Up direction. Furthermore, the accuracy of static BDS only PPP degrades when the BDS IGSO and MEO satellites switches to orbit-normal orientation
Design and Testing of a Hall Effect Thruster with 3D Printed Channel and Propellant Distributor
Hopping, Ethan P.; Xu, Kunning G.
2017-01-01
The UAH-78AM is a low-power Hall effect thruster developed at the University of Alabama in Huntsville with channel walls and a propellant distributor manufactured using 3D printing. The goal of this project is to assess the feasibility of using unconventional materials to produce a low-cost functioning Hall effect thruster and consider how additive manufacturing can expand the design space and provide other benefits. A version of the thruster was tested at NASA Glenn Research Center to obtain performance metrics and to validate the ability of the thruster to produce thrust and sustain a discharge. An overview of the thruster design and transient performance measurements are presented here. Measured thrust ranged from 17.2 millinewtons to 30.4 millinewtons over a discharge power of 280 watts to 520 watts with an anode I (sub SP)(Specific Impulse) range of 870 seconds to 1450 seconds. Temperature limitations of materials used for the channel walls and propellant distributor limit the ability to run the thruster at thermal steady-state.
Plasma Reactors and Plasma Thrusters Modeling by Ar Complete Global Models
Directory of Open Access Journals (Sweden)
Chloe Berenguer
2012-01-01
Full Text Available A complete global model for argon was developed and adapted to plasma reactor and plasma thruster modeling. It takes into consideration ground level and excited Ar and Ar+ species and the reactor and thruster form factors. The electronic temperature, the species densities, and the ionization percentage, depending mainly on the pressure and the absorbed power, have been obtained and commented for various physical conditions.
The microwave thermal thruster and its application to the launch problem
Parkin, Kevin L. G.
Nuclear thermal thrusters long ago bypassed the 50-year-old specific impulse (Isp) limitation of conventional thrusters, using nuclear powered heat exchangers in place of conventional combustion to heat a hydrogen propellant. These heat exchanger thrusters experimentally achieved an Isp of 825 seconds, but with a thrust-to-weight ratio (T/W) of less than ten they have thus far been too heavy to propel rockets into orbit. This thesis proposes a new idea to achieve both high Isp and high T/W The Microwave Thermal Thruster. This thruster covers the underside of a rocket aeroshell with a lightweight microwave absorbent heat exchange layer that may double as a re-entry heat shield. By illuminating the layer with microwaves directed from a ground-based phased array, an Isp of 700--900 seconds and T/W of 50--150 is possible using a hydrogen propellant. The single propellant simplifies vehicle design, and the high Isp increases payload fraction and structural margins. These factors combined could have a profound effect on the economics of building and reusing rockets. A laboratory-scale microwave thermal heat exchanger is constructed using a single channel in a cylindrical microwave resonant cavity, and new type of coupled electromagnetic-conduction-convection model is developed to simulate it. The resonant cavity approach to small-scale testing reveals several drawbacks, including an unexpected oscillatory behavior. Stable operation of the laboratory-scale thruster is nevertheless successful, and the simulations are consistent with the experimental results. In addition to proposing a new type of propulsion and demonstrating it, this thesis provides three other principal contributions: The first is a new perspective on the launch problem, placing it in a wider economic context. The second is a new type of ascent trajectory that significantly reduces the diameter, and hence cost, of the ground-based phased array. The third is an eclectic collection of data, techniques, and
Hall-Effect Thruster Simulations with 2-D Electron Transport and Hydrodynamic Ions
Mikellides, Ioannis G.; Katz, Ira; Hofer, Richard H.; Goebel, Dan M.
2009-01-01
A computational approach that has been used extensively in the last two decades for Hall thruster simulations is to solve a diffusion equation and energy conservation law for the electrons in a direction that is perpendicular to the magnetic field, and use discrete-particle methods for the heavy species. This "hybrid" approach has allowed for the capture of bulk plasma phenomena inside these thrusters within reasonable computational times. Regions of the thruster with complex magnetic field arrangements (such as those near eroded walls and magnets) and/or reduced Hall parameter (such as those near the anode and the cathode plume) challenge the validity of the quasi-one-dimensional assumption for the electrons. This paper reports on the development of a computer code that solves numerically the 2-D axisymmetric vector form of Ohm's law, with no assumptions regarding the rate of electron transport in the parallel and perpendicular directions. The numerical challenges related to the large disparity of the transport coefficients in the two directions are met by solving the equations in a computational mesh that is aligned with the magnetic field. The fully-2D approach allows for a large physical domain that extends more than five times the thruster channel length in the axial direction, and encompasses the cathode boundary. Ions are treated as an isothermal, cold (relative to the electrons) fluid, accounting for charge-exchange and multiple-ionization collisions in the momentum equations. A first series of simulations of two Hall thrusters, namely the BPT-4000 and a 6-kW laboratory thruster, quantifies the significance of ion diffusion in the anode region and the importance of the extended physical domain on studies related to the impact of the transport coefficients on the electron flow field.
HiVHAc Thruster Wear and Structural Tests
National Aeronautics and Space Administration — NASA GRC is developing a 4.5 kW-class Hall propulsion system. This system includes a long life high performance Hall Effect Thruster (HET), a highly efficient...
“You can get there from here”: Advanced low cost propulsion concepts for small satellites beyond LEO
Baker, Adam M.; da Silva Curiel, Alex; Schaffner, Jake; Sweeting, Martin
2005-07-01
microsatellite from a typical 700 km sun-synchronous orbit to a lower or higher orbit using a low cost 40 N thrust concentrated hydrogen peroxide/kerosene bipropellant engine. A spin stabilized 'tug' concept capable of providing between 130 and 300 m/s of deltaV to the payload is described. Transfer of an enhanced microsatellite from LEO to lunar orbit using a novel, storable propellant solar thermal propulsion system under development at the Surrey Space Centre. The solar thermal propulsion unit is designed for low cost small satellite support and will be compared with a more traditional approach using and industry standard storable bipropellant chemical engine. Nanosatellite manoeuvring for formation flying using advanced low power electric propulsion. A colloid thruster system concept is planned for development jointly between SSTL, Queen Mary University London and Rutherford Appleton Laboratory, UK. The colloid thruster system is designed to complement an existing butane resistojet to give full 3-axis manoeuvrability to an upgraded SNAP nanosatellite platform which could be reflown in 2007 alongside ESA's Proba 2 technology demonstrator microsatellite. A comparison between low power resistojets, a colloid thruster system, and pulsed plasma thrusters for orbit manoeuvring of microsatellites will be made. This paper's final section will briefly describe some of the interplanetary missions which have been considered at the Surrey Space Centre, and will highlight the few as yet practical solutions for sending small spacecraft on high deltaV missions without the use of a costly upper stage.
Reduced power processor requirements for the 30-cm diameter HG ion thruster
Rawlin, V. K.
1979-01-01
The characteristics of power processors strongly impact the overall performance and cost of electric propulsion systems. A program was initiated to evaluate simplifications of the thruster-power processor interface requirements. The power processor requirements are mission dependent with major differences arising for those missions which require a nearly constant thruster operating point (typical of geocentric and some inbound planetary missions) and those requiring operation over a large range of input power (such as outbound planetary missions). This paper describes the results of tests which have indicated that as many as seven of the twelve power supplies may be eliminated from the present Functional Model Power Processor used with 30-cm diameter Hg ion thrusters.
High Fidelity Modeling of Field-Reversed Configuration (FRC) Thrusters (Briefing Charts)
2017-05-24
THRUSTERS (Briefing Charts) Robert Martin , Eder Sousa, Jonathan Tran Air Force Research Laboratory (AFMC) AFRL/RQRS 1 Ara Drive Edwards AFB, CA 93524... Martin N/A HIGH FIDELITY MODELING OF FIELD-REVERSED CONFIGURATION (FRC) THRUSTERS Robert Martin1, Eder Sousa2, Jonathan Tran2 1AIR FORCE RESEARCH...Distribution is unlimited. PA Clearance No. 17314 MARTIN , SOUSA, TRAN (AFRL/RQRS) DISTRIBUTION A - APPROVED FOR PUBLIC RELEASE; DISTRIBUTION UNLIMITED. PA
Recycle Requirements for NASA's 30 cm Xenon Ion Thruster
Pinero, Luis R.; Rawlin, Vincent K.
1994-01-01
Electrical breakdowns have been observed during ion thruster operation. These breakdowns, or arcs, can be caused by several conditions. In flight systems, the power processing unit must be designed to handle these faults autonomously. This has a strong impact on power processor requirements and must be understood fully for the power processing unit being designed for the NASA Solar Electric Propulsion Technology Application Readiness program. In this study, fault conditions were investigated using a NASA 30 cm ion thruster and a power console. Power processing unit output specifications were defined based on the breakdown phenomena identified and characterized.
Optimized Magnetic Nozzles for MPD Thrusters, Phase I
National Aeronautics and Space Administration — Magnetoplasmadynamic (MPD) thrusters can provide the high-specific impulse, high-power propulsion required to enable ambitious human and robotic exploration missions...
Acoustic Resonance Reaction Control Thruster (ARCTIC), Phase I
National Aeronautics and Space Administration — ORBITEC proposes to develop and demonstrate the innovative Acoustic Resonance Reaction Control Thruster (ARCTIC) to provide rapid and reliable in-space impulse...
Determination of the Hall Thruster Operating Regimes
International Nuclear Information System (INIS)
L. Dorf; V. Semenov; Y. Raitses; N.J. Fisch
2002-04-01
A quasi one-dimensional (1-D) steady-state model of the Hall thruster is presented. For the same discharge voltage two operating regimes are possible -- with and without the anode sheath. For given mass flow rate, magnetic field profile and discharge voltage a unique solution can be constructed, assuming that the thruster operates in one of the regimes. However, we show that for a given temperature profile the applied discharge voltage uniquely determines the operating regime: for discharge voltages greater than a certain value, the sheath disappears. That result is obtained over a wide range of incoming neutral velocities, channel lengths and widths, and cathode plane locations. It is also shown that a good correlation between the quasi 1-D model and experimental results can be achieved by selecting an appropriate electron mobility and temperature profile
High Fidelity Multi-Objective Design Optimization of a Downscaled Cusped Field Thruster
Directory of Open Access Journals (Sweden)
Thomas Fahey
2017-11-01
Full Text Available The Cusped Field Thruster (CFT concept has demonstrated significantly improved performance over the Hall Effect Thruster and the Gridded Ion Thruster; however, little is understood about the complexities of the interactions and interdependencies of the geometrical, magnetic and ion beam properties of the thruster. This study applies an advanced design methodology combining a modified power distribution calculation and evolutionary algorithms assisted by surrogate modeling to a multi-objective design optimization for the performance optimization and characterization of the CFT. Optimization is performed for maximization of performance defined by five design parameters (i.e., anode voltage, anode current, mass flow rate, and magnet radii, simultaneously aiming to maximize three objectives; that is, thrust, efficiency and specific impulse. Statistical methods based on global sensitivity analysis are employed to assess the optimization results in conjunction with surrogate models to identify key design factors with respect to the three design objectives and additional performance measures. The research indicates that the anode current and the Outer Magnet Radius have the greatest effect on the performance parameters. An optimal value for the anode current is determined, and a trend towards maximizing anode potential and mass flow rate is observed.
Numerical investigation of two interacting parallel thruster-plumes and comparison to experiment
Grabe, Martin; Holz, André; Ziegenhagen, Stefan; Hannemann, Klaus
2014-12-01
Clusters of orbital thrusters are an attractive option to achieve graduated thrust levels and increased redundancy with available hardware, but the heavily under-expanded plumes of chemical attitude control thrusters placed in close proximity will interact, leading to a local amplification of downstream fluxes and of back-flow onto the spacecraft. The interaction of two similar, parallel, axi-symmetric cold-gas model thrusters has recently been studied in the DLR High-Vacuum Plume Test Facility STG under space-like vacuum conditions, employing a Patterson-type impact pressure probe with slot orifice. We reproduce a selection of these experiments numerically, and emphasise that a comparison of numerical results to the measured data is not straight-forward. The signal of the probe used in the experiments must be interpreted according to the degree of rarefaction and local flow Mach number, and both vary dramatically thoughout the flow-field. We present a procedure to reconstruct the probe signal by post-processing the numerically obtained flow-field data and show that agreement to the experimental results is then improved. Features of the investigated cold-gas thruster plume interaction are discussed on the basis of the numerical results.
Performance of an iodine-fueled radio-frequency ion-thruster
Holste, Kristof; Gärtner, Waldemar; Zschätzsch, Daniel; Scharmann, Steffen; Köhler, Peter; Dietz, Patrick; Klar, Peter J.
2018-01-01
Two sets of performance data of the same radio-frequency ion-thruster (RIT) have been recorded using iodine and xenon, respectively, as propellant. To characterize the thruster's performance, we have recorded the radio-frequency DC-power, required for yielding preset values of the extracted ion-beam currents, as a function of mass flow. For that purpose, an iodine mass flow system had to be developed, calibrated, and integrated into a newly-built test facility for studying corrosive propellants. The performance mappings for iodine and xenon differ significantly despite comparable operation conditions. At low mass flows, iodine exhibits the better performance. The situation changes at higher mass flows where the performance of iodine is significantly poorer than that of xenon. The reason is very likely related to the molecular nature of iodine. Our results show that iodine as propellant is compatible with RIT technology. Furthermore, it is a viable alternative as propellant for dedicated space missions. In particular, when taking into account additional benefits such as possible storage as a solid and its low price the use of iodine as propellant in ion thrusters is competitive.
MacKay, Rebecca A.; Smith, Stephen W.; Shah, Sandeep R.; Piascik, Robert S.
2005-01-01
The shuttle orbiter s reaction control system (RCS) primary thruster serial number 120 was found to contain cracks in the counter bores and relief radius after a chamber repair and rejuvenation was performed in April 2004. Relief radius cracking had been observed in the 1970s and 1980s in seven thrusters prior to flight; however, counter bore cracking had never been seen previously in RCS thrusters. Members of the Materials Super Problem Resolution Team (SPRT) of the NASA Engineering and Safety Center (NESC) conducted a detailed review of the relevant literature and of the documentation from the previous RCS thruster failure analyses. It was concluded that the previous failure analyses lacked sufficient documentation to support the conclusions that stress corrosion cracking or hot-salt cracking was the root cause of the thruster cracking and lacked reliable inspection controls to prevent cracked thrusters from entering the fleet. The NESC team identified and performed new materials characterization and mechanical tests. It was determined that the thruster intergranular cracking was due to hydrogen embrittlement and that the cracking was produced during manufacturing as a result of processing the thrusters with fluoride-containing acids. Testing and characterization demonstrated that appreciable environmental crack propagation does not occur after manufacturing.
Overview of Iodine Propellant Hall Thruster Development Activities at NASA Glenn Research Center
Kamhawi, Hani; Benavides, Gabriel; Haag, Thomas; Hickman, Tyler; Smith, Timothy; Williams, George; Myers, James; Polzin, Kurt; Dankanich, John; Byrne, Larry;
2016-01-01
NASA is continuing to invest in advancing Hall thruster technologies for implementation in commercial and government missions. There have been several recent iodine Hall propulsion system development activities performed by the team of the NASA Glenn Research Center, the NASA Marshall Space Flight Center, and Busek Co. Inc. In particular, the work focused on qualification of the Busek BHT-200-I, 200 W and the continued development of the BHT-600-I Hall thruster propulsion systems. This presentation presents an overview of these development activities and also reports on the results of short duration tests that were performed on the engineering model BHT-200-I and the development model BHT-600-I Hall thrusters.
Kamhawi, Hani; Huang, Wensheng; Haag, Thomas; Shastry, Rohit; Thomas, Robert; Yim, John; Herman, Daniel; Williams, George; Myers, James; Hofer, Richard;
2015-01-01
NASA's Space Technology Mission Directorate (STMD) Solar Electric Propulsion Technology Demonstration Mission (SEP/TDM) project is funding the development of a 12.5-kW Hall thruster system to support future NASA missions. The thruster designated Hall Effect Rocket with Magnetic Shielding (HERMeS) is a 12.5-kW Hall thruster with magnetic shielding incorporating a centrally mounted cathode. HERMeS was designed and modeled by a NASA GRC and JPL team and was fabricated and tested in vacuum facility 5 (VF5) at NASA GRC. Tests at NASA GRC were performed with the Technology Development Unit 1 (TDU1) thruster. TDU1's magnetic shielding topology was confirmed by measurement of anode potential and low electron temperature along the discharge chamber walls. Thermal characterization tests indicated that during full power thruster operation at peak magnetic field strength, the various thruster component temperatures were below prescribed maximum allowable limits. Performance characterization tests demonstrated the thruster's wide throttling range and found that the thruster can achieve a peak thruster efficiency of 63% at 12.5 kW 500 V and can attain a specific impulse of 3,000 s at 12.5 kW and a discharge voltage of 800 V. Facility background pressure variation tests revealed that the performance, operational characteristics, and magnetic shielding effectiveness of the TDU1 design were mostly insensitive to increases in background pressure.
Hollow Cathode Assembly Development for the HERMeS Hall Thruster
Sarver-Verhey, Timothy R.; Kamhawi, Hani; Goebel, Dan M.; Polk, James E.; Peterson, Peter Y.; Robinson, Dale A.
2016-01-01
To support the operation of the HERMeS 12.5 kW Hall Thruster for NASA's Asteroid Redirect Robotic Mission, hollow cathodes using emitters based on barium oxide impregnate and lanthanum hexaboride are being evaluated through wear-testing, performance characterization, plasma modeling, and review of integration requirements. This presentation will present the development approach used to assess the cathode emitter options. A 2,000-hour wear-test of development model Barium Oxide (BaO) hollow cathode is being performed as part of the development plan. Specifically this test is to identify potential impacts cathode emitter life during operation in the HERMeS thruster. The cathode was operated with a magnetic field-equipped anode that simulates the HERMeS hall thruster operating environment. Cathode discharge performance has been stable with the device accumulating 743 hours at the time of this report. Observed voltage changes are attributed to keeper surface condition changes during testing. Cathode behavior during characterization sweeps exhibited stable behavior, including cathode temperature. The details of the cathode assembly operation of the wear-test will be presented.
Dual Mode Low Power Hall Thruster, Phase I
National Aeronautics and Space Administration — Sample and return missions desire and missions like Saturn Observer require a low power Hall thruster that can operate at high thrust to power as well as high...
Advanced-technology 30-cm-diameter mercury ion thruster
Beattie, J. R.; Kami, S.
1982-01-01
An advanced-technology mercury ion thruster designed for operation at high thrust and high thrust-to-power ratio is described. The laboratory-model thruster employs a highly efficient discharge-chamber design that uses high-field-strength samarium-cobalt magnets arranged in a ring-cusp configuration. Ion extraction is achieved using an advanced three-grid ion-optics assembly which utilizes flexible mounts for supporting the screen, accel, and decel electrodes. Performance results are presented for operation at beam currents in the range from 1 to 5 A. The baseline specific discharge power is shown to be about 125 eV/ion, and the acceptable range of net-to-total accelerating-voltage ratio is shown to be in the range of 0.2-0.8 for beam currents in the range of 1-5 A.
Hall Thruster Modeling with a Given Temperature Profile
International Nuclear Information System (INIS)
Dorf, L.; Semenov, V.; Raitses, Y.; Fisch, N.J.
2002-01-01
A quasi one-dimensional steady-state model of the Hall thruster is presented. For given mass flow rate, magnetic field profile, and discharge voltage the unique solution can be constructed, assuming that the thruster operates in one of the two regimes: with or without the anode sheath. It is shown that for a given temperature profile, the applied discharge voltage uniquely determines the operating regime; for discharge voltages greater than a certain value, the sheath disappears. That result is obtained over a wide range of incoming neutral velocities, channel lengths and widths, and cathode plane locations. A good correlation between the quasi one-dimensional model and experimental results can be achieved by selecting an appropriate temperature profile. We also show how the presented model can be used to obtain a two-dimensional potential distribution
ISS Contingency Attitude Control Recovery Method for Loss of Automatic Thruster Control
Bedrossian, Nazareth; Bhatt, Sagar; Alaniz, Abran; McCants, Edward; Nguyen, Louis; Chamitoff, Greg
2008-01-01
In this paper, the attitude control issues associated with International Space Station (ISS) loss of automatic thruster control capability are discussed and methods for attitude control recovery are presented. This scenario was experienced recently during Shuttle mission STS-117 and ISS Stage 13A in June 2007 when the Russian GN&C computers, which command the ISS thrusters, failed. Without automatic propulsive attitude control, the ISS would not be able to regain attitude control after the Orbiter undocked. The core issues associated with recovering long-term attitude control using CMGs are described as well as the systems engineering analysis to identify recovery options. It is shown that the recovery method can be separated into a procedure for rate damping to a safe harbor gravity gradient stable orientation and a capability to maneuver the vehicle to the necessary initial conditions for long term attitude hold. A manual control option using Soyuz and Progress vehicle thrusters is investigated for rate damping and maneuvers. The issues with implementing such an option are presented and the key issue of closed-loop stability is addressed. A new non-propulsive alternative to thruster control, Zero Propellant Maneuver (ZPM) attitude control method is introduced and its rate damping and maneuver performance evaluated. It is shown that ZPM can meet the tight attitude and rate error tolerances needed for long term attitude control. A combination of manual thruster rate damping to a safe harbor attitude followed by a ZPM to Stage long term attitude control orientation was selected by the Anomaly Resolution Team as the alternate attitude control method for such a contingency.
Particle-in-cell numerical simulations of a cylindrical Hall thruster with permanent magnets
Miranda, Rodrigo A.; Martins, Alexandre A.; Ferreira, José L.
2017-10-01
The cylindrical Hall thruster (CHT) is a propulsion device that offers high propellant utilization and performance at smaller dimensions and lower power levels than traditional Hall thrusters. In this paper we present first results of a numerical model of a CHT. This model solves particle and field dynamics self-consistently using a particle-in-cell approach. We describe a number of techniques applied to reduce the execution time of the numerical simulations. The specific impulse and thrust computed from our simulations are in agreement with laboratory experiments. This simplified model will allow for a detailed analysis of different thruster operational parameters and obtain an optimal configuration to be implemented at the Plasma Physics Laboratory at the University of Brasília.
Use of an ions thruster to dispose of type II long-lived fission products into outer space
International Nuclear Information System (INIS)
Takahashi, H.; Yu, A.
1997-01-01
To dispose of long-lived fission products (LLFPs) into outer space, an ions thruster can be used instead of a static accelerator. The specifications of the ions thrusters which are presently studies for space propulsion are presented, and their usability discussed. Using of a rocket with an ions thruster for disposing of the LLFPs directly into the sun required a larger amount of energy than does the use of an accelerator
MEMS-Based Solid Propellant Rocket Array Thruster
Tanaka, Shuji; Hosokawa, Ryuichiro; Tokudome, Shin-Ichiro; Hori, Keiichi; Saito, Hirobumi; Watanabe, Masashi; Esashi, Masayoshi
The prototype of a solid propellant rocket array thruster for simple attitude control of a 10 kg class micro-spacecraft was completed and tested. The prototype has 10×10 φ0.8 mm solid propellant micro-rockets arrayed at a pitch of 1.2 mm on a 20×22 mm substrate. To realize such a dense array of micro-rockets, each ignition heater is powered from the backside of the thruster through an electrical feedthrough which passes along a propellant cylinder wall. Boron/potassium nitrate propellant (NAB) is used with/without lead rhodanide/potassium chlorate/nitrocellulose ignition aid (RK). Impulse thrust was measured by a pendulum method in air. Ignition required electric power of at least 3 4 W with RK and 4 6 W without RK. Measured impulse thrusts were from 2×10-5 Ns to 3×10-4 Ns after the calculation of compensation for air dumping.
Control Valve for Miniature Xenon Ion Thruster, Phase II
National Aeronautics and Space Administration — NASA is continuing its development of electric propulsion engines for various applications. Efforts have been directed toward both large and small thrusters,...
Prediction of GNSS satellite clocks
International Nuclear Information System (INIS)
Broederbauer, V.
2010-01-01
This thesis deals with the characterisation and prediction of GNSS-satellite-clocks. A prerequisite to develop powerful algorithms for the prediction of clock-corrections is the thorough study of the behaviour of the different clock-types of the satellites. In this context the predicted part of the IGU-clock-corrections provided by the Analysis Centers (ACs) of the IGS was compared to the IGS-Rapid-clock solutions to determine reasonable estimates of the quality of already existing well performing predictions. For the shortest investigated interval (three hours) all ACs obtain almost the same accuracy of 0,1 to 0,4 ns. For longer intervals the individual predictions results start to diverge. Thus, for a 12-hours- interval the differences range from nearly 10 ns (GFZ, CODE) until up to some 'tens of ns'. Based on the estimated clock corrections provided via the IGS Rapid products a simple quadratic polynomial turns out to be sufficient to describe the time series of Rubidium-clocks. On the other hand Cesium-clocks show a periodical behaviour (revolution period) with an amplitude of up to 6 ns. A clear correlation between these amplitudes and the Sun elevation angle above the orbital planes can be demonstrated. The variability of the amplitudes is supposed to be caused by temperature-variations affecting the oscillator. To account for this periodical behaviour a quadratic polynomial with an additional sinus-term was finally chosen as prediction model both for the Cesium as well as for the Rubidium clocks. The three polynomial-parameters as well as amplitude and phase shift of the periodic term are estimated within a least-square-adjustment by means of program GNSS-VC/static. Input-data are time series of the observed part of the IGU clock corrections. With the estimated parameters clock-corrections are predicted for various durations. The mean error of the prediction of Rubidium-clock-corrections for an interval of six hours reaches up to 1,5 ns. For the 12-hours
STS-39: OMS Pod Thruster Removal/Replace
1991-01-01
Shown is the removal and replacement of the Discovery's orbital maneuvering systems (OMS) pod thruster. The OMS engine will be used to propel Discovery north, off of its previous orbital groundtrack, without changing the spacecraft's altitude. A burn with this lateral effect is known as "out-of-plane."
Beattie, J. R.
1983-01-01
An investigation of short term measurement techniques for predicting the wearout of ion thrusters resulting from sputter erosion damage is described. The previously established laminar thin film techniques to provide high precision erosion rate data. However, the erosion rates obtained using this technique are generally substantially higher than those obtained during long term endurance tests (by virtue of the as deposited nature of the thin films), so that the results must be interpreted in a relative sense. Absolute measurements can be performed using a new masked substrate arrangement which was developed during this study. This new technique provides a means for estimating the lifetimes of critical discharge chamber components based on direct measurements of sputter erosion depths obtained during short duration (10 hour) tests. The method enables the effects on lifetime of thruster design and operating parameters to be inferred without the investment of the time and capital required to conduct long term (1000 hour) endurance tests. Results obtained using the direct measurement technique are shown to agree with sputter erosion depths calculated for the plasma conditions of the test and also with lifetest results. The direct measurement approach is shown to be applicable to both mercury and argon discharge plasma environments and should be useful in estimating the lifetimes of inert gas and extended performance mercury ion thrusters presently under development.
Space Charge Saturated Sheath Regime and Electron Temperature Saturation in Hall Thrusters
International Nuclear Information System (INIS)
Raitses, Y.; Staack, D.; Smirnov, A.; Fisch, N.J.
2005-01-01
Secondary electron emission in Hall thrusters is predicted to lead to space charge saturated wall sheaths resulting in enhanced power losses in the thruster channel. Analysis of experimentally obtained electron-wall collision frequency suggests that the electron temperature saturation, which occurs at high discharge voltages, appears to be caused by a decrease of the Joule heating rather than by the enhancement of the electron energy loss at the walls due to a strong secondary electron emission
Determination of the Hall Thruster Operating Regimes; TOPICAL
International Nuclear Information System (INIS)
L. Dorf; V. Semenov; Y. Raitses; N.J. Fisch
2002-01-01
A quasi one-dimensional (1-D) steady-state model of the Hall thruster is presented. For the same discharge voltage two operating regimes are possible - with and without the anode sheath. For given mass flow rate, magnetic field profile and discharge voltage a unique solution can be constructed, assuming that the thruster operates in one of the regimes. However, we show that for a given temperature profile the applied discharge voltage uniquely determines the operating regime: for discharge voltages greater than a certain value, the sheath disappears. That result is obtained over a wide range of incoming neutral velocities, channel lengths and widths, and cathode plane locations. It is also shown that a good correlation between the quasi 1-D model and experimental results can be achieved by selecting an appropriate electron mobility and temperature profile
Experimental Investigation of the Near-Wall Region in the NASA HiVHAc EDU2 Hall Thruster
Shastry, Rohit; Kamhawi, Hani; Huang, Wensheng; Haag, Thomas W.
2015-01-01
The HiVHAc propulsion system is currently being developed to support Discovery-class NASA science missions. Presently, the thruster meets the required operational lifetime by utilizing a novel discharge channel replacement mechanism. As a risk reduction activity, an alternative approach is being investigated that modifies the existing magnetic circuit to shift the ion acceleration zone further downstream such that the magnetic components are not exposed to direct ion impingement during the thruster's lifetime while maintaining adequate thruster performance and stability. To measure the change in plasma properties between the original magnetic circuit configuration and the modified, "advanced" configuration, six Langmuir probes were flush-mounted within each channel wall near the thruster exit plane. Plasma potential and electron temperature were measured for both configurations across a wide range of discharge voltages and powers. Measurements indicate that the upstream edge of the acceleration zone shifted downstream by as much as 0.104 channel lengths, depending on operating condition. The upstream edge of the acceleration zone also appears to be more insensitive to operating condition in the advanced configuration, remaining between 0.136 and 0.178 channel lengths upstream of the thruster exit plane. Facility effects studies performed on the original configuration indicate that the plasma and acceleration zone recede further upstream into the channel with increasing facility pressure. These results will be used to inform further modifications to the magnetic circuit that will provide maximum protection of the magnetic components without significant changes to thruster performance and stability.
Elias, P. Q.; Jarrige, J.; Cucchetti, E.; Cannat, F.; Packan, D.
2017-09-01
Measuring the full ion velocity distribution function (IVDF) by non-intrusive techniques can improve our understanding of the ionization processes and beam dynamics at work in electric thrusters. In this paper, a Laser-Induced Fluorescence (LIF) tomographic reconstruction technique is applied to the measurement of the IVDF in the plume of a miniature Hall effect thruster. A setup is developed to move the laser axis along two rotation axes around the measurement volume. The fluorescence spectra taken from different viewing angles are combined using a tomographic reconstruction algorithm to build the complete 3D (in phase space) time-averaged distribution function. For the first time, this technique is used in the plume of a miniature Hall effect thruster to measure the full distribution function of the xenon ions. Two examples of reconstructions are provided, in front of the thruster nose-cone and in front of the anode channel. The reconstruction reveals the features of the ion beam, in particular on the thruster axis where a toroidal distribution function is observed. These findings are consistent with the thruster shape and operation. This technique, which can be used with other LIF schemes, could be helpful in revealing the details of the ion production regions and the beam dynamics. Using a more powerful laser source, the current implementation of the technique could be improved to reduce the measurement time and also to reconstruct the temporal evolution of the distribution function.
2D Electrostatic Potential Solver for Hall Thruster Simulation
National Research Council Canada - National Science Library
Koo, Justin W
2006-01-01
...) for Hall thruster simulation. It is based on a finite volume discretization of a current conservation equation where the electron current density is described by a Generalized Ohm's law description...
Electromagnetic properties of a modular MHD thruster
Kom, C. H.; Brunet, Y.
1999-04-01
The magnetic field of an annular MHD thruster made of independent superconducting modules has been studied with analytical and numerical methods. This configuration allows to obtain large magnetized volumes and high induction levels with rapidly decreasing stray fields. When some inductors are out of order, the thruster remains still operational, but the stray fields increase in the vicinity of the failure. For given structural materials and superconductors, it is possible to determine the size of the conductor in order to reduce the electromagnetic forces and the peak field supported by the conductors. For an active field of 10 T in a 6 m ray annular active channel of a thruster with 24 modules, the peak field is exactly 15.6 T in the Nb3Sn conductors and the structure has to sustain 10^8 N/m forces. The necessity to place some magnetic or superconducting shield is discussed, particularly when the thruster is in a degraded regime. Nous présentons une étude analytique et numérique du champ magnétique d'un propulseur MHD naval annulaire, constitué de secteurs inducteurs supraconducteurs. Cette configuration nécessite des champs magnétiques élevés dans des volumes importants, et permet une décroissance rapide des champs de fuite. Lorsque quelques inducteurs sont en panne, le propulseur reste toujours opérationnel, mais les champs de fuite sont importants aux environs des modules hors service. Étant donné un matériau supraconducteur, il est possible de déterminer la forme des inducteurs dans le but de réduire à la fois les forces électromagnétiques et le surchamp supporté par le bobinage. Pour un propulseur annulaire constitué de 24 modules inducteurs, et un champ actif de 10 T au centre de la partie active du canal (r = 6 m) on obtient avec du Nb3Sn un champ maximun sur le conducteur de 15,5 T et la structure supporte une force de 10^8 N/m. De plus, la nécessité de placer des écrans magnétique ou supraconducteur en régime dégradé (mise
Dankanich, John; Polzin, Kurt; Walker, Mitchell
2015-01-01
The project is an international collaboration and academic partnership to mature an innovative electric propulsion thruster concept to Technology Research Level-3 (TRL-3) through direct thrust measurement. The project includes application assessment of the technology ranging from small spacecraft to high power. The Plasma propulsion with Electronegative GASES(PEGASES) basic proof of concept has been matured to TRL-2 by Ane Aanesland of Laboratoire de Physique des Plasma at Ecole Polytechnique. The concept has advantages through eliminating the neutralizer requirement and should yield longer life and lower cost over conventional gridded ion engines. The objective of this research is to validate the proof of concept through the first direct thrust measurements and mature the concept to TRL-3.
Pages, X.
2000-03-01
in the early 90's in Hall propulsion through numerous partnership with Russian, American and Italian companies and/or universities. A mature knowledge of Hall thruster functioning and technologies helped SEP to recently complete a successful qualification of their first Hall thruster. "PPS 1350" which will be in flight aboard STENTOR French technological satellite in year 2000. A cost reduction research of this new product was held in parallel to the PPS 1350 qualification, taking into account all the lessons learnt during PPS 1350 development. Its major outputs are the numerous simplifications that were found leading to dramatic cost reductions without impairing thruster performances (reliability was even improved). This improved thruster is today very favorably considered by several primes for small low earth orbit satellites. Hydrazine propulsion is an other example. In this field, which SEP decided in 1996 to accompany their customers in their move from large traditional satellites (SPOT/ERS family) to smaller, cheaper ones. To do so, SEP proposed a monolithic propulsion subsystem (patented design) in which all usual propulsion subsystem assembly devices (piping, supports, brackets…) are avoided, components being directly mounted on the propellant tank. Significant costs reduction could be offered to customers thanks to this innovation. Along with the hydrazine propulsion, SEP also modernised their solar array drive mechanisms the SEPTA's® — SEPTA 31 was qualified end 1998 and will have its maiden flight aboard CNES/ALCATEL JASONI small earth observation satellite. In summary, SEP had to make important changes in order to adapt to the market evolution, which occurred in the early 90's. There efforts implied as well organization as processes as products. First outputs are significant cost reduction; in line will the objectives. First hardware of this new generation will fly in year 2000.
Non-Maxwellian electron energy probability functions in the plume of a SPT-100 Hall thruster
Giono, G.; Gudmundsson, J. T.; Ivchenko, N.; Mazouffre, S.; Dannenmayer, K.; Loubère, D.; Popelier, L.; Merino, M.; Olentšenko, G.
2018-01-01
We present measurements of the electron density, the effective electron temperature, the plasma potential, and the electron energy probability function (EEPF) in the plume of a 1.5 kW-class SPT-100 Hall thruster, derived from cylindrical Langmuir probe measurements. The measurements were taken on the plume axis at distances between 550 and 1550 mm from the thruster exit plane, and at different angles from the plume axis at 550 mm for three operating points of the thruster, characterized by different discharge voltages and mass flow rates. The bulk of the electron population can be approximated as a Maxwellian distribution, but the measured distributions were seen to decline faster at higher energy. The measured EEPFs were best modelled with a general EEPF with an exponent α between 1.2 and 1.5, and their axial and angular characteristics were studied for the different operating points of the thruster. As a result, the exponent α from the fitted distribution was seen to be almost constant as a function of the axial distance along the plume, as well as across the angles. However, the exponent α was seen to be affected by the mass flow rate, suggesting a possible relationship with the collision rate, especially close to the thruster exit. The ratio of the specific heats, the γ factor, between the measured plasma parameters was found to be lower than the adiabatic value of 5/3 for each of the thruster settings, indicating the existence of non-trivial kinetic heat fluxes in the near collisionless plume. These results are intended to be used as input and/or testing properties for plume expansion models in further work.
A concept of ferroelectric microparticle propulsion thruster
International Nuclear Information System (INIS)
Yarmolich, D.; Vekselman, V.; Krasik, Ya. E.
2008-01-01
A space propulsion concept using charged ferroelectric microparticles as a propellant is suggested. The measured ferroelectric plasma source thrust, produced mainly by microparticles emission, reaches ∼9x10 -4 N. The obtained trajectories of microparticles demonstrate that the majority of the microparticles are positively charged, which permits further improvement of the thruster
Deposition of fluorocarbon films by Pulsed Plasma Thruster on the anode side
International Nuclear Information System (INIS)
Zhang, Rui; Zhang, Daixian; Zhang, Fan; He, Zhen; Wu, Jianjun
2013-01-01
Fluorocarbon thin films were deposited by Pulsed Plasma Thruster at different angles on the anode side of the thruster. Density and velocity of the plasma in the plume of the Pulsed Plasma Thruster were determined using double and triple Langmuir probe apparatus respectively. The deposited films were characterized by X-ray photoelectron spectroscopy (XPS), scanning probe microscope (SPM) and UV–vis spectrometer. Low F/C ratio (0.64–0.86) fluorocarbon films are deposited. The F/C ratio decreases with angle increasing from 0 degree to 30 degree; however it turns to increase with angle increasing from 45 degree to 90 degree. The films deposited at center angles appear rougher compared with that prepared at angles beyond 45 degree. These films basically show having strong absorption properties for wavelength below 600 nm and having enhanced reflective characteristics. Due to the influence of the chemical composition and the surface morphology of the films, the optical properties of these films also show significant angular dependence.
Magnesium Hall Thruster for Solar System Exploration, Phase II
National Aeronautics and Space Administration — The innovation being developed in this program is a Mg Hall Effect Thruster system that would open the door for In-Situ Resource Utilization based solar system...
Design study of an AC power supply system in JT-60SA
International Nuclear Information System (INIS)
Shimada, Katsuhiro; Baulaigue, Olivier; Cara, Philippe; Coletti, Alberto; Coletti, Roberto; Matsukawa, Makoto; Terakado, Tsunehisa; Yamauchi, Kunihito
2011-01-01
In the initial research phase of JT-60SA, which is the International Thermonuclear Experimental Reactor (ITER) satellite Tokamak with superconducting toroidal and poloidal magnetic field coils, the plasma heating operation of 30 MW-60 s or 20 MW-100 s is planned for 5.5 MA single null divertor plasmas. To achieve this operation, AC power source of the medium voltage of 18 kV and ∼7 GJ has to be provided in total to the poloidal field coil power supplies and additional heating devices such as neutral beam injection (NBI) and electron cyclotron radio frequency (ECRF). In this paper, the proposed AC power supply system in JT-60SA was estimated from the view point of available power, and harmonic currents based on the standard plasma operation scenario during the initial research phase. This AC power supply system consists of the reused JT-60 power supply facilities including motor generators with flywheel, AC breakers, harmonic filters, etc., to make it cost effective. In addition, the conceptual design of the upgraded AC power supply system for the ultimate heating power of 41 MW-100 s in the extended research phase is also described.
Development and characterization of high-efficiency, high-specific impulse xenon Hall thrusters
Hofer, Richard Robert
This dissertation presents research aimed at extending the efficient operation of 1600 s specific impulse Hall thruster technology to the 2000--3000 s range. While recent studies of commercially developed Hall thrusters demonstrated greater than 4000 s specific impulse, maximum efficiency occurred at less than 3000 s. It was hypothesized that the efficiency maximum resulted as a consequence of modern magnetic field designs, optimized for 1600 s, which were unsuitable at high-specific impulse. Motivated by the industry efforts and mission studies, the aim of this research was to develop and characterize xenon Hall thrusters capable of both high-specific impulse and high-efficiency operation. The research divided into development and characterization phases. During the development phase, the laboratory-model NASA-173M Hall thrusters were designed with plasma lens magnetic field topographies and their performance and plasma characteristics were evaluated. Experiments with the NASA-173M version 1 (v1) validated the plasma lens design by showing how changing the magnetic field topography at high-specific impulse improved efficiency. Experiments with the NASA-173M version 2 (v2) showed there was a minimum current density and optimum magnetic field topography at which efficiency monotonically increased with voltage. Between 300--1000 V, total specific impulse and total efficiency of the NASA-173Mv2 operating at 10 mg/s ranged from 1600--3400 s and 51--61%, respectively. Comparison of the thrusters showed that efficiency can be optimized for specific impulse by varying the plasma lens design. During the characterization phase, additional plasma properties of the NASA-173Mv2 were measured and a performance model was derived accounting for a multiply-charged, partially-ionized plasma. Results from the model based on experimental data showed how efficient operation at high-specific impulse was enabled through regulation of the electron current with the magnetic field. The
Discharge Oscillations in a Permanent Magnet Cylindrical Hall-Effect Thruster
Polzin, K. A.; Sooby, E. S.; Raitses, Y.; Merino, E.; Fisch, N. J.
2009-01-01
Measurements of the discharge current in a cylindrical Hall thruster are presented to quantify plasma oscillations and instabilities without introducing an intrusive probe into the plasma. The time-varying component of the discharge current is measured using a current monitor that possesses a wide frequency bandwidth and the signal is Fourier transformed to yield the frequency spectra present, allowing for the identification of plasma oscillations. The data show that the discharge current oscillations become generally greater in amplitude and complexity as the voltage is increased, and are reduced in severity with increasing flow rate. The breathing mode ionization instability is identified, with frequency as a function of discharge voltage not increasing with discharge voltage as has been observed in some traditional Hall thruster geometries, but instead following a scaling similar to a large-amplitude, nonlinear oscillation mode recently predicted in for annular Hall thrusters. A transition from lower amplitude oscillations to large relative fluctuations in the oscillating discharge current is observed at low flow rates and is suppressed as the mass flow rate is increased. A second set of peaks in the frequency spectra are observed at the highest propellant flow rate tested. Possible mechanisms that might give rise to these peaks include ionization instabilities and interactions between various oscillatory modes.
Enabling Ring-Cusp Ion Thruster Technology for NASA Missions
National Aeronautics and Space Administration — ESA is flying T6 Kaufman ion thrusters on the BepiColombo Mission to Mercury in 2018. They are planning to develop a longer life, higher performing, 30-cm ring-cusp...
High Input Voltage Hall Thruster Discharge Converter, Phase I
National Aeronautics and Space Administration — The overall scope of this Phase I/II effort is the development of a high efficiency 15kW (nominal) Hall thruster discharge converter. In Phase I, Busek Co. Inc. will...
Experimental Investigations of a Krypton Stationary Plasma Thruster
Directory of Open Access Journals (Sweden)
A. I. Bugrova
2013-01-01
Full Text Available Stationary plasma thrusters are attractive electric propulsion systems for spacecrafts. The usual propellant is xenon. Among the other suggested propellants, krypton could be one of the best candidates. Most studies have been carried out with a Hall effect thruster previously designed for xenon. The ATON A-3 developed by MSTU MIREA (Moscow initially defined for xenon has been optimized for krypton. The stable high-performance ATON A-3 operation in Kr has been achieved after optimization of its magnetic field configuration and its optimization in different parameters: length and width of the channel, buffer volume dimensions, mode of the cathode operation, and input parameters. For a voltage of 400 V and the anode mass flow rate of 2.5 mg/s the anode efficiency reaches 60% and the specific impulse reaches 2900 s under A-3 operating with Kr. The achieved performances under operation A-3 with Kr are presented and compared with performances obtained with Xe.
International Nuclear Information System (INIS)
Zhang, Tao; Li, Guoxiu; Yu, Yusong; Sun, Zuoyu; Wang, Meng; Chen, Jun
2014-01-01
Highlights: • Decomposition and combustion process of ADN-based thruster are studied. • Distribution of droplets is obtained during the process of spray hit on wire mesh. • Two temperature models are adopted to describe the heat transfer in porous media. • The influences brought by different mass flux and porosity are studied. - Abstract: Ammonium dinitramide (ADN) monopropellant is currently the most promising among all ‘green propellants’. In this paper, the decomposition and combustion process of liquid ADN-based ternary mixtures for propulsion are numerically studied. The R–R distribution model is used to study the initial boundary conditions of droplet distribution resulting from spray hit on a wire mesh based on PDA experiment. To simulate the heat-transfer characteristics between the gas–solid phases, a two-temperature porous medium model in a catalytic bed is used. An 11-species and 7-reactions chemistry model is used to study the catalytic and combustion processes. The final distribution of temperature, pressure, and other kinds of material component concentrations are obtained using the ADN thruster. The results of simulation conducted in the present study are well agree with previous experimental data, and the demonstration of the ADN thruster confirms that a good steady-state operation is achieved. The effects of spray inlet mass flux and porosity on monopropellant thruster performance are analyzed. The numerical results further show that a larger inlet mass flux results in better thruster performance and a catalytic bed porosity value of 0.5 can exhibit the best thruster performance. These findings can serve as a key reference for designing and testing non-toxic aerospace monopropellant thrusters
Effect of plasma distribution on propulsion performance in electrodeless plasma thrusters
Takao, Yoshinori; Takase, Kazuki; Takahashi, Kazunori
2016-09-01
A helicon plasma thruster consisting of a helicon plasma source and a magnetic nozzle is one of the candidates for long-lifetime thrusters because no electrodes are employed to generate or accelerate plasma. A recent experiment, however, detected the non-negligible axial momentum lost to the lateral wall boundary, which degrades thruster performance, when the source was operated with highly ionized gases. To investigate this mechanism, we have conducted two-dimensional axisymmetric particle-in-cell (PIC) simulations with the neutral distribution obtained by Direct Simulation Monte Carlo (DSMC) method. The numerical results have indicated that the axially asymmetric profiles of the plasma density and potential are obtained when the strong decay of neutrals occurs at the source downstream. This asymmetric potential profile leads to the accelerated ion towards the lateral wall, leading to the non-negligible net axial force in the opposite direction of the thrust. Hence, to reduce this asymmetric profile by increasing the neutral density at downstream and/or by confining plasma with external magnetic field would result in improvement of the propulsion performance. These effects are also analyzed by PIC/DSMC simulations.
Long Life Cold Cathodes for Hall effect Thrusters, Phase I
National Aeronautics and Space Administration — An electron source incorporating long life, high current density cold cathodes inside a microchannel plate for use with ion thrusters is proposed. Cathode lifetime...
Microfluidic Array of Externally Fed Electrospray Thrusters for Micro-Propulsion
National Aeronautics and Space Administration — The goal of this proposal is to design an electrospray micropropulsion thruster that utilizes a novel propellant transport mechanism. This project is a collaboration...
The Iodine Satellite (iSat) Project Development Towards Critical Design Review
Dankanich, John W.; Calvert, Derek; Kamhawi, Hani; Hickman, Tyler; Szabo, James; Byrne, Lawrence
2015-01-01
Despite the prevalence of small satellites in recent years, the systems flown to date have very limited propulsion capability. SmallSats are typically secondary payloads and have significant constraints for volume, mass, and power in addition to limitations on the use of hazardous propellants or stored energy. These constraints limit the options for SmallSat maneuverability. NASA's Space Technology Mission Directorate approved the iodine Satellite flight project for a rapid demonstration of iodine Hall thruster technology in a 12U (cubesat units) configuration under the Small Spacecraft Technology Program. The mission is a partnership between NASA MSFC, NASA GRC, and Busek Co, Inc., with the Air Force supporting the propulsion technology maturation. The team is working towards the critical design review in the final design and fabrication phase of the project. The current design shows positive technical performance margins in all areas. The iSat project is planned for launch readiness in the spring of 2017.
Modeling of the near field plume of a Hall thruster
International Nuclear Information System (INIS)
Boyd, Iain D.; Yim, John T.
2004-01-01
In this study, a detailed numerical model is developed to simulate the xenon plasma near-field plume from a Hall thruster. The model uses a detailed fluid model to describe the electrons and a particle-based kinetic approach is used to model the heavy xenon ions and atoms. The detailed model is applied to compute the near field plume of a small, 200 W Hall thruster. Results from the detailed model are compared with the standard modeling approach that employs the Boltzmann model. The usefulness of the model detailed is assessed through direct comparisons with a number of different measured data sets. The comparisons illustrate that the detailed model accurately predicts a number of features of the measured data not captured by the simpler Boltzmann approach
Iodine Hall Thruster Propellant Feed System for a CubeSat
Polzin, Kurt A.; Peeples, Steven
2014-01-01
The components required for an in-space iodine vapor-fed Hall effect thruster propellant management system are described. A laboratory apparatus was assembled and used to produce iodine vapor and control the flow through the application of heating to the propellant reservoir and through the adjustment of the opening in a proportional flow control valve. Changing of the reservoir temperature altered the flowrate on the timescale of minutes while adjustment of the proportional flow control valve changed the flowrate immediately without an overshoot or undershoot in flowrate with the requisite recovery time associated with thermal control systems. The flowrates tested spanned a range from 0-1.5 mg/s of iodine, which is sufficient to feed a 200-W Hall effect thruster.
Hybrid-PIC Computer Simulation of the Plasma and Erosion Processes in Hall Thrusters
Hofer, Richard R.; Katz, Ira; Mikellides, Ioannis G.; Gamero-Castano, Manuel
2010-01-01
HPHall software simulates and tracks the time-dependent evolution of the plasma and erosion processes in the discharge chamber and near-field plume of Hall thrusters. HPHall is an axisymmetric solver that employs a hybrid fluid/particle-in-cell (Hybrid-PIC) numerical approach. HPHall, originally developed by MIT in 1998, was upgraded to HPHall-2 by the Polytechnic University of Madrid in 2006. The Jet Propulsion Laboratory has continued the development of HPHall-2 through upgrades to the physical models employed in the code, and the addition of entirely new ones. Primary among these are the inclusion of a three-region electron mobility model that more accurately depicts the cross-field electron transport, and the development of an erosion sub-model that allows for the tracking of the erosion of the discharge chamber wall. The code is being developed to provide NASA science missions with a predictive tool of Hall thruster performance and lifetime that can be used to validate Hall thrusters for missions.
High-Power Krypton Hall Thruster Technology Being Developed for Nuclear-Powered Applications
Jacobson, David T.; Manzella, David H.
2004-01-01
The NASA Glenn Research Center has been performing research and development of moderate specific impulse, xenon-fueled, high-power Hall thrusters for potential solar electric propulsion applications. These applications include Mars missions, reusable tugs for low-Earth-orbit to geosynchronous-Earth-orbit transportation, and missions that require transportation to libration points. This research and development effort resulted in the design and fabrication of the NASA-457M Hall thruster that has been tested at input powers up to 95 kW. During project year 2003, NASA established Project Prometheus to develop technology in the areas of nuclear power and propulsion, which are enabling for deep-space science missions. One of the Project-Prometheus-sponsored Nuclear Propulsion Research tasks is to investigate alternate propellants for high-power Hall thruster electric propulsion. The motivation for alternate propellants includes the disadvantageous cost and availability of xenon propellant for extremely large scale, xenon-fueled propulsion systems and the potential system performance benefits of using alternate propellants. The alternate propellant krypton was investigated because of its low cost relative to xenon. Krypton propellant also has potential performance benefits for deep-space missions because the theoretical specific impulse for a given voltage is 20 percent higher than for xenon because of krypton's lower molecular weight. During project year 2003, the performance of the high-power NASA-457M Hall thruster was measured using krypton as the propellant at power levels ranging from 6.4 to 72.5 kW. The thrust produced ranged from 0.3 to 2.5 N at a discharge specific impulse up to 4500 sec.
Laser-Induced Fluorescence Measurements within a Laboratory Hall Thruster (Postprint)
National Research Council Canada - National Science Library
Hargus, Jr., W. A; Cappelli, M. A
1999-01-01
In this paper, we describe the results of a study of laser induced fluorescence velocimetry of ionic xenon in the plume and interior acceleration channel of a laboratory Hall type thruster operating...
Krivoruchko, D. D.; Skrylev, A. V.
2018-01-01
The article deals with investigation of the excited states populations distribution of a low-temperature xenon plasma in the thruster with closed electron drift at 300 W operating conditions were investigated by laser-induced fluorescence (LIF) over the 350-1100 nm range. Seven xenon ions (Xe II) transitions were analyzed, while for neutral atoms (Xe I) just three transitions were explored, since the majority of Xe I emission falls into the ultraviolet or infrared part of the spectrum and are difficult to measure. The necessary spontaneous emission probabilities (Einstein coefficients) were calculated. Measurements of the excited state distribution were made for points (volume of about 12 mm3) all over the plane perpendicular to thruster axis in four positions on it (5, 10, 50 and 100 mm). Measured LIF signal intensity have differences for each location of researched point (due to anisotropy of thruster plume), however the structure of states populations distribution persisted at plume and is violated at the thruster exit plane and cathode area. Measured distributions show that for describing plasma of Hall thruster one needs to use a multilevel kinetic model, classic model can be used just for far plume region or for specific electron transitions.
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
Near-Surface Plasma Characterization of the 12.5-kW NASA TDU1 Hall Thruster
Shastry, Rohit; Huang, Wensheng; Kamhawi, Hani
2015-01-01
To advance the state-of-the-art in Hall thruster technology, NASA is developing a 12.5-kW, high-specific-impulse, high-throughput thruster for the Solar Electric Propulsion Technology Demonstration Mission. In order to meet the demanding lifetime requirements of potential missions such as the Asteroid Redirect Robotic Mission, magnetic shielding was incorporated into the thruster design. Two units of the resulting thruster, called the Hall Effect Rocket with Magnetic Shielding (HERMeS), were fabricated and are presently being characterized. The first of these units, designated the Technology Development Unit 1 (TDU1), has undergone extensive performance and thermal characterization at NASA Glenn Research Center. A preliminary lifetime assessment was conducted by characterizing the degree of magnetic shielding within the thruster. This characterization was accomplished by placing eight flush-mounted Langmuir probes within each discharge channel wall and measuring the local plasma potential and electron temperature at various axial locations. Measured properties indicate a high degree of magnetic shielding across the throttle table, with plasma potential variations along each channel wall being less than or equal to 5 eV and electron temperatures being maintained at less than or equal to 5 eV, even at 800 V discharge voltage near the thruster exit plane. These properties indicate that ion impact energies within the HERMeS will not exceed 26 eV, which is below the expected sputtering threshold energy for boron nitride. Parametric studies that varied the facility backpressure and magnetic field strength at 300 V, 9.4 kW, illustrate that the plasma potential and electron temperature are insensitive to these parameters, with shielding being maintained at facility pressures 3X higher and magnetic field strengths 2.5X higher than nominal conditions. Overall, the preliminary lifetime assessment indicates a high degree of shielding within the HERMeS TDU1, effectively
Cassini Spacecraft In-Flight Swap to Backup Attitude Control Thrusters
Bates, David M.
2010-01-01
NASA's Cassini Spacecraft, launched on October 15th, 1997 and arrived at Saturn on June 30th, 2004, is the largest and most ambitious interplanetary spacecraft in history. In order to meet the challenging attitude control and navigation requirements of the orbit profile at Saturn, Cassini is equipped with a monopropellant thruster based Reaction Control System (RCS), a bipropellant Main Engine Assembly (MEA) and a Reaction Wheel Assembly (RWA). In 2008, after 11 years of reliable service, several RCS thrusters began to show signs of end of life degradation, which led the operations team to successfully perform the swap to the backup RCS system, the details and challenges of which are described in this paper. With some modifications, it is hoped that similar techniques and design strategies could be used to benefit other spacecraft.
Long Life Miniature Hall Thruster Enabling Low Cost Human Precursor Missions
National Aeronautics and Space Administration — Key and Central Objectives: This investigation aims to demonstrate that the application of magnetic shielding technology on miniature Hall thrusters will...
Hot-Fire Testing of 5N and 22N HPGP Thrusters
Burnside, Christopher G.; Pedersen, Kevin W.; Pierce, Charles W.
2015-01-01
This hot-fire test continues NASA investigation of green propellant technologies for future missions. To show the potential for green propellants to replace some hydrazine systems in future spacecraft, NASA Marshall Space Flight Center (MSFC) is continuing to embark on hot-fire test campaigns with various green propellant blends.NASA completed hot-fire testing of 5N and 22N HPGP thrusters at the Marshall Space Flight Center’s Component Development Area altitude test stand in April 2015. Both thrusters are ground test articles and not flight ready units, but are representative of potential flight hardware with a known path towards flight application. The purpose of the 5N testing was to perform facility check-outs and generate a small set of data for comparison to ECAPS and Orbital ATK data sets. The 5N thruster performed as expected with thrust and propellant flow-rate data generated that are similar to previous testing at Orbital ATK. Immediately following the 5N testing, and using the same facility, the 22N testing was conducted on the same test stand with the purpose of demonstrating the 22N performance. The results of 22N testing indicate it performed as expected.The results of the hot-fire testing are presented in this paper and presentation.
The Iodine Satellite (iSat) Project Development Towards Critical Design Review (CDR)
Dankanich, John W.; Selby, Michael; Polzin, Kurt A.; Kamhawi, Hani; Hickman, Tyler; Byrne, Larry
2016-01-01
Despite the prevalence of Small Satellites in recent years, the systems flown to date have very limited propulsion capability. SmallSats are typically secondary payloads and have significant constraints for volume, mass, and power in addition to limitations on the use of hazardous propellants or stored energy (i.e. high pressure vessels). These constraints limit the options for SmallSat maneuverability. NASA's Space Technology Mission Directorate approved the iodine Satellite flight project for a rapid demonstration of iodine Hall thruster technology in a 12U configuration under the Small Spacecraft Technology Program. The project formally began in FY15 as a partnership between NASA MSFC, NASA GRC, and Busek Co, Inc., with the Air Force supporting the propulsion technology maturation. The team is in final preparation of the Critical Design Review prior to initiating the fabrication and integration phase of the project. The iSat project is on schedule for a launch opportunity in November 2017.
Transit-time instability in Hall thrusters
International Nuclear Information System (INIS)
Barral, Serge; Makowski, Karol; Peradzynski, Zbigniew; Dudeck, Michel
2005-01-01
Longitudinal waves characterized by a phase velocity of the order of the velocity of ions have been recurrently observed in Hall thruster experiments and simulations. The origin of this so-called ion transit-time instability is investigated with a simple one-dimensional fluid model of a Hall thruster discharge in which cold ions are accelerated between two electrodes within a quasineutral plasma. A short-wave asymptotics applied to linearized equations shows that plasma perturbations in such a device consist of quasineutral ion acoustic waves superimposed on a background standing wave generated by discharge current oscillations. Under adequate circumstances and, in particular, at high ionization levels, acoustic waves are amplified as they propagate, inducing strong perturbation of the ion density and velocity. Responding to the subsequent perturbation of the column resistivity, the discharge current generates a standing wave, the reflection of which sustains the generation of acoustic waves at the inlet boundary. A calculation of the frequency and growth rate of this resonance mechanism for a supersonic ion flow is proposed, which illustrates the influence of the ionization degree on their onset and the approximate scaling of the frequency with the ion transit time. Consistent with experimental reports, the traveling wave can be observed on plasma density and velocity perturbations, while the plasma potential ostensibly oscillates in phase along the discharge
Leonardo-BRDF: A New Generation Satellite Constellation
Esper, Jaime; Neeck, Steven; Wiscombe, Warren; Ryschkewitsch, Michael; Andary, J. (Technical Monitor)
2000-01-01
alongtrack or cross-track mode, or anything in between, at ground command. This provides inherent system redundancy and cross-calibration capability. Several "wing-man" satellites in non-static orbits fly in formation up to 1000 km out from the keystone satellites to provide additional along- and cross-track angular sampling. They view the target(s) observed by the keystone satellites from different zenith and azimuth angles and are maneuverable within a limited range of zenith angle using thrusters, and within a large range of azimuth angle using clever orbit design. The wing-man satellites carry single miniature imaging radiometers with just a few wavelength bands in order to be lighter and more agile.
NASA Brief: Q-Thruster Physics
White, Harold
2013-01-01
Q-thrusters are a low-TRL form of electric propulsion that operates on the principle of pushing off of the quantum vacuum. A terrestrial analog to this is to consider how a submarine uses its propeller to push a column of water in one direction, while the sub recoils in the other to conserve momentum -the submarine does not carry a "tank" of sea water to be used as propellant. In our case, we use the tools of Magnetohydrodynamics (MHD) to show how the thruster pushes off of the quantum vacuum which can be thought of as a sea of virtual particles -principally electrons and positrons that pop into and out of existence, and where fields are stronger, there are more virtual particles. The idea of pushing off the quantum vacuum has been in the technical literature for a few decades, but to date, the obstacle has been the magnitude of the predicted thrust which has been derived analytically to be very small, and therefore not likely to be useful for human spaceflight. Our recent theoretical model development and test data suggests that we can greatly increase the magnitude of the negative pressure of the quantum vacuum and generate a specific force such that technology based on this approach can be competitive for in-space propulsion approx. 0.1N/kW), and possibly for terrestrial applications (approx. 10N/kW). As an additional validation of the approach, the theory allows calculation of physics constants from first principles: Gravitational constant, Planck constant, Bohr radius, dark energy fraction, electron mass.
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
Real-Tme Boron Nitride Erosion Measurements of the HiVHAc Thruster via Cavity Ring-Down Spectroscopy
Lee, Brian C.; Yalin, Azer P.; Gallimore, Alec; Huang, Wensheng; Kamhawi, Hani
2013-01-01
Cavity ring-down spectroscopy was used to make real-time erosion measurements from the NASA High Voltage Hall Accelerator thruster. The optical sensor uses 250 nm light to measure absorption of atomic boron in the plume of an operating Hall thruster. Theerosion rate of the High Voltage Hall Accelerator thruster was measured for discharge voltages ranging from 330 to 600 V and discharge powers ranging from 1 to 3 kW. Boron densities as high as 6.5 x 10(exp 15) per cubic meter were found within the channel. Using a very simple boronvelocity model, approximate volumetric erosion rates between 5.0 x 10(exp -12) and 8.2 x 10(exp -12) cubic meter per second were found.
Enabling University Satellites to Travel to the Moon and Beyond
Siy, Grace; Branam, Richard
2017-11-01
Electric propulsion is a method of creating thrust for space exploration that requires less propellant than traditional chemical rockets by producing much higher exhaust velocities, and subsequently costing less. Currently, such forms of propulsion are unable to generate the vast amounts of thrust that traditional thrusters do, thus research is being done in the area. The focus of this project is Hall Effect thrusters, a specific type of ion propulsion. The distinctive feature of these thrusters are magnets which capture the electrons from the cathode. These electrons ionize the propellant gas and then interact with the present electric field to accelerate the resulting ions, generating thrust. The objectives of this project include building two Hall thrusters with different magnet configurations, collecting performance data, and testing with a Faraday probe that directly measures current density. The first magnet configuration will be a conventional Hall Effect thruster arrangement, while the second thruster's magnets are arranged to create a significantly stronger magnetic field. The performance data and Faraday probe results will be used to determine the level of improvement between the thrusters. The goal is to integrate a Hall Effect propulsion system into the university's Cube-Sat program. Special Acknowledgement of the REU Site: Fluid Mechanics with Analysis using Computations and Experiments (FM-ACE) EEC 1659710.
A data acquisition and storage system for the ion auxiliary propulsion system cyclic thruster test
Hamley, John A.
1989-01-01
A nine-track tape drive interfaced to a standard personal computer was used to transport data from a remote test site to the NASA Lewis mainframe computer for analysis. The Cyclic Ground Test of the Ion Auxiliary Propulsion System (IAPS), which successfully achieved its goal of 2557 cycles and 7057 hr of thrusting beam on time generated several megabytes of test data over many months of continuous testing. A flight-like controller and power supply were used to control the thruster and acquire data. Thruster data was converted to RS232 format and transmitted to a personal computer, which stored the raw digital data on the nine-track tape. The tape format was such that with minor modifications, mainframe flight data analysis software could be used to analyze the Cyclic Ground Test data. The personal computer also converted the digital data to engineering units and displayed real time thruster parameters. Hardcopy data was printed at a rate dependent on thruster operating conditions. The tape drive provided a convenient means to transport the data to the mainframe for analysis, and avoided a development effort for new data analysis software for the Cyclic test. This paper describes the data system, interfacing and software requirements.
Simulations of a Plasma Thruster Utilizing the FRC Configuration
Energy Technology Data Exchange (ETDEWEB)
Rognlien, T. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Cohen, B. I. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2016-10-10
This report describes work performed by LLNL to model the behavior and performance of a reverse-field configuration (FRC) type of plasma device as a plasma thruster as summarized by Razin et al. [1], which also describes the MNX device at PPPL used to study this concept.
Geometrical characterization and performance optimization of monopropellant thruster injector
Directory of Open Access Journals (Sweden)
T.R. Nada
2012-12-01
Full Text Available The function of the injector in a monopropellant thruster is to atomize the liquid hydrazine and to distribute it over the catalyst bed as uniformly as possible. A second objective is to place the maximum amount of catalyst in contact with the propellant in as short time as possible to minimize the starting transient time. Coverage by the spray is controlled mainly by cone angle and diameter of the catalyst bed, while atomization quality is measured by the Sauter Mean Diameter, SMD. These parameters are evaluated using empirical formulae. In this paper, two main types of injectors are investigated; plain orifice and full cone pressure swirl injectors. The performance of these two types is examined for use with blow down monopropellant propulsion system. A comprehensive characterization is given and design charts are introduced to facilitate optimizing the performance of the injector. Full-cone injector is a more suitable choice for monopropellant thruster and it might be available commercially.
Kamhawi, Hani; Pinero, Luis; Haag, Thomas; Huang, Wensheng; Ahern, Drew; Liang, Ray; Shilo, Vlad
2016-01-01
NASAs Science Mission Directorate is sponsoring the development of a 4 kW-class Hall propulsion system for implementation in NASA science and exploration missions. The main components of the system include the High Voltage Hall Accelerator (HiVHAc), an engineering model power processing unit (PPU) developed by Colorado Power Electronics, and a xenon flow control module (XFCM) developed by VACCO Industries. NASA Glenn Research Center is performing integrated tests of the Hall thruster propulsion system. This presentation presents results from integrated tests of the PPU and XFCM with the HiVHAc engineering development thruster and a SPT-140 thruster provided by Space System Loral. The results presented in this paper demonstrate thruster discharge initiation, open-loop and closed-loop control of the discharge current with anode flow for both the HiVHAc and the SPT-140 thrusters. Integrated tests with the SPT-140 thruster indicated that the PPU was able to repeatedly initiate the thrusters discharge, achieve steady state operation, and successfully throttle the thruster between 1.5 and 4.5 kW. The measured SPT-140 performance was identical to levels reported by Space Systems Loral.
Carbon Nanotube Based Electric Propulsion Thruster with Low Power Consumption, Phase II
National Aeronautics and Space Administration — Field emission electric propulsion (FEEP) thrusters have gained considerable attention for spacecrafts disturbance compensation because of excellent characteristics....
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Optimisation of a quantum pair space thruster
Directory of Open Access Journals (Sweden)
Valeriu DRAGAN
2012-06-01
Full Text Available The paper addresses the problem of propulsion for long term space missions. Traditionally a space propulsion unit has a propellant mass which is ejected trough a nozzle to generate thrust; this is also the case with inert gases energized by an on-board power unit. Unconventional methods for propulsion include high energy LASERs that rely on the momentum of photons to generate thrust. Anti-matter has also been proposed for energy storage. Although the momentum of ejected gas is significantly higher, the LASER propulsion offers the perspective of unlimited operational time – provided there is a power source. The paper will propose the use of the quantum pair formation for generating a working mass, this is different than conventional anti-matter thrusters since the material particles generated are used as propellant not as energy storage.Two methods will be compared: LASER and positron-electron, quantum pair formation. The latter will be shown to offer better momentum above certain energy levels.For the demonstrations an analytical solution is obtained and provided in the form of various coefficients. The implications are, for now, theoretical however the practicality of an optimized thruster using such particles is not to be neglected for long term space missions.
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
International Nuclear Information System (INIS)
Sterling, Enrique; Lin Jun; Sinko, John; Kodgis, Lisa; Porter, Simon; Pakhomov, Andrew V.; Larson, C. William; Mead, Franklin B. Jr.
2006-01-01
Laser-driven mini-thrusters were studied using Delrin registered and PVC (Delrin registered is a registered trademark of DuPont) as propellants. TEA CO2 laser (λ = 10.6 μm) was used as a driving laser. Coupling coefficients were deduced from two independent techniques: force-time curves measured with a piezoelectric sensor and ballistic pendulum. Time-resolved ICCD images of the expanding plasma and combustion products were analyzed in order to determine the main process that generates the thrust. The measurements were also performed in a nitrogen atmosphere in order to test the combustion effects on thrust. A pinhole transmission experiment was performed for the study of the cut-off time when the ablation/air breakdown plasma becomes opaque to the incoming laser pulse
Sterling, Enrique; Lin, Jun; Sinko, John; Kodgis, Lisa; Porter, Simon; Pakhomov, Andrew V.; Larson, C. William; Mead, Franklin B.
2006-05-01
Laser-driven mini-thrusters were studied using Delrin® and PVC (Delrin® is a registered trademark of DuPont) as propellants. TEA CO2 laser (λ = 10.6 μm) was used as a driving laser. Coupling coefficients were deduced from two independent techniques: force-time curves measured with a piezoelectric sensor and ballistic pendulum. Time-resolved ICCD images of the expanding plasma and combustion products were analyzed in order to determine the main process that generates the thrust. The measurements were also performed in a nitrogen atmosphere in order to test the combustion effects on thrust. A pinhole transmission experiment was performed for the study of the cut-off time when the ablation/air breakdown plasma becomes opaque to the incoming laser pulse.
Directory of Open Access Journals (Sweden)
Peng Hu
2016-09-01
Full Text Available The performance characteristics of a Multi-cusped Field Thruster depending on the magnetic field strength in the discharge channel were investigated. Four thrusters with different outer diameters of the magnet rings were designed to change the magnetic field strength in the discharge channel. It is found that increasing the magnetic field strength could restrain the radial cross-field electron current and decrease the radial width of main ionization region, which gives rise to the reduction of propellant utilization and thruster performance. The test results in different anode voltage conditions indicate that both the thrust and anode efficiency are higher for the weaker magnetic field in the discharge channel.
Artificial Neural Network Test Support Development for the Space Shuttle PRCS Thrusters
Lehr, Mark E.
2005-01-01
A significant anomaly, Fuel Valve Pilot Seal Extrusion, is affecting the Shuttle Primary Reaction Control System (PRCS) Thrusters, and has caused 79 to fail. To help address this problem, a Shuttle PRCS Thruster Process Evaluation Team (TPET) was formed. The White Sands Test Facility (WSTF) and Boeing members of the TPET have identified many discrete valve current trace characteristics that are predictive of the problem. However, these are difficult and time consuming to identify and trend by manual analysis. Based on this exhaustive analysis over months, 22 thrusters previously delivered by the Depot were identified as high risk for flight failures. Although these had only recently been installed, they had to be removed from Shuttles OV103 and OV104 for reprocessing, by directive of the Shuttle Project Office. The resulting impact of the thruster removal, replacement, and valve replacement was significant (months of work and hundreds of thousands of dollars). Much of this could have been saved had the proposed Neural Network (NN) tool described in this paper been in place. In addition to the significant benefits to the Shuttle indicated above, the development and implementation of this type of testing will be the genesis for potential Quality improvements across many areas of WSTF test data analysis and will be shared with other NASA centers. Future tests can be designed to incorporate engineering experience via Artificial Neural Nets (ANN) into depot level acceptance of hardware. Additionally, results were shared with a NASA Engineering and Safety Center (NESC) Super Problem Response Team (SPRT). There was extensive interest voiced among many different personnel from several centers. There are potential spin-offs of this effort that can be directly applied to other data acquisition systems as well as vehicle health management for current and future flight vehicles.
Space Weather Magnetometer Set with Automated AC Spacecraft Field Correction for GEO-KOMPSAT-2A
Auster, U.; Magnes, W.; Delva, M.; Valavanoglou, A.; Leitner, S.; Hillenmaier, O.; Strauch, C.; Brown, P.; Whiteside, B.; Bendyk, M.; Hilgers, A.; Kraft, S.; Luntama, J. P.; Seon, J.
2016-05-01
Monitoring the solar wind conditions, in particular its magnetic field (interplanetary magnetic field) ahead of the Earth is essential in performing accurate and reliable space weather forecasting. The magnetic condition of the spacecraft itself is a key parameter for the successful performance of the magnetometer onboard. In practice a condition with negligible magnetic field of the spacecraft cannot always be fulfilled and magnetic sources on the spacecraft interfere with the natural magnetic field measured by the space magnetometer. The presented "ready-to-use" Service Oriented Spacecraft Magnetometer (SOSMAG) is developed for use on any satellite implemented without magnetic cleanliness programme. It enables detection of the spacecraft field AC variations on a proper time scale suitable to distinguish the magnetic field variations relevant to space weather phenomena, such as sudden increase in the interplanetary field or southward turning. This is achieved through the use of dual fluxgate magnetometers on a short boom (1m) and two additional AMR sensors on the spacecraft body, which monitor potential AC disturbers. The measurements of the latter sensors enable an automated correction of the AC signal contributions from the spacecraft in the final magnetic vector. After successful development and test of the EQM prototype, a flight model (FM) is being built for the Korean satellite Geo-Kompsat 2A, with launch foreseen in 2018.
Beyond reliability, multi-state failure analysis of satellite subsystems: A statistical approach
International Nuclear Information System (INIS)
Castet, Jean-Francois; Saleh, Joseph H.
2010-01-01
Reliability is widely recognized as a critical design attribute for space systems. In recent articles, we conducted nonparametric analyses and Weibull fits of satellite and satellite subsystems reliability for 1584 Earth-orbiting satellites launched between January 1990 and October 2008. In this paper, we extend our investigation of failures of satellites and satellite subsystems beyond the binary concept of reliability to the analysis of their anomalies and multi-state failures. In reliability analysis, the system or subsystem under study is considered to be either in an operational or failed state; multi-state failure analysis introduces 'degraded states' or partial failures, and thus provides more insights through finer resolution into the degradation behavior of an item and its progression towards complete failure. The database used for the statistical analysis in the present work identifies five states for each satellite subsystem: three degraded states, one fully operational state, and one failed state (complete failure). Because our dataset is right-censored, we calculate the nonparametric probability of transitioning between states for each satellite subsystem with the Kaplan-Meier estimator, and we derive confidence intervals for each probability of transitioning between states. We then conduct parametric Weibull fits of these probabilities using the Maximum Likelihood Estimation (MLE) approach. After validating the results, we compare the reliability versus multi-state failure analyses of three satellite subsystems: the thruster/fuel; the telemetry, tracking, and control (TTC); and the gyro/sensor/reaction wheel subsystems. The results are particularly revealing of the insights that can be gleaned from multi-state failure analysis and the deficiencies, or blind spots, of the traditional reliability analysis. In addition to the specific results provided here, which should prove particularly useful to the space industry, this work highlights the importance
Antennas Designed for Advanced Communications for Air Traffic Management (AC/ATM) Project
Zakrajsek, Robert J.
2000-01-01
The goal of the Advanced Communications for Air Traffic Management (AC/ATM) Project at the NASA Glenn Research Center at Lewis Field is to enable a communications infrastructure that provides the capacity, efficiency, and flexibility necessary to realize a mature free-flight environment. The technical thrust of the AC/ATM Project is targeted at the design, development, integration, test, and demonstration of enabling technologies for global broadband aeronautical communications. Since Ku-band facilities and equipment are readily available, one of the near-term demonstrations involves a link through a Kuband communications satellite. Two conformally mounted antennas will support the initial AC/ATM communications links. Both of these are steered electronically through monolithic microwave integrated circuit (MMIC) amplifiers and phase shifters. This link will be asymmetrical with the downlink to the aircraft (mobile vehicle) at a throughput rate of greater than 1.5 megabits per second (Mbps), whereas the throughput rate of the uplink from the aircraft will be greater than 100 kilobits per second (kbps). The data on the downlink can be narrow-band, wide-band, or a combination of both, depending on the requirements of the experiment. The AC/ATM project is purchasing a phased-array Ku-band transmitting antenna for the uplink from the test vehicle. Many Ku-band receiving antennas have been built, and one will be borrowed for a short time to perform the initial experiments at the NASA Glenn Research Center at Lewis Field. The Ku-band transmitting antenna is a 254-element MMIC phased-array antenna being built by Boeing Phantom Works. Each element can radiate 100 mW. The antenna is approximately 43-cm high by 24-cm wide by 3.3-cm thick. It can be steered beyond 60 from broadside. The beamwidth varies from 6 at broadside to 12 degrees at 60 degrees, which is typical of phased-array antennas. When the antenna is steered to 60 degrees, the beamwidth will illuminate
Silicon Carbide (SiC) Power Processing Unit (PPU) for Hall Effect Thrusters
Reese, Bradley
2015-01-01
Arkansas Power Electronics International (APEI), Inc., is developing a high-efficiency, radiation-hardened 3.8-kW SiC power supply for the PPU of Hall effect thrusters. This project specifically targets the design of a PPU for the high-voltage Hall accelerator (HiVHAC) thruster, with target specifications of 80- to 160-V input, 200- to 700-V/5A output, efficiency greater than 96 percent, and peak power density in excess of 2.5 kW/kg. The PPU under development uses SiC junction field-effect transistor power switches, components that APEI, Inc., has irradiated under total ionizing dose conditions to greater than 3 MRad with little to no change in device performance.
Snyder, John S.; Brophy, John R.; Hofer, Richard R.; Goebel, Dan M.; Katz, Ira
2012-01-01
As NASA considers future exploration missions, high-power solar-electric propulsion (SEP) plays a prominent role in achieving many mission goals. Studies of high-power SEP systems (i.e. tens to hundreds of kilowatts) suggest that significant mass savings may be realized by implementing a direct-drive power system, so NASA recently established the National Direct-Drive Testbed to examine technical issues identified by previous investigations. The testbed includes a 12-kW solar array and power control station designed to power single and multiple Hall thrusters over a wide range of voltages and currents. In this paper, single Hall thruster operation directly from solar array output at discharge voltages of 200 to 450 V and discharge powers of 1 to 10 kW is reported. Hall thruster control and operation is shown to be simple and no different than for operation on conventional power supplies. Thruster and power system electrical oscillations were investigated over a large range of operating conditions and with different filter capacitances. Thruster oscillations were the same as for conventional power supplies, did not adversely affect solar array operation, and were independent of filter capacitance from 8 to 80 ?F. Solar array current and voltage oscillations were very small compared to their mean values and showed a modest dependence on capacitor size. No instabilities or anomalous behavior were observed in the thruster or power system at any operating condition investigated, including near and at the array peak power point. Thruster startup using the anode propellant flow as the power 'switch' was shown to be simple and reliable with system transients mitigated by the proper selection of filter capacitance size. Shutdown via cutoff of propellant flow was also demonstrated. A simple electrical circuit model was developed and is shown to have good agreement with the experimental data.
Williams, George J.; Kojima, Jun J.; Arrington, Lynn A.; Deans, Matthew C.; Reed, Brian D.; Kinzbach, McKenzie I.; McLean, Christopher H.
2015-01-01
The Green Propellant Infusion Mission (GPIM) will demonstrate the capability of a green propulsion system, specifically, one using the monopropellant, AF-M315E. One of the risks identified for GPIM is potential contamination of sensitive areas of the spacecraft from the effluents in the plumes of AF-M315E thrusters. Plume characterization of a laboratory-model 22 N thruster via optical diagnostics was conducted at NASA GRC in a space-simulated environment. A high-frequency pulsed laser was coupled with an electron-multiplied ICCD camera to perform Raman spectroscopy in the near-field, low-pressure plume. The Raman data yielded plume constituents and temperatures over a range of thruster chamber pressures and as a function of thruster (catalyst) operating time. Schlieren images of the near-field plume enabled calculation of plume velocities and revealed general plume structure of the otherwise invisible plume. The measured velocities are compared to those predicted by a two-dimensional, kinetic model. Trends in data and numerical results are presented from catalyst mid-life to end-of-life. The results of this investigation were coupled with the Raman and Schlieren data to provide an anchor for plume impingement analysis presented in a companion paper. The results of both analyses will be used to improve understanding of the nature of AF-M315E plumes and their impacts to GPIM and other future missions.
Investigation of a subsonic-arc-attachment thruster using segmented anodes
Berns, Darren H.; Sankovic, John M.; Sarmiento, Charles J.
1993-01-01
To investigate high frequency arc instabilities observed in subsonic-arc-attachment thrusters, a 3 kW, segmented-anode arcjet was designed and tested using hydrogen as the propellant. The thruster nozzle geometry was scaled from a 30 kW design previously tested in the 1960's. By observing the current to each segment and the arc voltage, it was determined that the 75-200 kHz instabilities were results of axial movements of the arc anode attachment point. The arc attachment point was fully contained in the subsonic portion of the nozzle for nearly all flow rates. The effects of isolating selected segments were investigated. In some cases, forcing the arc downstream caused the restrike to cease. Finally, decreasing the background pressure from 18 Pa to 0.05 Pa affected the pressure distribution in the nozzle, including the pressure in the subsonic arc chamber.
Investigation of a subsonic-arc-attachment thruster using segmented anodes
Berns, Darren H.; Sankovic, John M.; Sarmiento, Charles J.
1993-01-01
To investigate high frequency arc instabilities observed in subsonic-arc-attachment thrusters, a 3 kW, segmented-anode arc jet was designed and tested using hydrogen as the propellant. The thruster nozzle geometry was scaled from a 30 kW design previously tested in the 1960's. By observing the current to each segment and the arc voltage, it was determined that the 75-200 kHz instabilities were results of axial movements of the arc anode attachment point. The arc attachment point was fully contained in the subsonic portion of the nozzle for nearly all flow rates. The effects of isolating selected segments were investigated. In some cases, forcing the arc downstream caused the restrike to cease. Finally, decreasing the background pressure from 18 to 0.05 Pa affected the pressure distribution in the nozzle including the pressure in the subsonic arc chamber.
HIGH ENERGY REPLACEMENT FOR TEFLON PROPELLANT IN PULSED PLASMA THRUSTERS, Phase I
National Aeronautics and Space Administration — This program will utilize a well-characterized Pulsed Plasma Thruster (PPT) to test experimental high-energy extinguishable solid propellants (HE), instead of...
A cavity ring-down spectroscopy sensor for real-time Hall thruster erosion measurements
International Nuclear Information System (INIS)
Lee, B. C.; Huang, W.; Tao, L.; Yamamoto, N.; Yalin, A. P.; Gallimore, A. D.
2014-01-01
A continuous-wave cavity ring-down spectroscopy sensor for real-time measurements of sputtered boron from Hall thrusters has been developed. The sensor uses a continuous-wave frequency-quadrupled diode laser at 250 nm to probe ground state atomic boron sputtered from the boron nitride insulating channel. Validation results from a controlled setup using an ion beam and target showed good agreement with a simple finite-element model. Application of the sensor for measurements of two Hall thrusters, the H6 and SPT-70, is described. The H6 was tested at power levels ranging from 1.5 to 10 kW. Peak boron densities of 10 ± 2 × 10 14 m −3 were measured in the thruster plume, and the estimated eroded channel volume agreed within a factor of 2 of profilometry. The SPT-70 was tested at 600 and 660 W, yielding peak boron densities of 7.2 ± 1.1 × 10 14 m −3 , and the estimated erosion rate agreed within ∼20% of profilometry. Technical challenges associated with operating a high-finesse cavity in the presence of energetic plasma are also discussed
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Development of an Ion Thruster and Power Processor for New Millennium's Deep Space 1 Mission
Sovey, James S.; Hamley, John A.; Haag, Thomas W.; Patterson, Michael J.; Pencil, Eric J.; Peterson, Todd T.; Pinero, Luis R.; Power, John L.; Rawlin, Vincent K.; Sarmiento, Charles J.;
1997-01-01
The NASA Solar Electric Propulsion Technology Applications Readiness Program (NSTAR) will provide a single-string primary propulsion system to NASA's New Millennium Deep Space 1 Mission which will perform comet and asteroid flybys in the years 1999 and 2000. The propulsion system includes a 30-cm diameter ion thruster, a xenon feed system, a power processing unit, and a digital control and interface unit. A total of four engineering model ion thrusters, three breadboard power processors, and a controller have been built, integrated, and tested. An extensive set of development tests has been completed along with thruster design verification tests of 2000 h and 1000 h. An 8000 h Life Demonstration Test is ongoing and has successfully demonstrated more than 6000 h of operation. In situ measurements of accelerator grid wear are consistent with grid lifetimes well in excess of the 12,000 h qualification test requirement. Flight hardware is now being assembled in preparation for integration, functional, and acceptance tests.
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
Nonlinear dynamics of mini-satellite respinup by weak internal controllable torques
Somov, Yevgeny
2014-12-01
Contemporary space engineering advanced new problem before theoretical mechanics and motion control theory: a spacecraft directed respinup by the weak restricted control internal forces. The paper presents some results on this problem, which is very actual for energy supply of information mini-satellites (for communication, geodesy, radio- and opto-electronic observation of the Earth et al.) with electro-reaction plasma thrusters and gyro moment cluster based on the reaction wheels or the control moment gyros. The solution achieved is based on the methods for synthesis of nonlinear robust control and on rigorous analytical proof for the required spacecraft rotation stability by Lyapunov function method. These results were verified by a computer simulation of strongly nonlinear oscillatory processes at respinuping of a flexible spacecraft.
Nonlinear dynamics of mini-satellite respinup by weak internal controllable torques
Energy Technology Data Exchange (ETDEWEB)
Somov, Yevgeny, E-mail: e-somov@mail.ru [Samara State Technical University, Department for Guidance, Navigation and Control, 244 Molodogvardeyskaya Str., Samara 443100 (Russian Federation)
2014-12-10
Contemporary space engineering advanced new problem before theoretical mechanics and motion control theory: a spacecraft directed respinup by the weak restricted control internal forces. The paper presents some results on this problem, which is very actual for energy supply of information mini-satellites (for communication, geodesy, radio- and opto-electronic observation of the Earth et al.) with electro-reaction plasma thrusters and gyro moment cluster based on the reaction wheels or the control moment gyros. The solution achieved is based on the methods for synthesis of nonlinear robust control and on rigorous analytical proof for the required spacecraft rotation stability by Lyapunov function method. These results were verified by a computer simulation of strongly nonlinear oscillatory processes at respinuping of a flexible spacecraft.
Waller, Jess; Saulsberry, Regor L.
2003-01-01
Pilot operated valves (POVs) are used to control the flow of hypergolic propellants monomethylhydrazine (fuel) and nitrogen tetroxide (oxidizer) to the Shuttle orbiter Primary Reaction Control Subsystem (PRCS) thrusters. The POV incorporates a two-stage design: a solenoid-actuated pilot stage, which in turn controls a pressure-actuated main stage. Isolation of propellant supply from the thruster chamber is accomplished in part by a captive polytetrafluoroethylene (PTFE) pilot seal retained inside a Custom 455.1 stainless steel cavity. Extrusion of the pilot seal restricts the flow of fuel around the pilot poppet, thus impeding or preventing the main valve stage from opening. It can also prevent the main stage from staying open with adequate force margin, particularly if there is gas in the main stage actuation cavity. During thruster operation on-orbit, fuel valve pilot seal extrusion is commonly indicated by low or erratic chamber pressure or failure of the thruster to fire upon command (Fail-Off). During ground turnaround, pilot seal extrusion is commonly indicated by slow gaseous nitrogen (GN2) main valve opening times (greater than 38 ms) or slow water main valve opening response times (greater than 33 ms). Poppet lift tests and visual inspection can also detect pilot seal extrusion during ground servicing; however, direct metrology on the pilot seat assembly provides the most quantitative and accurate means of identifying extrusion. Minimizing PRCS fuel valve pilot seal extrusion has become an important issue in the effort to improve PRCS reliability and reduce associated life cycle costs.
Fabrication of LTCC based Micro Thruster for Precision Controlled Spaceflight
DEFF Research Database (Denmark)
Larsen, Jack; Jørgensen, John Leif
2011-01-01
The paper at hand presents the initial investigations on the development and fabrication of a micro thruster based on LTCC technology, delivering a thrust in the micro Newton regime. Using smaller segments of an observation system distributed on two or more spacecrafts, one can realize an observa...
Measurement of erosion rate by absorption spectroscopy in a Hall thruster
International Nuclear Information System (INIS)
Yamamoto, Naoji; Yokota, Shigeru; Matsui, Makoto; Komurasaki, Kimiya; Arakawa, Yoshihiro
2005-01-01
The erosion rate of a Hall thruster was estimated with the objective of building a real-time erosion rate monitoring system using a 1 kW class anode layer type Hall thruster. This system aids the understanding of the tradeoff between lifetime and performance. To estimate the flux of the sputtered wall material, the number density of the sputtered iron was measured by laser absorption spectroscopy using an absorption line from ground atomic iron at 371.9935 nm. An ultravioletAl x In y Ga (1-x-y) N diode laser was used as the probe. The estimated number density of iron was 1.1x10 16 m -3 , which is reasonable when compared with that measured by duration erosion tests. The relation between estimated erosion rate and magnetic flux density also agreed with that measured by duration erosion tests
The Implementation of Satellite Control System Software Using Object Oriented Design
Anderson, Mark O.; Reid, Mark; Drury, Derek; Hansell, William; Phillips, Tom
1998-01-01
NASA established the Small Explorer (SMEX) program in 1988 to provide frequent opportunities for highly focused and relatively inexpensive space science missions that can be launched into low earth orbit by small expendable vehicles. The development schedule for each SMEX spacecraft was three years from start to launch. The SMEX program has produced five satellites; Solar Anomalous and Magnetospheric Particle Explorer (SAMPEX), Fast Auroral Snapshot Explorer (FAST), Submillimeter Wave Astronomy Satellite (SWAS), Transition Region and Coronal Explorer (TRACE) and Wide-Field Infrared Explorer (WIRE). SAMPEX and FAST are on-orbit, TRACE is scheduled to be launched in April of 1998, WIRE is scheduled to be launched in September of 1998, and SWAS is scheduled to be launched in January of 1999. In each of these missions, the Attitude Control System (ACS) software was written using a modular procedural design. Current program goals require complete spacecraft development within 18 months. This requirement has increased pressure to write reusable flight software. Object-Oriented Design (OOD) offers the constructs for developing an application that only needs modification for mission unique requirements. This paper describes the OOD that was used to develop the SMEX-Lite ACS software. The SMEX-Lite ACS is three-axis controlled, momentum stabilized, and is capable of performing sub-arc-minute pointing. The paper first describes the high level requirements which governed the architecture of the SMEX-Lite ACS software. Next, the context in which the software resides is explained. The paper describes the benefits of encapsulation, inheritance and polymorphism with respect to the implementation of an ACS software system. This paper will discuss the design of several software components that comprise the ACS software. Specifically, Object-Oriented designs are presented for sensor data processing, attitude control, attitude determination and failure detection. The paper addresses
Feasibility of a 5mN Laser-Driven Mini-Thruster, Phase I
National Aeronautics and Space Administration — We have developed a next-generation thruster under a Phase II SBIR which we believe can meet NASA requirements after some modifications and improvements. It is the...
On the Application of Hall Thruster Working with Ambient Atmospheric Gas for Orbital Station-Keeping
Directory of Open Access Journals (Sweden)
D. V. Duhopel'nikov
2016-01-01
Full Text Available The paper considers the application of the Hall thruster using the ambient atmospheric air for orbital station keeping. This is a relevant direction at the up-to-date development stage of propulsion systems. Many teams of designers of electric rocket thrusters evaluate the application of different schemes of particle acceleration at the low-earth orbit. Such technical solution allows us to abandon the storage systems of the working agent on the spacecraft board. Thus, lifetime of such a system at the orbit wouldn`t be limited by fuel range. The paper suggests a scheme of the propulsion device with a parabolic confuser that provides a required compression ratio of the ambient air for correct operation. Formulates physical and structural restrictions on ambient air to be used as a working agent of the thruster. Pointes out that the altitudes from 200 to 300 km are the most promising for such propulsion devices. Shows that for operation at lower altitudes are required the higher capacities that are not provided by modern onboard power supply systems. For the orbit heightening the air intakes with significant compression rate are of necessity. The size of such air intakes would exceed nose fairing of exploited space launch systems. To perform further design calculations are shown dependencies that allow us to calculate an effective diameter of the thruster channel and a critical voltage to be desirable for thrust force excess over air resistance. The dependencies to calculate minimal and maximal fluxes of neutral particles of oxygen and nitrogen, that are necessary for normal thruster operation, are also shown. Calculation results of the propulsion system parameters for the spacecrafts with cross-sectional area within 1 - 3 m2 and inlet diameter of air intake within 1 - 3 m are demonstrated. The research results have practical significance in design of advanced propulsion devices for lowaltitude spacecrafts. The work has been supported by the RFFR
Neumann, Patrick R. C.; Bilek, Marcela; McKenzie, David R.
2016-08-01
The cathodic arc is a high current, low voltage discharge that operates in vacuum and provides a stream of highly ionised plasma from a solid conducting cathode. The high ion velocities, together with the high ionisation fraction and the quasineutrality of the exhaust stream, make the cathodic arc an attractive plasma source for spacecraft propulsion applications. The specific impulse of the cathodic arc thruster is substantially increased when the emission of neutral species is reduced. Here, we demonstrate a reduction of neutral emission by exploiting sublimation in cathode spots and enhanced ionisation of the plasma in short, high-current pulses. This, combined with the enhanced directionality due to the efficient erosion profiles created by centre-triggering, substantially increases the specific impulse. We present experimentally measured specific impulses and jet power efficiencies for titanium and magnesium fuels. Our Mg fuelled source provides the highest reported specific impulse for a gridless ion thruster and is competitive with all flight rated ion thrusters. We present a model based on cathode sublimation and melting at the cathodic arc spot explaining the outstanding performance of the Mg fuelled source. A further significant advantage of an Mg-fuelled thruster is the abundance of Mg in asteroidal material and in space junk, providing an opportunity for utilising these resources in space.
Romano, F.; Massuti-Ballester, B.; Binder, T.; Herdrich, G.; Fasoulas, S.; Schönherr, T.
2018-06-01
Challenging space mission scenarios include those in low altitude orbits, where the atmosphere creates significant drag to the S/C and forces their orbit to an early decay. For drag compensation, propulsion systems are needed, requiring propellant to be carried on-board. An atmosphere-breathing electric propulsion system (ABEP) ingests the residual atmosphere particles through an intake and uses them as propellant for an electric thruster. Theoretically applicable to any planet with atmosphere, the system might allow to orbit for unlimited time without carrying propellant. A new range of altitudes for continuous operation would become accessible, enabling new scientific missions while reducing costs. Preliminary studies have shown that the collectible propellant flow for an ion thruster (in LEO) might not be enough, and that electrode erosion due to aggressive gases, such as atomic oxygen, will limit the thruster lifetime. In this paper an inductive plasma thruster (IPT) is considered for the ABEP system. The starting point is a small scale inductively heated plasma generator IPG6-S. These devices are electrodeless and have already shown high electric-to-thermal coupling efficiencies using O2 and CO2 . The system analysis is integrated with IPG6-S tests to assess mean mass-specific energies of the plasma plume and estimate exhaust velocities.
Kamhawi, Hani; Huang, Wensheng; Haag, Thomas; Yim, John; Chang, Li; Clayman, Lauren; Herman, Daniel; Shastry, Rohit; Thomas, Robert; Verhey, Timothy;
2014-01-01
NASA is developing mission concepts for a solar electric propulsion technology demonstration mission. A number of mission concepts are being evaluated including ambitious missions to near Earth objects. The demonstration of a high-power solar electric propulsion capability is one of the objectives of the candidate missions under consideration. In support of NASA's exploration goals, a number of projects are developing extensible technologies to support NASA's near and long term mission needs. Specifically, the Space Technology Mission Directorate Solar Electric Propulsion Technology Demonstration Mission project is funding the development of a 12.5-kilowatt magnetically shielded Hall thruster system to support future NASA missions. This paper presents the design attributes of the thruster that was collaboratively developed by the NASA Glenn Research Center and the Jet Propulsion Laboratory. The paper provides an overview of the magnetic, plasma, thermal, and structural modeling activities that were carried out in support of the thruster design. The paper also summarizes the results of the functional tests that have been carried out to date. The planned thruster performance, plasma diagnostics (internal and in the plume), thermal, wear, and mechanical tests are outlined.
A New Method for Analyzing Near-Field Faraday Probe Data in Hall Thrusters
Huang, Wensheng; Shastry, Rohit; Herman, Daniel A.; Soulas, George C.; Kamhawi, Hani
2013-01-01
This paper presents a new method for analyzing near-field Faraday probe data obtained from Hall thrusters. Traditional methods spawned from far-field Faraday probe analysis rely on assumptions that are not applicable to near-field Faraday probe data. In particular, arbitrary choices for the point of origin and limits of integration have made interpretation of the results difficult. The new method, called iterative pathfinding, uses the evolution of the near-field plume with distance to provide feedback for determining the location of the point of origin. Although still susceptible to the choice of integration limits, this method presents a systematic approach to determining the origin point for calculating the divergence angle. The iterative pathfinding method is applied to near-field Faraday probe data taken in a previous study from the NASA-300M and NASA-457Mv2 Hall thrusters. Since these two thrusters use centrally mounted cathodes the current density associated with the cathode plume is removed before applying iterative pathfinding. A procedure is presented for removing the cathode plume. The results of the analysis are compared to far-field probe analysis results. This paper ends with checks on the validity of the new method and discussions on the implications of the results.
Engineering Risk Assessment of Space Thruster Challenge Problem
Mathias, Donovan L.; Mattenberger, Christopher J.; Go, Susie
2014-01-01
The Engineering Risk Assessment (ERA) team at NASA Ames Research Center utilizes dynamic models with linked physics-of-failure analyses to produce quantitative risk assessments of space exploration missions. This paper applies the ERA approach to the baseline and extended versions of the PSAM Space Thruster Challenge Problem, which investigates mission risk for a deep space ion propulsion system with time-varying thruster requirements and operations schedules. The dynamic mission is modeled using a combination of discrete and continuous-time reliability elements within the commercially available GoldSim software. Loss-of-mission (LOM) probability results are generated via Monte Carlo sampling performed by the integrated model. Model convergence studies are presented to illustrate the sensitivity of integrated LOM results to the number of Monte Carlo trials. A deterministic risk model was also built for the three baseline and extended missions using the Ames Reliability Tool (ART), and results are compared to the simulation results to evaluate the relative importance of mission dynamics. The ART model did a reasonable job of matching the simulation models for the baseline case, while a hybrid approach using offline dynamic models was required for the extended missions. This study highlighted that state-of-the-art techniques can adequately adapt to a range of dynamic problems.
Ultra-Compact Center-Mounted Hollow Cathodes for Hall Effect Thrusters, Phase I
National Aeronautics and Space Administration — The proposed innovation is a long lifetime, compact hollow cathode that can be mounted along the axis of a 600 W-class Hall effect thruster. Testing at kilowatt...
Technology for Transient Simulation of Vibration during Combustion Process in Rocket Thruster
Zubanov, V. M.; Stepanov, D. V.; Shabliy, L. S.
2018-01-01
The article describes the technology for simulation of transient combustion processes in the rocket thruster for determination of vibration frequency occurs during combustion. The engine operates on gaseous propellant: oxygen and hydrogen. Combustion simulation was performed using the ANSYS CFX software. Three reaction mechanisms for the stationary mode were considered and described in detail. The way for obtaining quick CFD-results with intermediate combustion components using an EDM model was found. The way to generate the Flamelet library with CFX-RIF was described. A technique for modeling transient combustion processes in the rocket thruster was proposed based on the Flamelet library. A cyclic irregularity of the temperature field like vortex core precession was detected in the chamber. Frequency of flame precession was obtained with the proposed simulation technique.
International Nuclear Information System (INIS)
Ren Junxue; Xie Kan; Qiu Qian; Tang Haibin; Li Juan; Tian Huabing
2013-01-01
Based on the three-dimensional particle-in-cell (PIC) method and Compute Unified Device Architecture (CUDA), a parallel particle simulation code combined with a graphic processor unit (GPU) has been developed for the simulation of charge-exchange (CEX) xenon ions in the plume of an ion thruster. Using the proposed technique, the potential and CEX plasma distribution are calculated for the ion thruster plume surrounding the DS1 spacecraft at different thrust levels. The simulation results are in good agreement with measured CEX ion parameters reported in literature, and the GPU's results are equal to a CPU's. Compared with a single CPU Intel Core 2 E6300, 16-processor GPU NVIDIA GeForce 9400 GT indicates a speedup factor of 3.6 when the total macro particle number is 1.1×10 6 . The simulation results also reveal how the back flow CEX plasma affects the spacecraft floating potential, which indicates that the plume of the ion thruster is indeed able to alleviate the extreme negative floating potentials of spacecraft in geosynchronous orbit
Orbital Dynamics of a Simple Solar Photon Thruster
Guerman, Anna D.; Smirnov, Georgi V.; Pereira, Maria Cecilia
2009-01-01
We study orbital dynamics of a compound solar sail, namely, a Simple Solar Photon Thruster and compare its behavior to that of a common version of sailcraft. To perform this analysis, development of a mathematical model for force created by light reflection on all sailcraft elements is essential. We deduce the equations of sailcraft's motion and compare performance of two schemes of solar propulsion for two test time-optimal control problems of trajectory transfer.
Effects of the Phoenix Lander descent thruster plume on the Martian surface
Plemmons, D. H.; Mehta, M.; Clark, B. C.; Kounaves, S. P.; Peach, L. L.; Renno, N. O.; Tamppari, L.; Young, S. M. M.
2008-08-01
The exhaust plume of Phoenix's hydrazine monopropellant pulsed descent thrusters will impact the surface of Mars during its descent and landing phase in the northern polar region. Experimental and computational studies have been performed to characterize the chemical compounds in the thruster exhausts. No undecomposed hydrazine is observed above the instrument detection limit of 0.2%. Forty-five percent ammonia is measured in the exhaust at steady state. Water vapor is observed at a level of 0.25%, consistent with fuel purity analysis results. Moreover, the dynamic interactions of the thruster plumes with the ground have been studied. Large pressure overshoots are produced at the ground during the ramp-up and ramp-down phases of the duty cycle of Phoenix's pulsed engines. These pressure overshoots are superimposed on the 10 Hz quasi-steady ground pressure perturbations with amplitude of about 5 kPa (at touchdown altitude) and have a maximum amplitude of about 20-40 kPa. A theoretical explanation for the physics that causes these pressure perturbations is briefly described in this article. The potential for soil erosion and uplifting at the landing site is also discussed. The objectives of the research described in this article are to provide empirical and theoretical data for the Phoenix Science Team to mitigate any potential problem. The data will also be used to ensure proper interpretation of the results from on-board scientific instrumentation when Martian soil samples are analyzed.
Control of the electric-field profile in the Hall thruster
International Nuclear Information System (INIS)
Fruchtman, A.; Fisch, N.J.; Raitses, Y.
2001-01-01
Control of the electric-field profile in the Hall thruster through the positioning of an additional electrode along the channel is shown theoretically to enhance the efficiency. The reduction of the potential drop near the anode by use of the additional electrode increases the plasma density there, through the increase of the electron and ion transit times, causing the ionization in the vicinity of the anode to increase. The resulting separation of the ionization and acceleration regions increases the propellant and energy utilizations. An abrupt sonic transition is forced to occur at the axial location of the additional electrode, accompanied by the generation of a large (theoretically infinite) electric field. This ability to generate a large electric field at a specific location along the channel, in addition to the ability to specify the electric potential there, allows us further control of the electric-field profile in the thruster. In particular, when the electron temperature is high, a large abrupt voltage drop is induced at the vicinity of the additional electrode, a voltage drop that can comprise a significant part of the applied voltage
Directory of Open Access Journals (Sweden)
Kyun Ho Lee
Full Text Available A space propulsion system is important for the normal mission operations of a spacecraft by adjusting its attitude and maneuver. Generally, a mono- and a bipropellant thruster have been mainly used for low thrust liquid rocket engines. But as the plume gas expelled from these small thrusters diffuses freely in a vacuum space along all directions, unwanted effects due to the plume collision onto the spacecraft surfaces can dramatically cause a deterioration of the function and performance of a spacecraft. Thus, aim of the present study is to investigate and compare the major differences of the plume gas impingement effects quantitatively between the small mono- and bipropellant thrusters using the computational fluid dynamics (CFD. For an efficiency of the numerical calculations, the whole calculation domain is divided into two different flow regimes depending on the flow characteristics, and then Navier-Stokes equations and parallelized Direct Simulation Monte Carlo (DSMC method are adopted for each flow regime. From the present analysis, thermal and mass influences of the plume gas impingements on the spacecraft were analyzed for the mono- and the bipropellant thrusters. As a result, it is concluded that a careful understanding on the plume impingement effects depending on the chemical characteristics of different propellants are necessary for the efficient design of the spacecraft.
Human Outer Solar System Exploration via Q-Thruster Technology
Joosten, B. Kent; White, Harold G.
2014-01-01
Propulsion technology development efforts at the NASA Johnson Space Center continue to advance the understanding of the quantum vacuum plasma thruster (QThruster), a form of electric propulsion. Through the use of electric and magnetic fields, a Q-thruster pushes quantum particles (electrons/positrons) in one direction, while the Qthruster recoils to conserve momentum. This principle is similar to how a submarine uses its propeller to push water in one direction, while the submarine recoils to conserve momentum. Based on laboratory results, it appears that continuous specific thrust levels of 0.4 - 4.0 N/kWe are achievable with essentially no onboard propellant consumption. To evaluate the potential of this technology, a mission analysis tool was developed utilizing the Generalized Reduced Gradient non-linear parameter optimization engine contained in the Microsoft Excel® platform. This tool allowed very rapid assessments of "Q-Ship" minimum time transfers from earth to the outer planets and back utilizing parametric variations in thrust acceleration while enforcing constraints on planetary phase angles and minimum heliocentric distances. A conservative Q-Thruster specific thrust assumption (0.4 N/kWe) combined with "moderate" levels of space nuclear power (1 - 2 MWe) and vehicle specific mass (45 - 55 kg/kWe) results in continuous milli-g thrust acceleration, opening up realms of human spaceflight performance completely unattainable by any current systems or near-term proposed technologies. Minimum flight times to Mars are predicted to be as low as 75 days, but perhaps more importantly new "retro-phase" and "gravity-augmented" trajectory shaping techniques were revealed which overcome adverse planetary phasing and allow virtually unrestricted departure and return opportunities. Even more impressively, the Jovian and Saturnian systems would be opened up to human exploration with round-trip times of 21 and 32 months respectively including 6 to 12 months of
Design, fabrication and testing of porous tungsten vaporizers for mercury ion thrusters
Zavesky, R.; Kroeger, E.; Kami, S.
1983-01-01
The dispersions in the characteristics, performance and reliability of vaporizers for early model 30-cm thrusters were investigated. The purpose of the paper is to explore the findings and to discuss the approaches that were taken to reduce the observed dispersion and present the results of a program which validated those approaches. The information that is presented includes porous tungsten materials specifications, a discussion of assembly procedures, and a description of a test program which screens both material and fabrication processes. There are five appendices providing additional detail in the areas of vaporizer contamination, nitrogen flow testing, bubble testing, porosimeter testing, and mercury purity. Four neutralizers, seven cathodes and five main vaporizers were successfully fabricated, tested, and operated on thrusters. Performance data from those devices is presented and indicates extremely repeatable results from using the design and fabrication procedures.
Orbital Dynamics of a Simple Solar Photon Thruster
Directory of Open Access Journals (Sweden)
Anna D. Guerman
2009-01-01
Full Text Available We study orbital dynamics of a compound solar sail, namely, a Simple Solar Photon Thruster and compare its behavior to that of a common version of sailcraft. To perform this analysis, development of a mathematical model for force created by light reflection on all sailcraft elements is essential. We deduce the equations of sailcraft's motion and compare performance of two schemes of solar propulsion for two test time-optimal control problems of trajectory transfer.
Directory of Open Access Journals (Sweden)
Hui Liu
2018-04-01
Full Text Available Due to a special magnetic field structure, the multi-cusped field thruster shows advantages of low wall erosion, low noise and high thrust density over a wide range of thrust. In this paper, expanding discharge channels are employed to make up for deficiencies on the range of thrust and plume divergence, which often emerges in conventional straight cylindrical channels. Three thruster geometries are fabricated with different expanding-angle channels, and a group of experiments are carried out to find out their influence on the performance and discharge characteristics of the thruster. A retarding potential analyzer and a Faraday probe are employed to analyze the structures of the plume in these three models. The results show that when the thrusters operate at low mass flow rate, the gradually-expanding channels exhibit lower propellant utilization and lower overall performance by amounts not exceeding 44.8% in ionization rate and 19.5% in anode efficiency, respectively. But the weakening of magnetic field intensity near the exit of expanding channels leads to an extended thrust throttling ability, a smaller plume divergence angle, and a relatively larger stable operating space without mode converting and the consequent performance degradation.
International Nuclear Information System (INIS)
Sydorenko, D.; Smolyakov, A.; Kaganovich, I.; Raitses, Y.
2008-01-01
Particle-in-cell simulation of Hall thruster plasmas reveals a plasma-sheath instability manifesting itself as a rearrangement of the plasma sheath near the thruster channel walls accompanied by a sudden change of many discharge parameters. The instability develops when the sheath current as a function of the sheath voltage is in the negative conductivity regime. The major part of the sheath current is produced by beams of secondary electrons counter-streaming between the walls. The negative conductivity is the result of nonlinear dependence of beam-induced secondary electron emission on the plasma potential. The intensity of such emission is defined by the beam energy. The energy of the beam in crossed axial electric and radial magnetic fields is a quasi-periodical function of the phase of cyclotron rotation, which depends on the radial profile of the potential and the thruster channel width. There is a discrete set of stability intervals determined by the final phase of the cyclotron rotation of secondary electrons. As a result, a small variation of the thruster channel width may result in abrupt changes of plasma parameters if the plasma state jumps from one stability interval to another
Zhang, Luchu; Gong, Huiying; Sun, Qinwei; Zhao, Ruqian; Jia, Yimin
2018-01-17
Spermidine is an acetyltransferase inhibitor and a specific inducer of autophagy. Recently, spermidine is identified as a potential therapeutic agent for age-related muscle atrophy and inherited myopathies. However, the effect of spermidine on nonpathological skeletal muscle remains unclear. In this study, long-term spermidine administration in mice lowered the mean cross-sectional area of the gastrocnemius muscle and reduced the expression of myosin heavy chain isoforms in the muscle, which was associated with ubiquitination. Moreover, spermidine supplementation induced autophagy in satellite cells and enhanced satellite cell proliferation. ChIP assay revealed that spermidine repressed H3K56ac in the promoter of ACVR2B and lowered the binding affinity of Smad3 to the promoters of Myf5 and MyoD. Altogether, our results indicate that long-term administration of spermidine can activate satellite cells, as well as enhance autophagy, eventually resulting in muscle atrophy. In addition, H3K56ac and Smad3 emerged as key determinants of satellite cell activation.
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Internal plasma potential measurements of a Hall thruster using xenon and krypton propellant
International Nuclear Information System (INIS)
Linnell, Jesse A.; Gallimore, Alec D.
2006-01-01
For krypton to become a realistic option for Hall thruster operation, it is necessary to understand the performance gap between xenon and krypton and what can be done to reduce it. A floating emissive probe is used with the Plasmadynamics and Electric Propulsion Laboratory's High-speed Axial Reciprocating Probe system to map the internal plasma potential structure of the NASA-173Mv1 Hall thruster [R. R. Hofer, R. S. Jankovsky, and A. D. Gallimore, J. Propulsion Power 22, 721 (2006); and ibid.22, 732 (2006)] using xenon and krypton propellant. Measurements are taken for both propellants at discharge voltages of 500 and 600 V. Electron temperatures and electric fields are also reported. The acceleration zone and equipotential lines are found to be strongly linked to the magnetic-field lines. The electrostatic plasma lens of the NASA-173Mv1 Hall thruster strongly focuses the xenon ions toward the center of the discharge channel, whereas the krypton ions are defocused. Krypton is also found to have a longer acceleration zone than the xenon cases. These results explain the large beam divergence observed with krypton operation. Krypton and xenon have similar maximum electron temperatures and similar lengths of the high electron temperature zone, although the high electron temperature zone is located farther downstream in the krypton case
The Implementation of Satellite Attitude Control System Software Using Object Oriented Design
Reid, W. Mark; Hansell, William; Phillips, Tom; Anderson, Mark O.; Drury, Derek
1998-01-01
NASA established the Small Explorer (SNMX) program in 1988 to provide frequent opportunities for highly focused and relatively inexpensive space science missions. The SMEX program has produced five satellites, three of which have been successfully launched. The remaining two spacecraft are scheduled for launch within the coming year. NASA has recently developed a prototype for the next generation Small Explorer spacecraft (SMEX-Lite). This paper describes the object-oriented design (OOD) of the SMEX-Lite Attitude Control System (ACS) software. The SMEX-Lite ACS is three-axis controlled and is capable of performing sub-arc-minute pointing. This paper first describes high level requirements governing the SMEX-Lite ACS software architecture. Next, the context in which the software resides is explained. The paper describes the principles of encapsulation, inheritance, and polymorphism with respect to the implementation of an ACS software system. This paper will also discuss the design of several ACS software components. Specifically, object-oriented designs are presented for sensor data processing, attitude determination, attitude control, and failure detection. Finally, this paper will address the establishment of the ACS Foundation Class (AFC) Library. The AFC is a large software repository, requiring a minimal amount of code modifications to produce ACS software for future projects.
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
An axially propagating two-stream instability in the Hall thruster plasma
Czech Academy of Sciences Publication Activity Database
Tsikata, S.; Cavalier, Jordan; Héron, A.; Honore, C.; Lemoine, N.; Gresillon, D.; Coulette, D.
2014-01-01
Roč. 21, č. 7 (2014), 072116-072116 ISSN 1070-664X Institutional support: RVO:61389021 Keywords : Collective Thomson scattering * Hall thruster * kinetic theory * electrostatic modes Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.142, year: 2014 http://dx.doi.org/10.1063/1.4890025
Hall Thruster Thermal Modeling and Test Data Correlation
Myers, James
2016-01-01
HERMeS - Hall Effect Rocket with Magnetic Shielding. Developed through a joint effort by NASA/GRC and the Jet Propulsion Laboratory (JPL). Design goals: High power (12.5 kW) high Isp (3000 sec), high efficiency (> 60%), high throughput (10,000 kg), reduced plasma erosion and increased life (5 yrs) to support Asteroid Redirect Robotic Mission (ARRM). Further details see "Performance, Facility Pressure Effects and Stability Characterization Tests of NASAs HERMeS Thruster" by H. Kamhawi and team. Hall Thrusters (HT) inherently operate at elevated temperatures approx. 600 C (or more). Due to electric magnetic (E x B) fields used to ionize and accelerate propellant gas particles (i.e., plasma). Cooling is largely limited to radiation in vacuum environment.Thus the hardware components must withstand large start-up delta-T's. HT's are constructed of multiple materials; assorted metals, non-metals and ceramics for their required electrical and magnetic properties. To mitigate thermal stresses HT design must accommodate the differential thermal growth from a wide range of material Coef. of Thermal Expansion (CTEs). Prohibiting the use of some bolted/torqued interfaces.Commonly use spring loaded interfaces, particularly at the metal-to-ceramic interfaces to allow for slippage.However most component interfaces must also effectively conduct heat to the external surfaces for dissipation by radiation.Thus contact pressure and area are important.
Jorns, Benjamin A.; Goebel, Dan M.; Hofer, Richard R.
2015-01-01
An experimental investigation is presented to quantify the effect of high-speed probing on the plasma parameters inside the discharge chamber of a 6-kW Hall thruster. Understanding the nature of these perturbations is of significant interest given the importance of accurate plasma measurements for characterizing thruster operation. An array of diagnostics including a high-speed camera and embedded wall probes is employed to examine in real time the changes in electron temperature and plasma potential induced by inserting a high-speed reciprocating Langmuir probe into the discharge chamber. It is found that the perturbations onset when the scanning probe is downstream of the electron temperature peak, and that along channel centerline, the perturbations are best characterized as a downstream shift of plasma parameters by 15-20% the length of the discharge chamber. A parametric study is performed to investigate techniques to mitigate the observed probe perturbations including varying probe speed, probe location, and operating conditions. It is found that the perturbations largely disappear when the thruster is operated at low power and low discharge voltage. The results of this mitigation study are discussed in the context of recommended methods for generating unperturbed measurements of the discharge chamber plasma.
The direct wave-drive thruster
Feldman, Matthew Solomon
A propulsion concept relying on the direct, steady-state acceleration of a plasma by an inductive wave-launching antenna is presented. By operating inductively in steady state, a Direct Wave-Drive Thruster avoids drawbacks associated with electrode erosion and pulsed acceleration. The generalized relations for the scaling of thrust and efficiency with the antenna current are derived analytically; thrust is shown to scale with current squared, and efficiency is shown to increase with increasing current or power. Two specific configurations are modeled to determine nondimensional parameters governing the antenna-plasma coupling: an annular antenna pushing against a finite-conductivity plasma, and a linear antenna targeting the magnetosonic wave. Calculations from the model show that total thrust improves for increasing excitation frequencies, wavenumbers, plasma densities, and device sizes. To demonstrate the magnetosonic wave as an ideal candidate to drive a DWDT, it is shown to be capable of carrying substantial momentum and able to drive a variable specific impulse. The magnetosonic wave-driven mass flow is compared to mass transport due to thermal effects and cross-field diffusion in order to derive critical power requirements that ensure the thruster channel is dominated by wave dynamics. A proof-of-concept experiment is constructed that consists of a separate plasma source, a confining magnetic field, and a wave-launching antenna. The scaling of the increase of exhaust velocity is analytically modeled and is dependent on a nondimensional characteristic wavenumber that is proportional to the excitation frequency and plasma density and inversely proportional to the magnetic field strength. Experimental validation of the derived scaling behavior is carried out using a Mach probe to measure the flow velocity in the plume. Increases in exhaust velocity are measured as the antenna current increases for varying excitation frequencies and applied magnetic field
Propulsion System Development for the Iodine Satellite (iSAT) Demonstration Mission
Polzin, Kurt A.; Peeples, Stephen R.; Seixal, Joao F.; Mauro, Stephanie L.; Lewis, Brandon L.; Jerman, Gregory A.; Calvert, Derek H.; Dankanich, John; Kamhawi, Hani; Hickman, Tyler A.;
2015-01-01
The development and testing of a 200-W iodine-fed Hall thruster propulsion system that will be flown on a 12-U CubeSat is described. The switch in propellant from more traditional xenon gas to solid iodine yields the advantage of high density, low pressure propellant storage but introduces new requirements that must be addressed in the design and operation of the propulsion system. The thruster materials have been modified from a previously-flown xenon Hall thruster to make it compatible with iodine vapor. The cathode incorporated into this design additionally requires little or no heating to initiate the discharge, reducing the power needed to start the thruster. The feed system produces iodine vapor in the propellant reservoir through sublimation and then controls the flow to the anode and cathode of the thruster using a pair of proportional flow control valves. The propellant feeding process is controlled by the power processing unit, with feedback control on the anode flow rate provided through a measure of the thruster discharge current. Thermal modeling indicates that it may be difficult to sufficiently heat the iodine if it loses contact with the propellant reservoir walls, serving to motivate future testing of that scenario to verify the modeling result and develop potential mitigation strategies. Preliminary, short-duration materials testing has thus-far indicated that several materials may be acceptable for prolonged contact with iodine vapor, motivating longer-duration testing. A propellant loading procedure is presented that aims to minimize the contaminants in the feed system and propellant reservoir. Finally, an 80-hour duration test being performed to gain experience operating the thruster over long durations and multiple restarts is discussed.
Mikellides, Ioannis G.; Katz, Ira; Hofer, Richard R.; Goebel, Dan M.
2012-01-01
A proof-of-principle effort to demonstrate a technique by which erosion of the acceleration channel in Hall thrusters of the magnetic-layer type can be eliminated has been completed. The first principles of the technique, now known as "magnetic shielding," were derived based on the findings of numerical simulations in 2-D axisymmetric geometry. The simulations, in turn, guided the modification of an existing 6-kW laboratory Hall thruster. This magnetically shielded (MS) thruster was then built and tested. Because neither theory nor experiment alone can validate fully the first principles of the technique, the objective of the 2-yr effort was twofold: (1) to demonstrate in the laboratory that the erosion rates can be reduced by >order of magnitude, and (2) to demonstrate that the near-wall plasma properties can be altered according to the theoretical predictions. This paper concludes the demonstration of magnetic shielding by reporting on a wide range of comparisons between results from numerical simulations and laboratory diagnostics. Collectively, we find that the comparisons validate the theory. Near the walls of the MS thruster, theory and experiment agree: (1) the plasma potential has been sustained at values near the discharge voltage, and (2) the electron temperature has been lowered by at least 2.5-3 times compared to the unshielded (US) thruster. Also, based on carbon deposition measurements, the erosion rates at the inner and outer walls of the MS thruster are found to be lower by at least 2300 and 1875 times, respectively. Erosion was so low along these walls that the rates were below the resolution of the profilometer. Using a sputtering yield model with an energy threshold of 25 V, the simulations predict a reduction of 600 at the MS inner wall. At the outer wall ion energies are computed to be below 25 V, for which case we set the erosion to zero in the simulations. When a 50-V threshold is used the computed ion energies are below the threshold at both
A structural and thermal packaging approach for power processing units for 30-cm ion thrusters
Maloy, J. E.; Sharp, G. R.
1975-01-01
Solar Electric Propulsion (SEP) is currently being studied for possible use in a number of near earth and planetary missions. The thruster subsystem for these missions would consist of 30 centimeter ion thrusters with Power Processor Units (PPU) clustered in assemblies of from two to ten units. A preliminary design study of the electronic packaging of the PPU has been completed at Lewis Research Center of NASA. This study evaluates designs meeting the competing requirements of low system weight and overall mission flexibility. These requirements are evaluated regarding structural and thermal design, electrical efficiency, and integration of the electrical circuits into a functional PPU layout.
A Plasmoid Thruster for Space Propulsion
Koelfgen, Syri J.; Hawk, Clark W.; Eskridge, Richard; Smith, James W.; Martin, Adam K.
2003-01-01
There are a number of possible advantages to using accelerated plasmoids for in-space propulsion. A plasmoid is a compact plasma structure with an integral magnetic field. They have been studied extensively in controlled fusion research and are classified according to the relative strength of the poloidal and toroidal magnetic field (B(sub p), and B(sub t), respectively). An object with B(sub p), / B(sub t) much greater than 1 is classified as a Field Reversed Configuration (FRC); if B(sub p) approximately equal to B(sub t), it is called a Spheromak. The plasmoid thruster operates by producing FRC-like plasmoids and subsequently ejecting them from the device at a high velocity. The plasmoid is formed inside of a single-turn conical theta-pinch coil. As this process is inductive, there are no electrodes. Similar experiments have yielded plasmoid velocities of at least 50 km/s, and calculations indicate that velocities in excess of 100 km/s should be possible. This concept should be capable of producing Isp's in the range of 5,000 - 15,000 s with thrust densities on the order of 10(exp 5) N per square meters. The current experiment is designed to produce jet powers in the range of 5 - 10 kW, although the concept should be scalable to several MW's. The plasmoid mass and velocity will be measured with a variety of diagnostics, including internal and external B-dot probes, flux loops, Langmuir probes, high-speed cameras and a laser interferometer. Also of key importance will be measurements of the efficiency and mass utilization. Simulations of the plasmoid thruster using MOQUI, a time-dependent MHD code, will be carried out concurrently with experimental testing.
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
Gallimore, Alec D.
2000-01-01
While the closed-drift Hall thruster (CDT) offers significant improvement in performance over conventional chemical rockets and other advanced propulsion systems such as the arcjet, its potential impact on spacecraft communication signals must be carefully assessed before widespread use of this device can take place. To this end, many of the potentially unique issues that are associated with these thrusters center on its plume plasma characteristics and the its interaction with electromagnetic waves. Although a great deal of experiments have been made in characterizing the electromagnetic interference (EMI) potential of these thrusters, the interpretation of the resulting data is difficult because most of these measurements have been made in vacuum chambers with metal walls which reflect radio waves emanating from the thruster. This project developed a means of assessing the impact of metal vacuum chambers of arbitrary size or shape on EMI experiments, thereby allowing for test results to be interpreted properly. Chamber calibration techniques were developed and initially tested at RIAME using their vacuum chamber. Calibration experiments were to have been made at Tank 5 of NASA GRC and the 6 m by 9 m vacuum chamber at the University of Michigan to test the new procedure, however the subcontract to RIAME was cancelled by NASA memorandum on Feb. 26. 1999.
Design and Stability of an On-Orbit Attitude Control System Using Reaction Control Thrusters
Hall, Robert A.; Hough, Steven; Orphee, Carolina; Clements, Keith
2016-01-01
Basic principles for the design and stability of a spacecraft on-orbit attitude control system employing on-off Reaction Control System (RCS) thrusters are presented. Both vehicle dynamics and the control system actuators are inherently nonlinear, hence traditional linear control system design approaches are not directly applicable. This paper has two main aspects: It summarizes key RCS design principles from earlier NASA vehicles, notably the Space Shuttle and Space Station programs, and introduces advances in the linear modelling and analyses of a phase plane control system derived in the initial development of the NASA's next upper stage vehicle, the Exploration Upper Stage (EUS). Topics include thruster hardware specifications, phase plane design and stability, jet selection approaches, filter design metrics, and RCS rotational maneuver logic.
Charles, Christine; Boswell, Roderick; Bish, Andrew; Khayms, Vadim; Scholz, Edwin
2016-05-01
Gas flow heating using radio frequency plasmas offers the possibility of depositing power in the centre of the flow rather than on the outside, as is the case with electro-thermal systems where thermal wall losses lower efficiency. Improved systems for space propulsion are one possible application and we have tested a prototype micro-thruster on a thrust balance in vacuum. For these initial tests, a fixed component radio frequency matching network weighing 90 grams was closely attached to the thruster in vacuum with the frequency agile radio frequency generator power being delivered via a 50 Ohm cable. Without accounting for system losses (estimated at around 50%), for a few 10s of Watts from the radio frequency generator the specific impulse was tripled to ˜48 seconds and the thrust tripled from 0.8 to 2.4 milli-Newtons.
Directory of Open Access Journals (Sweden)
Christine eCharles
2016-05-01
Full Text Available Gas flow heating using radio frequency plasmas offers the possibility of depositing power in the centre of the flow rather than on the outside, as is the case with electro-thermal systems where thermal wall losses lower efficiency. Improved systems for space propulsion are one possible application and we have tested a prototype micro-thruster on a thrust balance in vacuum. For these initial tests, a fixed component radio frequency matching network weighing 90 grams was closely attached to the thruster in vacuum with the frequency agile radio frequency generator power being delivered via a 50 Ohm cable. Without accounting for system losses (estimated at around 50~$%$, for a few 10s of Watts from the radio frequency generator the specific impulse was tripled to $sim$48 seconds and the thrust tripled from 0.8 to 2.4 milli-Newtons.
Concept Study of Radio Frequency (RF Plasma Thruster for Space Propulsion
Directory of Open Access Journals (Sweden)
Anna-Maria Theodora ANDREESCU
2016-12-01
Full Text Available Electric thrusters are capable of accelerating ions to speeds that are impossible to reach using chemical reaction. Recent advances in plasma-based concepts have led to the identification of electromagnetic (RF generation and acceleration systems as able to provide not only continuous thrust, but also highly controllable and wide-range exhaust velocities. For Future Space Propulsion there is a pressing need for low pressure, high mass flow rate and controlled ion energies. This paper explores the potential of using RF heated plasmas for space propulsion in order to mitigate the electric propulsion problems caused by erosion and gain flexibility in plasma manipulation. The main key components of RF thruster architecture are: a feeding system able to provide the required neutral gas flow, plasma source chamber, antenna/electrodes wrapped around the discharge tube and optimized electromagnetic field coils for plasma confinement. A preliminary analysis of system performance (thrust, specific impulse, efficiency is performed along with future plans of Space Propulsion based on this new concept of plasma mechanism.
A direct-measurement technique for estimating discharge-chamber lifetime. [for ion thrusters
Beattie, J. R.; Garvin, H. L.
1982-01-01
The use of short-term measurement techniques for predicting the wearout of ion thrusters resulting from sputter-erosion damage is investigated. The laminar-thin-film technique is found to provide high precision erosion-rate data, although the erosion rates are generally substantially higher than those found during long-term erosion tests, so that the results must be interpreted in a relative sense. A technique for obtaining absolute measurements is developed using a masked-substrate arrangement. This new technique provides a means for estimating the lifetimes of critical discharge-chamber components based on direct measurements of sputter-erosion depths obtained during short-duration (approximately 1 hr) tests. Results obtained using the direct-measurement technique are shown to agree with sputter-erosion depths calculated for the plasma conditions of the test. The direct-measurement approach is found to be applicable to both mercury and argon discharge-plasma environments and will be useful for estimating the lifetimes of inert gas and extended performance mercury ion thrusters currently under development.
Two-Dimensional Modelling of the Hall Thruster Discharge: Final Report
2007-09-10
ion energy flux to wall, qWi, and electron energy flux to wall, qWe for Vd= 300 V, 600 V and 750 V. All variables are evaluated at the outer wall (r... qWe for Vd= 300 V, 600 V and 750 V. All variables are evaluated at the outer wall (r=0.05m). The vertical dashed line represents the thruster exit
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Electron energy distribution function in a low-power Hall thruster discharge and near-field plume
Tichý, M.; Pétin, A.; Kudrna, P.; Horký, M.; Mazouffre, S.
2018-06-01
Electron temperature and plasma density, as well as the electron energy distribution function (EEDF), have been obtained inside and outside the dielectric channel of a 200 W permanent magnet Hall thruster. Measurements were carried out by means of a cylindrical Langmuir probe mounted onto a compact fast moving translation stage. The 3D particle-in cell numerical simulations complement experiments. The model accounts for the crossed electric and magnetic field configuration in a weakly collisional regime where only electrons are magnetized. Since only the electron dynamics is of interest in this study, an artificial mass of ions corresponding to mi = 30 000me was used to ensure ions could be assumed at rest. The simulation domain is located at the thruster exit plane and does not include the cathode. The measured EEDF evidences a high-energy electron population that is superimposed onto the low energy bulk population outside the channel. Inside the channel, the EEDF is close to Maxwellian. Both the experimental and numerical EEDF depart from an equilibrium distribution at the channel exit plane, a region of high magnetic field. We therefore conclude that the fast electron group found in the experiment corresponds to the electrons emitted by the external cathode that reach the thruster discharge without experiencing collision events.
Sharp, G. R.; Gedeon, L.; Oglebay, J. C.; Shaker, F. S.; Siegert, C. E.
1978-01-01
A prototype electric power management and thruster control system for a 30 cm ion thruster is described. The system meets all of the requirements necessary to operate a thruster in a fully automatic mode. Power input to the system can vary over a full two to one dynamic range (200 to 400 V) for the solar array or other power source. The power management and control system is designed to protect the thruster, the flight system and itself from arcs and is fully compatible with standard spacecraft electronics. The system is easily integrated into flight systems which can operate over a thermal environment ranging from 0.3 to 5 AU. The complete power management and control system measures 45.7 cm (18 in.) x 15.2 cm (6 in.) x 114.8 cm (45.2 in.) and weighs 36.2 kg (79.7 lb). At full power the overall efficiency of the system is estimated to be 87.4 percent. Three systems are currently being built and a full schedule of environmental and electrical testing is planned.
Sharp, G. R.; Gedeon, L.; Oglebay, J. C.; Shaker, F. S.; Siegert, C. E.
1978-01-01
A prototype Electric Power Management and Thruster Control System for a 30 cm ion thruster has been built and is ready to support a first mission application. The system meets all of the requirements necessary to operate a thruster in a fully automatic mode. Power input to the system can vary over a full two to one dynamic range (200 to 400 V) for the solar array or other power source. The Power Management and Control system is designed to protect the thruster, the flight system and itself from arcs and is fully compatible with standard spacecraft electronics. The system is designed to be easily integrated into flight systems which can operate over a thermal environment ranging from 0.3 to 5 AU. The complete Power Management and Control system measures 45.7 cm x 15.2 cm x 114.8 cm and weighs 36.2 kg. At full power the overall efficiency of the system is estimated to be 87.4 percent. Three systems are currently being built and a full schedule of environmental and electrical testing is planned.
Diagnostic Setup for Characterization of Near-Anode Processes in Hall Thrusters
International Nuclear Information System (INIS)
Dorf, L.; Raitses, Y.; Fisch, N.J.
2003-01-01
A diagnostic setup for characterization of near-anode processes in Hall-current plasma thrusters consisting of biased and emissive electrostatic probes, high-precision positioning system and low-noise electronic circuitry was developed and tested. Experimental results show that radial probe insertion does not cause perturbations to the discharge and therefore can be used for accurate near-anode measurements
Vacuum arc plasma thrusters with inductive energy storage driver
Krishnan, Mahadevan (Inventor)
2009-01-01
A plasma thruster with a cylindrical inner and cylindrical outer electrode generates plasma particles from the application of energy stored in an inductor to a surface suitable for the formation of a plasma and expansion of plasma particles. The plasma production results in the generation of charged particles suitable for generating a reaction force, and the charged particles are guided by a magnetic field produced by the same inductor used to store the energy used to form the plasma.
Effect of Ambipolar Potential on the Propulsive Performance of the GDM Plasma Thruster, Phase II
National Aeronautics and Space Administration — The Gasdynamic Mirror (GDM) thruster is an electric propulsion device, without electrodes, that will magnetically confine a plasma with such density and temperature...
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
Satellite imagery in safeguards: progress and prospects
International Nuclear Information System (INIS)
Niemeyer, I.; Listner, C.
2013-01-01
The use of satellite imagery has become very important for the verification of the safeguards implementation under the Nuclear Non-Proliferation Treaty (NPT). The main applications of satellite imagery are to verify the correctness and completeness of the member states' declarations, and to provide preparatory information for inspections, complimentary access and other technical visits. If the area of interest is not accessible, remote sensing sensors provide one of the few opportunities of gathering data for nuclear monitoring, as for example in Iraq between 1998 and 2002 or currently in North Korea. Satellite data of all available sensor types contains a considerable amount of safeguard-relevant information. Very high-resolution optical satellite imagery provides the most detailed spatial information on nuclear sites and activities up to 0.41 m resolution, together with up to 8 spectral bands from the visible light and near infrared. Thermal infrared (TIR) images can indicate the operational status of nuclear facilities and help to identify undeclared activities. Hyper-spectral imagery allows a quantitative estimation of geophysical, geochemical and biochemical characteristics of the earth's surface and is therefore useful for assessing, for example, surface cover changes due to drilling, mining and milling activities. Synthetic Aperture Radar (SAR) image data up to 1 m spatial resolution provides an all-weather, day and night monitoring capability. However, the absence (or existence) of nuclear activities can never be confirmed completely based on satellite imagery. (A.C.)
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
Effect of Ambipolar Potential on the Propulsive Performance of the GDM Plasma Thruster, Phase I
National Aeronautics and Space Administration — The gasdynamic mirror (GDM) plasma thruster has the ability to confine high-density plasma for the length of time required to heat it to the temperatures...
High Input Voltage Discharge Supply for High Power Hall Thrusters Using Silicon Carbide Devices
Pinero, Luis R.; Scheidegger, Robert J.; Aulsio, Michael V.; Birchenough, Arthur G.
2014-01-01
A power processing unit for a 15 kW Hall thruster is under development at NASA Glenn Research Center. The unit produces up to 400 VDC with two parallel 7.5 kW discharge modules that operate from a 300 VDC nominal input voltage. Silicon carbide MOSFETs and diodes were used in this design because they were the best choice to handle the high voltage stress while delivering high efficiency and low specific mass. Efficiencies in excess of 97 percent were demonstrated during integration testing with the NASA-300M 20 kW Hall thruster. Electromagnet, cathode keeper, and heater supplies were also developed and will be integrated with the discharge supply into a vacuum-rated brassboard power processing unit with full flight functionality. This design could be evolved into a flight unit for future missions that requires high power electric propulsion.
Liu, Jinwen; Li, Hong; Mao, Wei; Ding, Yongjie; Wei, Liqiu; Li, Jianzhi; Yu, Daren; Wang, Xiaogang
2018-05-01
The energy deposition caused by the absorption of electrons by the anode is an important cause of power loss in a Hall thruster. The resulting anode heating is dangerous, as it can potentially reduce the thruster lifetime. In this study, by considering the ring shape of the anode of an ATON-type Hall thruster, the effects of the magnetic field strength and gradient on the anode ring temperature distribution are studied via experimental measurement. The results show that the temperature distribution is not affected by changes in the magnetic field strength and that the position of the peak temperature is essentially unchanged; however, the overall temperature does not change monotonically with the increase of the magnetic field strength and is positively correlated with the change in the discharge current. Moreover, as the magnetic field gradient increases, the position of the peak temperature gradually moves toward the channel exit and the temperature tends to decrease as a whole, regardless of the discharge current magnitude; in any case, the position of the peak temperature corresponds exactly to the intersection of the magnetic field cusp with the anode ring. Further theoretical analysis shows that the electrons, coming from the ionization region, travel along two characteristic paths to reach the anode under the guidance of the cusped magnetic field configuration. The change of the magnetic field strength or gradient changes the transfer of momentum and energy of the electrons in these two paths, which is the main reason for the changes in the temperature and distribution. This study is instructive for matching the design of the ring-shaped anode and the cusp magnetic field of an ATON-type Hall thruster.
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Ion engine auxiliary propulsion applications and integration study
Zafran, S. (Editor)
1977-01-01
The benefits derived from application of the 8-cm mercury electron bombardment ion thruster were assessed. Two specific spacecraft missions were studied. A thruster was tested to provide additional needed information on its efflux characteristics and interactive effects. A Users Manual was then prepared describing how to integrate the thruster for auxiliary propulsion on geosynchronous satellites. By incorporating ion engines on an advanced communications mission, the weight available for added payload increases by about 82 kg (181 lb) for a 100 kg (2200 lb) satellite which otherwise uses electrothermal hydrazine. Ion engines can be integrated into a high performance propulsion module that is compatible with the multimission modular spacecraft and can be used for both geosynchronous and low earth orbit applications. The low disturbance torques introduced by the ion engines permit accurate spacecraft pointing with the payload in operation during thrusting periods. The feasibility of using the thruster's neutralizer assembly for neutralization of differentially charged spacecraft surfaces at geosynchronous altitude was demonstrated during the testing program.
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Development of Long-Lifetime Pulsed Gas Valves for Pulsed Electric Thrusters
Burkhardt, Wendel M.; Crapuchettes, John M.; Addona, Brad M.; Polzin, Kurt A.
2015-01-01
It is advantageous for gas-fed pulsed electric thrusters to employ pulsed valves so propellant is only flowing to the device during operation. The propellant utilization of the thruster will be maximized when all the gas injected into the thruster is acted upon by the fields produced by the electrical pulse. Gas that is injected too early will diffuse away from the thruster before the electrical pulse can act to accelerate the propellant. Gas that is injected too late will miss being accelerated by the already-completed electrical pulse. As a consequence, the valve must open quickly and close equally quickly, only remaining open for a short duration. In addition, the valve must have only a small amount of volume between the sealing body and the thruster so the front and back ends of the pulse are as coincident as possible with the valve cycling, with very little latent propellant remaining in the feed lines after the valve is closed. For a real mission of interest, a pulsed thruster can be expected to pulse at least 10(exp 10) - 10(exp 11) times, setting the range for the number of times a valve must open and close. The valves described in this paper have been fabricated and tested for operation in an inductive pulsed plasma thruster (IPPT) for in-space propulsion. In general, an IPPT is an electrodeless space propulsion device where a capacitor is charged to an initial voltage and then discharged, producing a high-current pulse through a coil. The field produced by this pulse ionizes propellant, inductively driving current in a plasma located near the face of the coil. Once the plasma is formed, it can be accelerated and expelled at a high exhaust velocity by the electromagnetic Lorentz body force arising from the interaction of the induced plasma current and the magnetic field produced by the current in the coil. The valve characteristics needed for the IPPT application require a fast-acting valve capable of a minimum of 10(exp 10) valve actuation cycles. Since
Development and Testing of High Current Hollow Cathodes for High Power Hall Thrusters
Kamhawi, Hani; Van Noord, Jonathan
2012-01-01
NASA's Office of the Chief Technologist In-Space Propulsion project is sponsoring the testing and development of high power Hall thrusters for implementation in NASA missions. As part of the project, NASA Glenn Research Center is developing and testing new high current hollow cathode assemblies that can meet and exceed the required discharge current and life-time requirements of high power Hall thrusters. This paper presents test results of three high current hollow cathode configurations. Test results indicated that two novel emitter configurations were able to attain lower peak emitter temperatures compared to state-of-the-art emitter configurations. One hollow cathode configuration attained a cathode orifice plate tip temperature of 1132 degC at a discharge current of 100 A. More specifically, test and analysis results indicated that a novel emitter configuration had minimal temperature gradient along its length. Future work will include cathode wear tests, and internal emitter temperature and plasma properties measurements along with detailed physics based modeling.
Pickup ion processes associated with spacecraft thrusters: Implications for solar probe plus
Energy Technology Data Exchange (ETDEWEB)
Clemens, Adam, E-mail: a.j.clemens@qmul.ac.uk; Burgess, David [School of Physics and Astronomy, Queen Mary University of London, London (United Kingdom)
2016-03-15
Chemical thrusters are widely used in spacecraft for attitude control and orbital manoeuvres. They create an exhaust plume of neutral gas which produces ions via photoionization and charge exchange. Measurements of local plasma properties will be affected by perturbations caused by the coupling between the newborn ions and the plasma. A model of neutral expansion has been used in conjunction with a fully three-dimensional hybrid code to study the evolution and ionization over time of the neutral cloud produced by the firing of a mono-propellant hydrazine thruster as well as the interactions of the resulting ion cloud with the ambient solar wind. Results are presented which show that the plasma in the region near to the spacecraft will be perturbed for an extended period of time with the formation of an interaction region around the spacecraft, a moderate amplitude density bow wave bounding the interaction region and evidence of an instability at the forefront of the interaction region which causes clumps of ions to be ejected from the main ion cloud quasi-periodically.
The effect of magnetic mirror on near wall conductivity in Hall thrusters
International Nuclear Information System (INIS)
Yu, D.; Liu, H.; Fu, H.; Cao, Y.
2008-01-01
The effect of magnetic mirror on near wall conductivity is studied in the acceleration region of Hall thrusters. The electron dynamics process in the plasma is described by test particle method, in which electrons are randomly emitted from the centerline towards the inner wall of the channel. It is found that the effective collision coefficient, i.e. the rate of electrons colliding with the wall, changes dramatically with the magnetic mirror effect being considered; and that it decreases further with the increase of magnetic mirror ratio to enhance the electron mobility accordingly. In particular, under anistropic electron velocity distribution conditions, the magnetic mirror effect becomes even more prominent. Furthermore, due to decrease in magnetic mirror ratio from the exhaust plane to the anode in Hall thrusters, the axial gradient of electron mobility with magnetic mirror effect is greater than without it. The magnetic mirror effects on electron mobility are derived analytically and the results are found in agreement with the simulation. (copyright 2008 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Attitude Control Subsystem for the Advanced Communications Technology Satellite
Hewston, Alan W.; Mitchell, Kent A.; Sawicki, Jerzy T.
1996-01-01
This paper provides an overview of the on-orbit operation of the Attitude Control Subsystem (ACS) for the Advanced Communications Technology Satellite (ACTS). The three ACTS control axes are defined, including the means for sensing attitude and determining the pointing errors. The desired pointing requirements for various modes of control as well as the disturbance torques that oppose the control are identified. Finally, the hardware actuators and control loops utilized to reduce the attitude error are described.
Sun, Yushi; Sun, Changhong; Zhu, Harry; Wincheski, Buzz
2006-01-01
Stress corrosion cracking in the relief radius area of a space shuttle primary reaction control thruster is an issue of concern. The current approach for monitoring of potential crack growth is nondestructive inspection (NDI) of remaining thickness (RT) to the acoustic cavities using an eddy current or remote field eddy current probe. EDM manufacturers have difficulty in providing accurate RT calibration standards. Significant error in the RT values of NDI calibration standards could lead to a mistaken judgment of cracking condition of a thruster under inspection. A tool based on eddy current principle has been developed to measure the RT at each acoustic cavity of a calibration standard in order to validate that the standard meets the sample design criteria.
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Test Results of a 200 W Class Hall Thruster
Jacobson, David; Jankovsky, Robert S.
1999-01-01
The performance of a 200 W class Hall thruster was evaluated. Performance measurements were taken at power levels between 90 W and 250 W. At the nominal 200 W design point, the measured thrust was 11.3 mN. and the specific impulse was 1170 s excluding cathode flow in the calculation. A laboratory model 3 mm diameter hollow cathode was used for all testing. The engine was operated on laboratory power supplies in addition to a breadboard power processing unit fabricated from commercially available DC to DC converters.
Magnetically filtered Faraday probe for measuring the ion current density profile of a Hall thruster
International Nuclear Information System (INIS)
Rovey, Joshua L.; Walker, Mitchell L.R.; Gallimore, Alec D.; Peterson, Peter Y.
2006-01-01
The ability of a magnetically filtered Faraday probe (MFFP) to obtain the ion current density profile of a Hall thruster is investigated. The MFFP is designed to eliminate the collection of low-energy, charge-exchange (CEX) ions by using a variable magnetic field as an ion filter. In this study, a MFFP, Faraday probe with a reduced acceptance angle (BFP), and nude Faraday probe are used to measure the ion current density profile of a 5 kW Hall thruster operating over the range of 300-500 V and 5-10 mg/s. The probes are evaluated on a xenon propellant Hall thruster in the University of Michigan Large Vacuum Test Facility at operating pressures within the range of 4.4x10 -4 Pa Xe (3.3x10 -6 Torr Xe) to 1.1x10 -3 Pa Xe (8.4x10 -6 Torr Xe) in order to study the ability of the Faraday probe designs to filter out CEX ions. Detailed examination of the results shows that the nude probe measures a greater ion current density profile than both the MFFP and BFP over the range of angular positions investigated for each operating condition. The differences between the current density profiles obtained by each probe are attributed to the ion filtering systems employed. Analysis of the results shows that the MFFP, operating at a +5 A solenoid current, provides the best agreement with flight-test data and across operating pressures
Effect of the Thruster Configurations on a Laser Ignition Microthruster
Koizumi, Hiroyuki; Hamasaki, Kyoichi; Kondo, Ryo; Okada, Keisuke; Nakano, Masakatsu; Arakawa, Yoshihiro
Research and development of small spacecraft have advanced extensively throughout the world and propulsion devices suitable for the small spacecraft, microthruster, is eagerly anticipated. The authors proposed a microthruster using 1—10-mm-size solid propellant. Small pellets of solid propellant are installed in small combustion chambers and ignited by the irradiation of diode laser beam. This thruster is referred as to a laser ignition microthruster. Solid propellant enables large thrust capability and compact propulsion system. To date theories of a solid-propellant rocket have been well established. However, those theories are for a large-size solid propellant and there are a few theories and experiments for a micro-solid rocket of 1—10mm class. This causes the difficulty of the optimum design of a micro-solid rocket. In this study, we have experimentally investigated the effect of thruster configurations on a laser ignition microthruster. The examined parameters are aperture ratio of the nozzle, length of the combustion chamber, area of the nozzle throat, and divergence angle of the nozzle. Specific impulse dependences on those parameters were evaluated. It was found that large fraction of the uncombusted propellant was the main cause of the degrading performance. Decreasing the orifice diameter in the nozzle with a constant open aperture ratio was an effective method to improve this degradation.
Thermal Analysis of Iodine Satellite (iSAT)
Mauro, Stephanie
2015-01-01
This paper presents the progress of the thermal analysis and design of the Iodine Satellite (iSAT). The purpose of the iSAT spacecraft (SC) is to demonstrate the ability of the iodine Hall Thruster propulsion system throughout a one year mission in an effort to mature the system for use on future satellites. The benefit of this propulsion system is that it uses a propellant, iodine, that is easy to store and provides a high thrust-to-mass ratio. The spacecraft will also act as a bus for an earth observation payload, the Long Wave Infrared (LWIR) Camera. Four phases of the mission, determined to either be critical to achieving requirements or phases of thermal concern, are modeled. The phases are the Right Ascension of the Ascending Node (RAAN) Change, Altitude Reduction, De-Orbit, and Science Phases. Each phase was modeled in a worst case hot environment and the coldest phase, the Science Phase, was also modeled in a worst case cold environment. The thermal environments of the spacecraft are especially important to model because iSAT has a very high power density. The satellite is the size of a 12 unit cubesat, and dissipates slightly more than 75 Watts of power as heat at times. The maximum temperatures for several components are above their maximum operational limit for one or more cases. The analysis done for the first Design and Analysis Cycle (DAC1) showed that many components were above or within 5 degrees Centigrade of their maximum operation limit. The battery is a component of concern because although it is not over its operational temperature limit, efficiency greatly decreases if it operates at the currently predicted temperatures. In the second Design and Analysis Cycle (DAC2), many steps were taken to mitigate the overheating of components, including isolating several high temperature components, removal of components, and rearrangement of systems. These changes have greatly increased the thermal margin available.
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
International Nuclear Information System (INIS)
Peterson, Peter Y.; Gallimore, Alec D.; Haas, James M.
2002-01-01
Magnetic field measurements were made in the discharge channel of the 5 kW-class P5 laboratory-model Hall thruster to investigate what effect the Hall current has on the static, applied magnetic field topography. The P5 was operated at 1.6 and 3.0 kW with a discharge voltage of 300 V. A miniature inductive loop probe (B-Dot probe) was employed to measure the radial magnetic field profile inside the discharge channel of the P5 with and without the plasma discharge. These measurements are accomplished with minimal disturbance to thruster operation with the High-speed Axial Reciprocating Probe system. The results of the B-Dot probe measurements indicate a change in the magnetic field topography from that of the vacuum field measurements. The measured magnetic field profiles are then examined to determine the possible nature and source of the difference between the vacuum and plasma magnetic field profiles
Confidence Testing of Shell 405 and S-405 Catalysts in a Monopropellant Hydrazine Thruster
McRight, Patrick; Popp, Chris; Pierce, Charles; Turpin, Alicia; Urbanchock, Walter; Wilson, Mike
2005-01-01
As part of the transfer of catalyst manufacturing technology from Shell Chemical Company (Shell 405 catalyst manufactured in Houston, Texas) to Aerojet (S-405 manufactured in Redmond, Washington), Aerojet demonstrated the equivalence of S-405 and Shell 405 at beginning of life. Some US aerospace users expressed a desire to conduct a preliminary confidence test to assess end-of-life characteristics for S-405. NASA Marshall Space Flight Center (MSFC) and Aerojet entered a contractual agreement in 2004 to conduct a confidence test using a pair of 0.2-lbf MR-103G monopropellant hydrazine thrusters, comparing S-405 and Shell 405 side by side. This paper summarizes the formulation of this test program, explains the test matrix, describes the progress of the test, and analyzes the test results. This paper also includes a discussion of the limitations of this test and the ramifications of the test results for assessing the need for future qualification testing in particular hydrazine thruster applications.
Canning, Francis; Winet, Ed; Ice, Bob; Melcher, Cory; Pesavento, Phil; Holmes, Alan; Butler, Carey; Cole, John; Campbell, Jonathan
2004-01-01
The outline of this viewgraph presentation on asymmetrical capacitor thruster development includes: 1) Test apparatus; 2) Devices tested; 3) Circuits used; 4) Data collected (Time averaged, Time resolved); 5) Patterns observed; 6) Force calculation; 7) Electrostatic modeling; 8) Understand it all.
Hashmi, Jamil A; Zafar, Yusuf; Arshad, Muhammad; Mansoor, Shahid; Asad, Shaheen
2011-04-01
Several important biological processes are performed by distinct functional domains found on replication-associated protein (Rep) encoded by AC1 of geminiviruses. Two truncated forms of replicase (tAC1) gene, capable of expressing only the N-terminal 669 bp (5'AC1) and C-terminal 783 bp (3'AC1) nucleotides cloned under transcriptional control of the CaMV35S were introduced into cotton (Gossypium hirsutum L.) using LBA4404 strain of Agrobacterium tumefaciens to make use of an interference strategy for impairing cotton leaf curl virus (CLCuV) infection in transgenic cotton. Compared with nontransformed control, we observed that transgenic cotton plants overexpressing either N-terminal (5'AC1) or C-terminal (3'AC1) sequences confer resistance to CLCuV by inhibiting replication of viral genomic and β satellite DNA components. Molecular analysis by Northern blot hybridization revealed high transgene expression in early and late growth stages associated with inhibition of CLCuV replication. Of the eight T(1) transgenic lines tested, six had delayed and minor symptoms as compared to nontransformed control lines which developed disease symptoms after 2-3 weeks of whitefly-mediated viral delivery. Virus biological assay and growth of T(2) plants proved that transgenic cotton plants overexpressing 5'- and 3'AC1 displayed high resistance level up to 72, 81%, respectively, as compared to non-transformed control plants following inoculation with viruliferous whiteflies giving significantly high cotton seed yield. Progeny analysis of these plants by polymerase chain reaction (PCR), Southern blotting and virus biological assay showed stable transgene, integration, inheritance and cotton leaf curl disease (CLCuD) resistance in two of the eight transgenic lines having single or two transgene insertions. Transgenic cotton expressing partial AC1 gene of CLCuV can be used as virus resistance source in cotton breeding programs aiming to improve virus resistance in cotton crop.
DEFF Research Database (Denmark)
Liu, Wenzhao; Tarasiuk, Tomasz; Gorniak, Mariusz
2018-01-01
were proposed and carried out in a real ship under sea-going conditions to address this problem. The ship experimental results were presented and discussed considering non-linear bow thruster load and high power ballast pump loads under unbalanced and harmonic voltage conditions. In addition......, the analysis of voltage transient dips during ballast pump starting up is presented. Further, the voltage/current distortions of working generator, bow thruster and pump loads are analyzed. The paper provides a valuable analysis for coping with PQ issues in the real ship power system....
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
Choi, Maria; Yim, John T.; Williams, George J.; Herman, Daniel A.; Gilland, James H.
2018-01-01
Magnetic shielding has eliminated boron nitride erosion as the life limiting mechanism in a Hall thruster but has resulted in erosion of the front magnetic field pole pieces. Recent experiments show that the erosion of graphite pole covers, which are added to protect the magnetic field pole pieces, causes carbon to redeposit on other surfaces, such as boron nitride discharge channel and cathode keeper surfaces. As a part of the risk-reduction activities for Advanced Electric Propulsion System thruster development, this study models transport of backsputtered carbon from the graphite front pole covers and vacuum facility walls. Fluxes, energy distributions, and redeposition rates of backsputtered carbon on the anode, discharge channel, and graphite cathode keeper surfaces are predicted.
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
McElrath, T. P.; Cangahuala, L. A.; Miller, K. J.; Stravert, L. R.; Garcia-Perez, Raul
1995-01-01
Ulysses is a spin-stabilized spacecraft that experienced significant nutation after its launch in October 1990. This was due to the Sun-spacecraft-Earth geometry, and a study of the phenomenon predicted that the nutation would again be a problem during 1994-95. The difficulty of obtaining nutation estimates in real time from the spacecraft telemetry forced the ESA/NASA Ulysses Team to explore alternative information sources. The work performed by the ESA Operations Team provided a model for a system that uses the radio signal strength measurements to monitor the spacecraft dynamics. These measurements (referred to as AGC) are provided once per second by the tracking stations of the DSN. The system was named ARGOS (Attitude Reckoning from Ground Observable Signals) after the ever-vigilant, hundred-eyed giant of Greek Mythology. The ARGOS design also included Doppler processing, because Doppler shifts indicate thruster firings commanded by the active nutation control carried out onboard the spacecraft. While there is some visibility into thruster activity from telemetry, careful processing of the high-sample-rate Doppler data provides an accurate means of detecting the presence and time of thruster firings. DSN Doppler measurements are available at a ten-per-second rate in the same tracking data block as the AGC data.
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Laser Ignition Microthruster Experiments on KKS-1
Nakano, Masakatsu; Koizumi, Hiroyuki; Watanabe, Masashi; Arakawa, Yoshihiro
A laser ignition microthruster has been developed for microsatellites. Thruster performances such as impulse and ignition probability were measured, using boron potassium nitrate (B/KNO3) solid propellant ignited by a 1 W CW laser diode. The measured impulses were 60 mNs ± 15 mNs with almost 100 % ignition probability. The effect of the mixture ratios of B/KNO3 on thruster performance was also investigated, and it was shown that mixture ratios between B/KNO3/binder = 28/70/2 and 38/60/2 exhibited both high ignition probability and high impulse. Laser ignition thrusters designed and fabricated based on these data became the first non-conventional microthrusters on the Kouku Kousen Satellite No. 1 (KKS-1) microsatellite that was launched by a H2A rocket as one of six piggyback satellites in January 2009.
ION ACOUSTIC TURBULENCE, ANOMALOUS TRANSPORT, AND SYSTEM DYNAMICS IN HALL EFFECT THRUSTERS
2017-06-30
NUMBER (Include area code) 30 June 2017 Briefing Charts 26 May 2017 - 30 June 2017 ION ACOUSTIC TURBULENCE, ANOMALOUS TRANSPORT, AND SYSTEM DYNAMICS ...Robert Martin N/A ION ACOUSTIC TURBULENCE, ANOMALOUS TRANSPORT, AND SYSTEM DYNAMICS IN HALL EFFECT THRUSTERS Robert Martin1, Jonathan Tran2 1AIR FORCE...Approved for Public Release; Distribution is Unlimited. PA# 17394 1 / 13 OUTLINE 1 INTRODUCTION 2 TRANSPORT 3 DYNAMIC SYSTEM 4 SUMMARY AND CONCLUSION
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
National Aeronautics and Space Administration — One of the most practical forms of electric propulsion is the Hall Effect Thruster (HET), which makes use of electric and magnetic fields to create and eject a...
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Effect of Anode Magnetic Shield on Magnetic Field and Ion Beam in Cylindrical Hall Thruster
International Nuclear Information System (INIS)
Zhao Jie; Wang Shiqing; Liu Jian; Xu Li; Tang Deli; Geng Shaofei
2010-01-01
Numerical simulation of the effect of the anode magnetic shielding on the magnetic field and ion beam in a cylindrical Hall thruster is presented. The results show that after the anode is shielded by the magnetic shield, the magnetic field lines near the anode surface are obviously convex curved, the ratio of the magnetic mirror is enhanced, the width of the positive magnetic field gradient becomes larger than that without the anode magnetic shielding, the radial magnetic field component is enhanced, and the discharge plasma turbulence is reduced as a result of keeping the original saddle field profile and the important role the other two saddle field profiles play in restricting electrons. The results of the particle in cell (PIC) numerical simulation show that both the ion number and the energy of the ion beam increase after the anode is shielded by the magnetic shield. In other words, the specific impulse of the cylindrical Hall thruster is enhanced.
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
National Aeronautics and Space Administration — I propose to investigate the newly discovered oscillation modes specific to Magnetically Shied (MS) Hall Effect Thrusters (HET). Although HETs are classified as a...
West, Michael D; Charles, Christine; Boswell, Rod W
2009-05-01
A high sensitivity momentum flux measuring instrument based on a compound pendulum has been developed for use with electric propulsion devices and radio frequency driven plasmas. A laser displacement system, which builds upon techniques used by the materials science community for surface stress measurements, is used to measure with high sensitivity the displacement of a target plate placed in a plasma thruster exhaust. The instrument has been installed inside a vacuum chamber and calibrated via two different methods and is able to measure forces in the range of 0.02-0.5 mN with a resolution of 15 microN. Measurements have been made of the force produced from the cold gas flow and with a discharge ignited using argon propellant. The plasma is generated using a Helicon Double Layer Thruster prototype. The instrument target is placed about 1 mean free path for ion-neutral charge exchange collisions downstream of the thruster exit. At this position, the plasma consists of a low density ion beam (10%) and a much larger downstream component (90%). The results are in good agreement with those determined from the plasma parameters measured with diagnostic probes. Measurements at various flow rates show that variations in ion beam velocity and plasma density and the resulting momentum flux can be measured with this instrument. The instrument target is a simple, low cost device, and since the laser displacement system used is located outside the vacuum chamber, the measurement technique is free from radio frequency interference and thermal effects. It could be used to measure the thrust in the exhaust of other electric propulsion devices and the momentum flux of ion beams formed by expanding plasmas or fusion experiments.
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
National Aeronautics and Space Administration — Hall thrusters are being considered for many space missions because their high specific impulse delivers a larger payload mass fraction than chemical rockets. With a...
Resonant and Ground Experimental Study on the Microwave Plasma Thruster
Yang, Juan; He, Hongqing; Mao, Genwang; Qu, Kun; Tang, Jinlan; Han, Xianwei
2002-01-01
chemistry. Therefore, the application of EP for the attitude control and station keeping of satellite, the propulsion of deep space exploration craft allows to reduce substantially the mass of on-board propellant and the launching cost. The EP research is now receiving high interest everywhere. microwave generating subsystem, the propellant supplying subsystem and the resonator (the thruster). Its principle is that the magnetron of the microwave generating subsystem transfers electric energy into microwave energy at given frequency which is introduced into a resonant cavity. Microwave will resonate within the cavity when it is adjusted. When the propellant gas (N2, Ar, He, NH3 or H2) is put into the cavity and coupled with microwave energy at the maximal electric intensity place, it will be broken down to form free-floating plasma, which flows from nozzle with high speed to produce thrust. Its characteristic is high efficiency, simple power supply and without electrode ablation, its specific impulse is greater than arcjet. 2450MHz, have been developed. The microwave generating subsystem and resonator of lower power MPT, 70-200W, are coaxial. The resonator with TEM resonating mode is section of coaxial wave-guide, of which one end is shorted, another is semi-opened. The maximal electric intensity field is in the lumped capacity formed between the end surface of inner conductor, retracting in the cavity, and the semi-opened surface of outer conductor. It provides favorable condition for gas breakdown. The microwave generating system and resonator of middle power MPT, 500-1,000W, are wave-guide cavity. The resonator with TM011 resonating mode is cylinder wave-guide cavity, of which two end surface are shorted. The distribution of electromagnetic field is axial symmetry, its maximal electric intensity field locates on the axis and closes to the exit of nozzle, where the propellant gas is breakdown to form free floating plasma. The plasma is free from the wall of
Gas flow in miniaturized nozzles for micro-thrusters
La Torre, F.
2011-01-01
A new satellite philosophy, developed during the last two decades, suggests to make satellites smaller and lighter rather than bigger and heavier. In other words, large (?m3), single system satellites are being replaced by ?eets of small (?dm3), so-called micro-satellites. Future developmentsmay
National Research Council Canada - National Science Library
Gallimore, Alec D; Walker, Mitchell M; Beal, Brian E; Smith, Timothy B
2006-01-01
.... It is difficult for researchers to make adequate comparisons between data sets because of both differences in instrumentation and back pressures due to the wide range of facilities used in Hall thruster testing...
Improvement of the low frequency oscillation model for Hall thrusters
Energy Technology Data Exchange (ETDEWEB)
Wang, Chunsheng, E-mail: wangcs@hit.edu.cn; Wang, Huashan [Yanshan University, College of Vehicles and Energy, Qinhuangdao 066004, Hebei (China)
2016-08-15
The low frequency oscillation of the discharge current in Hall thrusters is a major aspect of these devices that requires further study. While the existing model captures the ionization mechanism of the low frequency oscillation, it unfortunately fails to express the dynamic characteristics of the ion acceleration. The analysis in this paper shows this is because of the simplification of the electron equation, which affects both the electric field distribution and the ion acceleration process. Additionally, the electron density equation is revised and a new model that is based on the physical properties of ion movement is proposed.
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
Directory of Open Access Journals (Sweden)
Amelia eGreig
2015-01-01
Full Text Available Computational fluid dynamics (CFD simulations of a radio-frequency (13.56 MHz electro-thermal capacitively coupled plasma (CCP micro-thruster have been performed using the commercial CFD-ACE+ package. Standard operating conditions of a 10 W, 1.5 Torr argon discharge were used to compare with previously obtained experimental results for validation. Results show that the driving force behind plasma production within the thruster is ion-induced secondary electrons ejected from the surface of the discharge tube, accelerated through the sheath to electron temperatures up to 33.5 eV. The secondary electron coefficient was varied to determine the effect on the discharge, with results showing that full breakdown of the discharge did not occur for coefficients coefficients less than or equal to 0.01.
Electrostatic Plasma Accelerator (EPA)
Brophy, John R.; Aston, Graeme
1995-01-01
The application of electric propulsion to communications satellites, however, has been limited to the use of hydrazine thrusters with electric heaters for thrust and specific impulse augmentation. These electrothermal thrusters operate at specific impulse levels of approximately 300 s with heater powers of about 500 W. Low power arcjets (1-3 kW) are currently being investigated as a way to increase specific impulse levels to approximately 500 s. Ion propulsion systems can easily produce specific impulses of 3000 s or greater, but have yet to be applied to communications satellites. The reasons most often given for not using ion propulsion systems are their high level of overall complexity, low thrust with long burn times, and the difficulty of integrating the propulsion system into existing commercial spacecraft busses. The Electrostatic Plasma Accelerator (EPA) is a thruster concept which promises specific impulse levels between low power arcjets and those of the ion engine while retaining the relative simplicity of the arcjet. The EPA thruster produces thrust through the electrostatic acceleration of a moderately dense plasma. No accelerating electrodes are used and the specific impulse is a direct function of the applied discharge voltage and the propellant atomic mass.
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
Field emission electric propulsion thruster modeling and simulation
Vanderwyst, Anton Sivaram
Electric propulsion allows space rockets a much greater range of capabilities with mass efficiencies that are 1.3 to 30 times greater than chemical propulsion. Field emission electric propulsion (FEEP) thrusters provide a specific design that possesses extremely high efficiency and small impulse bits. Depending on mass flow rate, these thrusters can emit both ions and droplets. To date, fundamental experimental work has been limited in FEEP. In particular, detailed individual droplet mechanics have yet to be understood. In this thesis, theoretical and computational investigations are conducted to examine the physical characteristics associated with droplet dynamics relevant to FEEP applications. Both asymptotic analysis and numerical simulations, based on a new approach combining level set and boundary element methods, were used to simulate 2D-planar and 2D-axisymmetric probability density functions of the droplets produced for a given geometry and electrode potential. The combined algorithm allows the simulation of electrostatically-driven liquids up to and after detachment. Second order accuracy in space is achieved using a volume of fluid correction. The simulations indicate that in general, (i) lowering surface tension, viscosity, and potential, or (ii) enlarging electrode rings, and needle tips reduce operational mass efficiency. Among these factors, surface tension and electrostatic potential have the largest impact. A probability density function for the mass to charge ratio (MTCR) of detached droplets is computed, with a peak around 4,000 atoms per electron. High impedance surfaces, strong electric fields, and large liquid surface tension result in a lower MTCR ratio, which governs FEEP droplet evolution via the charge on detached droplets and their corresponding acceleration. Due to the slow mass flow along a FEEP needle, viscosity is of less importance in altering the droplet velocities. The width of the needle, the composition of the propellant, the
Magnetically Filtered Faraday Probe for Measuring the Ion Current Density Profile of a Hall Thruster
National Research Council Canada - National Science Library
Rovey, Joshua L; Walker, Mitchell L. R; Gallimore, Alec D; Peterson, Peter Y
2006-01-01
.../s. The probes are evaluated on a xenon propellant Hall thruster in the University of Michigan Large Vacuum Test Facility at operating pressures within the range of 4.4 x 10(-4) Pa Xe (3.3 x 10(-6) Torr Xe) to 1.1 10(-3) Pa Xe (8.4 x 10(-6) Torr Xe...
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
Integration of a MicroCAT Propulsion System and a PhoneSat Bus into a 1.5U CubeSat
Agasid, Elwood Floyd; Perez, Andres Dono; Gazulla, Oriol Tintore; Trinh, Greenfield Tran; Uribe, Eddie Anthony; Keidar, Michael; Haque, Samudra; Teel, George
2014-01-01
NASA Ames Research Center and the George Washington University have developed an electric propulsion subsystem that can be integrated into the PhoneSat bus. Experimental tests have shown a reliable performance by firing three different thrusters at various frequencies in vacuum conditions. The three thrusters were controlled by a SmartPhone that was running the PhoneSat software. The subsystem is fully operational and it requires low average power to function (about 0.1 W). The interface consists of a microcontroller that sends a trigger pulses to the PPU (Plasma Processing Unit), which is responsible for the thruster operation. Frequencies ranging from 1 to 50Hz have been tested, showing a strong flexibility. A SmartPhone acts as the main user interface for the selection of commands that control the entire system. The micro cathode arc thruster MicroCAT provides a high 1(sub sp) of 3000s that allows a 4kg satellite to obtain a (delta)V of 300m/s. The system mass is only 200g with a total of volume of 200(cu cm). The propellant is based on a solid cylinder made of Titanium, which is the cathode at the same time. This simplicity in the design avoids miniaturization and manufacturing problems. The characteristics of this thruster allow an array of MicroCATs to perform attitude control and orbital correcton maneuvers that will open the door for the implementation of an extensive collection of new mission concepts and space applications for CubeSats. NASA Ames is currently working on the integration of the system to fit the thrusters and PPU inside a 1.5U CubeSat together with the PhoneSat bus into a 1.5U CubeSat. This satellite is intended to be deployed from the ISS in 2015 and test the functionality of the thrusters by spinning the satellite around its long axis and measure the rotational speed with the phone byros. This test flight will raise the TRL of the propulsion system from 5 to 7 and will be a first test for further CubeSats with propulsion systems, a key
International Nuclear Information System (INIS)
Black, D.C.; Mayo, R.M.; Gerwin, R.A.; Schoenberg, K.F.; Scheuer, J.T.; Hoyt, R.P.; Henins, I.
1994-01-01
Local, time-dependent magnetic field measurements have been made in the Los Alamos coaxial thruster experiment (CTX) [C. W. Barnes et al., Phys. Fluids B 2, 1871 (1990); J. C. Fernandez et al., Nucl. Fusion 28, 1555 (1988)] using a 24 coil magnetic probe array (eight spatial positions, three axis probes). The CTX is a magnetized, coaxial plasma gun presently being used to investigate the viability of high pulsed power plasma thrusters for advanced electric propulsion. Previous efforts on this device have indicated that high pulsed power plasma guns are attractive candidates for advanced propulsion that employ ideal magnetohydrodynamic (MHD) plasma stream flow through self-formed magnetic nozzles. Indirect evidence of magnetic nozzle formation was obtained from plasma gun performance and measurements of directed axial velocities up to v z ∼10 7 cm/s. The purpose of this work is to make direct measurement of the time evolving magnetic field topology. The intent is to both identify that applied magnetic field distortion by the highly conductive plasma is occurring, and to provide insight into the details of discharge evolution. Data from a magnetic fluctuation probe array have been used to investigate the details of applied magnetic field deformation through the reconstruction of time-dependent flux profiles. Experimentally observed magnetic field line distortion has been compared to that predicted by a simple one-dimensional (1-D) model of the discharge channel. Such a comparison is utilized to estimate the axial plasma velocity in the thruster. Velocities determined in this manner are in approximate agreement with the predicted self-field magnetosonic speed and those measured by a time-of-flight spectrometer
International Nuclear Information System (INIS)
Yu, Yu-Song; Li, Guo-Xiu; Zhang, Tao; Chen, Jun; Wang, Meng
2015-01-01
Highlights: • The decomposition and combustion process is investigated by numerical method. • Heat transfer in catalyst bed is modeled using non-isothermal and radiation model. • The wall heat transfer can impact on the distribution of temperature and species. • The value of catalyst bed length, diameter and wall thickness are optimized. - Abstract: The present investigation numerically studies the evolutions of decomposition and combustion within an ADN-based thruster, and the effects of the catalyst-bed’s three structure parameters (length, diameter, and wall thickness) on the general performance of ADN-based thruster have been systematically investigated. Based upon the calculated results, it can be known that the distribution of temperature gives a Gaussian manner at the exits of the catalyst-bed and the combustion chamber, and the temperature can be obviously effected by each the three structure parameters of the catalyst-bed. With the rise of each the three structure parameter, the temperature will first increases and decreases, and there exists an optimal design value making the temperature be the highest. Via the comparison on the maximal temperature at combustion chamber’s exit and the specific impulse, it can be obtained that the wall thickness plays an important role in the influences on the general performance of ADN-based thruster while the catalyst-bed’s length has the weak effects on the general performance among the three structure parameters.
International Nuclear Information System (INIS)
Burns, J.A.; Matthews, M.S.
1986-01-01
The present work is based on a conference: Natural Satellites, Colloquium 77 of the IAU, held at Cornell University from July 5 to 9, 1983. Attention is given to the background and origins of satellites, protosatellite swarms, the tectonics of icy satellites, the physical characteristics of satellite surfaces, and the interactions of planetary magnetospheres with icy satellite surfaces. Other topics include the surface composition of natural satellites, the cratering of planetary satellites, the moon, Io, and Europa. Consideration is also given to Ganymede and Callisto, the satellites of Saturn, small satellites, satellites of Uranus and Neptune, and the Pluto-Charon system
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Performance and Qualification of the Power Supply and Control Unit for the HEMP Thruster
Brag, R.; Herty, F.
2014-08-01
In 2013, Astrium GmbH delivered several flight model electronics for Electric Propulsion (EP) systems or corresponding components. One of the elements is a Power Supply and Control Unit (PSCU) for the Thales development "High Efficiency Multistage Plasma Thruster" (HEMP-T) (see Figure 1). This paper presents the PSCU specification and results of the qualification and acceptance phase of the EQM and the PFM.
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Numerical investigation of a Hall thruster plasma
International Nuclear Information System (INIS)
Roy, Subrata; Pandey, B.P.
2002-01-01
The dynamics of the Hall thruster is investigated numerically in the framework of a one-dimensional, multifluid macroscopic description of a partially ionized xenon plasma using finite element formulation. The model includes neutral dynamics, inelastic processes, and plasma-wall interaction. Owing to disparate temporal scales, ions and neutrals have been described by set of time-dependent equations, while electrons are considered in steady state. Based on the experimental observations, a third order polynomial in electron temperature is used to calculate ionization rate. The results show that in the acceleration channel the increase in the ion number density is related to the decrease in the neutral number density. The electron and ion velocity profiles are consistent with the imposed electric field. The electron temperature remains uniform for nearly two-thirds of the channel; then sharply increases to a peak before dropping slightly at the exit. This is consistent with the predicted electron gyration velocity distribution
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
Carbon Back Sputter Modeling for Hall Thruster Testing
Gilland, James H.; Williams, George J.; Burt, Jonathan M.; Yim, John T.
2016-01-01
In support of wear testing for the Hall Effect Rocket with Magnetic Shielding (HERMeS) program, the back sputter from a Hall effect thruster plume has been modeled for the NASA Glenn Research Centers Vacuum Facility 5. The predicted wear at a near-worst case condition of 600 V, 12.5 kW was found to be on the order of 3 4 mkhour in a fully carbon-lined chamber. A more detailed numerical monte carlo code was also modified to estimate back sputter for a detailed facility and pumping configuration. This code demonstrated similar back sputter rate distributions, but is not yet accurately modeling the magnitudes. The modeling has been benchmarked to recent HERMeS wear testing, using multiple microbalance measurements. These recent measurements have yielded values, on the order of 1.5- 2 microns/khour.
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Spectrum Diagnosis for Fuchsia Plume of Hall Effect Thruster with Xenon as Propellant
International Nuclear Information System (INIS)
Yu Daren; Ding Jiapeng; Dai Jingmin
2006-01-01
The colour of the Hall effect thruster's plume is often light-green, and sometimes a fuchsia plume appears during experiments. Based on a spectrum and colour analysis, and a comparison with normal plumes, a conclusion is made that the density of the Xe ions and the temperature of electrons are low when the plume appears fuchsia. In this condition, most of the components of the plume are Xe atoms, and the ionization rate of the propellant is low
Shastry, Rohit; Soulas, George C.
2016-01-01
The NEXT Long-Duration Test is part of a comprehensive thruster service life assessment intended to demonstrate overall throughput capability, validate service life models, quantify wear rates as a function of time and operating condition, and identify any unknown life-limiting mechanisms. The test was voluntarily terminated in February 2014 after demonstrating 51,184 hours of high-voltage operation, 918 kg of propellant throughput, and 35.5 MN-s of total impulse. The post-test inspection of the thruster hardware began shortly afterwards with a combination of non-destructive and destructive analysis techniques, and is presently nearing completion. This paper presents relevant results of the post-test inspection for both discharge and neutralizer cathodes. Discharge keeper erosion was found to be significantly reduced from what was observed in the NEXT 2 kh wear test and NSTAR Extended Life Test, providing adequate protection of vital cathode components throughout the test with ample lifetime remaining. The area of the discharge cathode orifice plate that was exposed by the keeper orifice exhibited net erosion, leading to cathode plate material building up in the cathode-keeper gap and causing a thermally-induced electrical short observed during the test. Significant erosion of the neutralizer cathode orifice was also found and is believed to be the root cause of an observed loss in flow margin. Deposition within the neutralizer keeper orifice as well as on the downstream surface was thicker than expected, potentially resulting in a facility-induced impact on the measured flow margin from plume mode. Neutralizer keeper wall erosion on the beam side was found to be significantly lower compared to the NEXT 2 kh wear test, likely due to the reduction in beam extraction diameter of the ion optics that resulted in decreased ion impingement. Results from the post-test inspection have led to some minor thruster design improvements.
International Nuclear Information System (INIS)
Yu Daren; Liu Hui; Fu Haiyang
2009-01-01
Considering the actual magnetic field configuration in a Hall thruster, the effect of magnetic mirror on the radial profile of near-wall conductivity (NWC) is studied in this paper. The plasma electron dynamic process is described by the test particle method. The Monte Carlo scheme is used to solve this model. The radial profile of electron mobility is obtained and the role of magnetic mirror in NWC is analysed both theoretically and numerically. The numerical results show that the electron mobility peak due to NWC is inversely proportional to the magnetic mirror ratio and the asymmetry of electron mobility along the radial direction gets greater when the magnetic mirror is considered. This effect indicates that apart from the disparity in the magnetic field strength, the difference in the magnetic mirror ratio near the inner and outer walls would actually augment the asymmetry of the radial profile of NWC in Hall thrusters.
International Nuclear Information System (INIS)
Escobar, D.; Ahedo, E.
2015-01-01
The linear stability of the Hall thruster discharge is analysed against axial-azimuthal perturbations in the low frequency range using a time-dependent 2D code of the discharge. This azimuthal stability analysis is spatially global, as opposed to the more common local stability analyses, already afforded previously (D. Escobar and E. Ahedo, Phys. Plasmas 21(4), 043505 (2014)). The study covers both axial and axial-azimuthal oscillations, known as breathing mode and spoke, respectively. The influence on the spoke instability of different operation parameters such as discharge voltage, mass flow, and thruster size is assessed by means of different parametric variations and compared against experimental results. Additionally, simplified models are used to unveil and characterize the mechanisms driving the spoke. The results indicate that the spoke is linked to azimuthal oscillations of the ionization process and to the Bohm condition in the transition to the anode sheath. Finally, results obtained from local and global stability analyses are compared in order to explain the discrepancies between both methods
Plattner, Alain; Simons, Frederik J.
2017-10-01
When modelling satellite data to recover a global planetary magnetic or gravitational potential field, the method of choice remains their analysis in terms of spherical harmonics. When only regional data are available, or when data quality varies strongly with geographic location, the inversion problem becomes severely ill-posed. In those cases, adopting explicitly local methods is to be preferred over adapting global ones (e.g. by regularization). Here, we develop the theory behind a procedure to invert for planetary potential fields from vector observations collected within a spatially bounded region at varying satellite altitude. Our method relies on the construction of spatiospectrally localized bases of functions that mitigate the noise amplification caused by downward continuation (from the satellite altitude to the source) while balancing the conflicting demands for spatial concentration and spectral limitation. The `altitude-cognizant' gradient vector Slepian functions (AC-GVSF) enjoy a noise tolerance under downward continuation that is much improved relative to the `classical' gradient vector Slepian functions (CL-GVSF), which do not factor satellite altitude into their construction. Furthermore, venturing beyond the realm of their first application, published in a preceding paper, in the present article we extend the theory to being able to handle both internal and external potential-field estimation. Solving simultaneously for internal and external fields under the limitation of regional data availability reduces internal-field artefacts introduced by downward-continuing unmodelled external fields, as we show with numerical examples. We explain our solution strategies on the basis of analytic expressions for the behaviour of the estimation bias and variance of models for which signal and noise are uncorrelated, (essentially) space- and band-limited, and spectrally (almost) white. The AC-GVSF are optimal linear combinations of vector spherical harmonics
Smith, Brandon D.; Boyd, Iain D.; Kamhawi, Hani
2014-01-01
The sensitivity of xenon ionization rates to collision cross-sections is studied within the framework of a hybrid-PIC model of a Hall thruster discharge. A revised curve fit based on the Drawin form is proposed and is shown to better reproduce the measured crosssections at high electron energies, with differences in the integrated rate coefficients being on the order of 10% for electron temperatures between 20 eV and 30 eV. The revised fit is implemented into HPHall and the updated model is used to simulate NASA's HiVHAc EDU2 Hall thruster at discharge voltages of 300, 400, and 500 V. For all three operating points, the revised cross-sections result in an increase in the predicted thrust and anode efficiency, reducing the error relative to experimental performance measurements. Electron temperature and ionization reaction rates are shown to follow the trends expected based on the integrated rate coefficients. The effects of triply-charged xenon are also assessed. The predicted thruster performance is found to have little or no dependence on the presence of triply-charged ions. The fraction of ion current carried by triply-charged ions is found to be on the order of 1% and increases slightly with increasing discharge voltage. The reaction rates for the 0?III, I?III, and II?III ionization reactions are found to be of similar order of magnitude and are about one order of magnitude smaller than the rate of 0?II ionization in the discharge channel.
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
One-dimensional hybrid-direct kinetic simulation of the discharge plasma in a Hall thruster
International Nuclear Information System (INIS)
Hara, Kentaro; Boyd, Iain D.; Kolobov, Vladimir I.
2012-01-01
In order to model the non-equilibrium plasma within the discharge region of a Hall thruster, the velocity distribution functions (VDFs) must be obtained accurately. A direct kinetic (DK) simulation method that directly solves the plasma Boltzmann equation can achieve better resolution of VDFs in comparison to particle simulations, such as the particle-in-cell (PIC) method that inherently include statistical noise. In this paper, a one-dimensional hybrid-DK simulation, which uses a DK simulation for heavy species and a fluid model for electrons, is developed and compared to a hybrid-PIC simulation. Time-averaged results obtained from the hybrid-DK simulation are in good agreement with hybrid-PIC results and experimental data. It is shown from a comparison of using a kinetic simulation and solving the continuity equation that modeling of the neutral atoms plays an important role for simulations of the Hall thruster discharge plasma. In addition, low and high frequency plasma oscillations are observed. Although the kinetic nature of electrons is not resolved due to the use of a fluid model, the hybrid-DK model provides spatially and temporally well-resolved plasma properties and an improved resolution of VDFs for heavy species with less statistical noise in comparison to the hybrid-PIC method.
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
RHETT2/EPDM Hall Thruster Propulsion System Electromagnetic Compatibility Evaluation
Sarmiento, Charles J.; Sankovic, John M.; Freitas, Joseph; Lynn, Peter R.
1997-01-01
Electromagnetic compatibility measurements were obtained as part of the Electric Propulsion Demonstration Module (EPDM) flight qualification program. Tests were conducted on a Hall thruster system operating at a nominal 66O W discharge power. Measurements of conducted and radiated susceptibility and emissions were obtained and referenced to MEL-STD-461 C. The power processor showed some conducted susceptibility below 4 kHz for the magnet current and discharge voltage. Radiated susceptibility testing yielded a null result. Conducted emissions showed slight violations of the specified limit for MIL-461C CE03. Radiated emissions exceeded the RE02 standard at low frequencies, below 300 MHz, by up to 40 dB RV/m/MHz.
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
Overview of NASA Iodine Hall Thruster Propulsion System Development
Smith, Timothy D.; Kamhawi, Hani; Hickman, Tyler; Haag, Thomas; Dankanich, John; Polzin, Kurt; Byrne, Lawrence; Szabo, James
2016-01-01
NASA is continuing to invest in advancing Hall thruster technologies for implementation in commercial and government missions. The most recent focus has been on increasing the power level for large-scale exploration applications. However, there has also been a similar push to examine applications of electric propulsion for small spacecraft in the range of 300 kg or less. There have been several recent iodine Hall propulsion system development activities performed by the team of the NASA Glenn Research Center, the NASA Marshall Space Flight Center, and Busek Co. Inc. In particular, the work focused on qualification of the Busek 200-W BHT-200-I and development of the 600-W BHT-600-I systems. This paper discusses the current status of iodine Hall propulsion system developments along with supporting technology development efforts.
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
NASA FACTS: E. coli AntiMicrobial Satellite (EcAMSat)
Spremo, Stevan; Cappuccio, Gelsomina; Tomko, David
2013-01-01
The E. coli AntiMicrobial Satellite(EcAMSat) mission will investigate space microgravity affects on the antibiotic resistance of E. coli, a bacterial pathogen responsible for urinary tract infection in humans and animals. EcAMSat is being developed through a partnership between NASAs Ames Research Center and the Stanford University School of Medicine. Dr. A.C. Matin is the Stanford University Principal Investigator. EcAMSat will investigate spaceflight effects on bacterial antibiotic resistance and its genetic basis. Bacterial antibiotic resistance may pose a danger to astronauts in microgravity, where the immune response is weakened. Scientists believe that the results of this experiment could help design effective countermeasures to protect astronauts health during long duration human space missions.
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Firing Control Optimization of Impulse Thrusters for Trajectory Correction Projectiles
Directory of Open Access Journals (Sweden)
Min Gao
2015-01-01
Full Text Available This paper presents an optimum control scheme of firing time and firing phase angle by taking impact point deviation as optimum objective function which takes account of the difference of longitudinal and horizontal correction efficiency, firing delay, roll rate, flight stability, and so forth. Simulations indicate that this control scheme can assure lateral impulse thrusters are activated at time and phase angle when the correction efficiency is higher. Further simulations show that the impact point dispersion is mainly influenced by the total impulse deployed, and the impulse, number, and firing interval need to be optimized to reduce the impact point dispersion of rockets. Live firing experiments with two trajectory correction rockets indicate that the firing control scheme works effectively.
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
Hall effect thruster with an AlN chamber
International Nuclear Information System (INIS)
Barral, S.; Jayet, Y.; Mazouffre, S.; Veron, E.; Echegut, P.; Dudeck, M.
2005-01-01
The plasma discharge of a Hall-effect thruster (SPT) is strongly depending of the plasma-insulated wall interactions. These interactions are mainly related to the energy deposition, potential sheath effect and electron secondary emission rate (e.s.e.). In usual SPT, the annular channel is made of BN-SiO 2 . The SPT100-ML (laboratory model will be tested with an AlN chamber in the French test facility Pivoine in the laboratoire d'Aerothermique (Orleans-France). The different parameters such as discharge current, thrust, plasma oscillations and wall temperature will studied for several operating conditions. The results will be compared with a fluid model developed in IPPT (Warsaw-Poland) taking into account electron emission from the internal and external walls and using previous experimental measurements of e.s.e. for AlN from ONERA (Toulouse-France). The surface state of AlN will be analysed before and after experiments by an Environmental Scanning Electron Microscope and by a Strength Electron Microscope. (author)
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Global characteristics of an ATON stationary plasma thruster operating with krypton and xenon
International Nuclear Information System (INIS)
Bugrova, A.I.; Lipatov, A.S.; Solomatina, L.V.; Morozov, A.I.
2002-01-01
Paper contains the experimental results of operation of the ATON plasma thruster operating with krypton and xenon. It is shown that consumption of a working gas for consumption of a working gas the krypton base thrust is higher in contrast to xenon base one at lower efficiency. In case of krypton use one obtained the efficiency constituting ∼ 60% at specific pulse reaching 3000 s. Jet divergence in case of krypton use is ∼ ± 22 deg in contrast to ∼ ± 11 deg in case of xenon use [ru
Comparison of Medium Power Hall Effect Thruster Ion Acceleration for Krypton and Xenon Propellants
2016-09-14
Pumping is provided by four single-stage cryogenic panels (single-stage cold heads at 25 K) and one 50 cm two stage cryogenic pump (12 K). This vacuum...test chamber has a mea- sured pumping speed of 36 kL/s on xenon. The Hall thruster used in this study is a medium power laboratory Hall effect...The first compo- nent passes through a krypton opto-galvanic cell and is terminated by a beam dump . The opto-galvanic cell current is capacitively
Stafford, A.; Safronova, A. S.; Kantsyrev, V. L.; Safronova, U. I.; Petkov, E. E.; Shlyaptseva, V. V.; Childers, R.; Shrestha, I.; Beiersdorfer, P.; Hell, H.; Brown, G. V.
2017-10-01
Dielectronic recombination (DR) is an important process for astrophysical and laboratory high energy density (HED) plasmas and the associated satellite lines are frequently used for plasma diagnostics. In particular, K-shell DR satellite lines were studied in detail in low-Z plasmas. L-shell Na-like spectral features from Mo X-pinches considered here represent the blend of DR and inner shell satellites and motivated the detailed study of DR at the EBIT-1 electron beam ion trap at LLNL. In these experiments the beam energy was swept between 0.6 - 2.4 keV to produce resonances at certain electron beam energies. The advantages of using an electron beam ion trap to better understand atomic processes with highly ionized ions in HED Mo plasma are highlighted. This work was supported by NNSA under DOE Grant DE-NA0002954. Work at LLNL was performed under the auspices of the U.S. DOE under Contract No. DE-AC52-07NA27344.
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
Validation Test Results for Orthogonal Probe Eddy Current Thruster Inspection System
Wincheski, Russell A.
2007-01-01
Recent nondestructive evaluation efforts within NASA have focused on an inspection system for the detection of intergranular cracking originating in the relief radius of Primary Reaction Control System (PCRS) Thrusters. Of particular concern is deep cracking in this area which could lead to combustion leakage in the event of through wall cracking from the relief radius into an acoustic cavity of the combustion chamber. In order to reliably detect such defects while ensuring minimal false positives during inspection, the Orthogonal Probe Eddy Current (OPEC) system has been developed and an extensive validation study performed. This report describes the validation procedure, sample set, and inspection results as well as comparing validation flaws with the response from naturally occuring damage.
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
National Aeronautics and Space Administration — With NASA planning to redirect an asteroid and possible future missions to the Moon or Martian satellites, the effects of thruster plume impingement on the surfaces...
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
High power electromagnetic propulsion research at the NASA Glenn Research Center
International Nuclear Information System (INIS)
LaPointe, Michael R.; Sankovic, John M.
2000-01-01
Interest in megawatt-class electromagnetic propulsion has been rekindled to support newly proposed high power orbit transfer and deep space mission applications. Electromagnetic thrusters can effectively process megawatts of power to provide a range of specific impulse values to meet diverse in-space propulsion requirements. Potential applications include orbit raising for the proposed multi-megawatt Space Solar Power Satellite and other large commercial and military space platforms, lunar and interplanetary cargo missions in support of the NASA Human Exploration and Development of Space strategic enterprise, robotic deep space exploration missions, and near-term interstellar precursor missions. As NASA's lead center for electric propulsion, the Glenn Research Center is developing a number of high power electromagnetic propulsion technologies to support these future mission applications. Program activities include research on MW-class magnetoplasmadynamic thrusters, high power pulsed inductive thrusters, and innovative electrodeless plasma thruster concepts. Program goals are highlighted, the status of each research area is discussed, and plans are outlined for the continued development of efficient, robust high power electromagnetic thrusters
E × B electron drift instability in Hall thrusters: Particle-in-cell simulations vs. theory
Boeuf, J. P.; Garrigues, L.
2018-06-01
The E × B Electron Drift Instability (E × B EDI), also called Electron Cyclotron Drift Instability, has been observed in recent particle simulations of Hall thrusters and is a possible candidate to explain anomalous electron transport across the magnetic field in these devices. This instability is characterized by the development of an azimuthal wave with wavelength in the mm range and velocity on the order of the ion acoustic velocity, which enhances electron transport across the magnetic field. In this paper, we study the development and convection of the E × B EDI in the acceleration and near plume regions of a Hall thruster using a simplified 2D axial-azimuthal Particle-In-Cell simulation. The simulation is collisionless and the ionization profile is not-self-consistent but rather is given as an input parameter of the model. The aim is to study the development and properties of the instability for different values of the ionization rate (i.e., of the total ion production rate or current) and to compare the results with the theory. An important result is that the wavelength of the simulated azimuthal wave scales as the electron Debye length and that its frequency is on the order of the ion plasma frequency. This is consistent with the theory predicting destruction of electron cyclotron resonance of the E × B EDI in the non-linear regime resulting in the transition to an ion acoustic instability. The simulations also show that for plasma densities smaller than under nominal conditions of Hall thrusters the field fluctuations induced by the E × B EDI are no longer sufficient to significantly enhance electron transport across the magnetic field, and transit time instabilities develop in the axial direction. The conditions and results of the simulations are described in detail in this paper and they can serve as benchmarks for comparisons between different simulation codes. Such benchmarks would be very useful to study the role of numerical noise (numerical
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
Attitude Dynamics and Stability of a Simple Solar Photon Thruster
Directory of Open Access Journals (Sweden)
Anna D. Guerman
2013-01-01
Full Text Available This paper is dedicated to the development of a model of the attitude dynamics for a nonideal Simple Solar Photon Thruster (SSPT and to the analysis of sailcraft motions with respect to their centre of mass. Derivation of the expressions for force and torque due to solar radiation that is valid for the case, when there is a misalignment of the SSPT axis with the sun direction, is followed by study of sailcraft dynamics and stability properties. Analysis of stability shows that an ideally reflecting sail is unstable, while for a sailcraft with nonideal collector, the symmetry axis is stable with respect to the Sun direction for large variety of system parameters. The motion around symmetry axis is always unstable and requires an active stabilizer.
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
Effect of dust on tilted electrostatic resistive instability in a Hall thruster
Tyagi, Jasvendra; Singh, Sukhmander; Malik, Hitendra K.
2018-03-01
Effect of negatively charged dust on resistive instability corresponding to the electrostatic wave is investigated in a Hall thruster plasma when this purely azimuthal wave is tilted and strong axial component of wave vector is developed. Analytical calculations are done to obtain the relevant dispersion equation, which is solved numerically to investigate the growth rate of the instability. The magnitude of the growth rate in the plasma having dust particles is found to be much smaller than the case of pure plasma. However, the instability grows faster for the increasing dust density and the higher charge on the dust particles. The higher magnetic field is also found to support the instability.
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
Vienna VLBI and Satellite Software (VieVS) for Geodesy and Astrometry
Böhm, Johannes; Böhm, Sigrid; Boisits, Janina; Girdiuk, Anastasiia; Gruber, Jakob; Hellerschmied, Andreas; Krásná, Hana; Landskron, Daniel; Madzak, Matthias; Mayer, David; McCallum, Jamie; McCallum, Lucia; Schartner, Matthias; Teke, Kamil
2018-04-01
The Vienna VLBI and Satellite Software (VieVS) is state-of-the-art Very Long Baseline Interferometry (VLBI) analysis software for geodesy and astrometry. VieVS has been developed at Technische Universität Wien (TU Wien) since 2008, where it is used for research purposes and for teaching space geodetic techniques. In the past decade, it has been successfully applied on Very Long Baseline Interferometry (VLBI) observations for the determination of celestial and terrestrial reference frames as well as for the estimation of celestial pole offsets, universal Time (UT1-UTC), and polar motion based on least-squares adjustment. Furthermore, VieVS is equipped with tools for scheduling and simulating VLBI observations to extragalactic radio sources as well as to satellites and spacecraft, features which proved to be very useful for a variety of applications. VieVS is now available as version 3.0 and we do provide the software to all interested persons and institutions. A wiki with more information about VieVS is available at http://vievswiki.geo.tuwien.ac.at/.
21 CFR 880.5100 - AC-powered adjustable hospital bed.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
Clearance of short circuited ion optics electrodes by capacitive discharge. [in ion thrusters
Poeschel, R. L.
1976-01-01
The ion optics electrodes of low specific impulse (3000 sec) mercury electron bombardment ion thrusters are vulnerable to short circuits by virtue of their relatively small interelectrode spacing (0.5 mm). Metallic flakes from backsputtered deposits are the most probable cause of such 'shorts' and 'typical' flakes have been simulated here using refractory wire that has a representative, but controllable, cross section. Shorting wires can be removed by capacitive discharge without significant damage to the electrodes. This paper describes an evaluation of 'short' removal versus electrode damage for several combinations of capacitor voltage, stored energy, and short circuit conditions.
Dougherty, Laura; Zhu, Yuandi; Xu, Kenong
2016-01-01
Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553
AC electric motors control advanced design techniques and applications
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi
Directory of Open Access Journals (Sweden)
Rudy Ariyanto
2017-11-01
Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
High-thrust and low-power operation of a 30-cm-diameter mercury ion thruster
Beattie, J. R.; Kami, S.
1981-01-01
An investigation of a 30-cm-diameter mercury ion thruster designed for high-thrust and low-power operation is described. Experimental results are presented which indicate that good performance and long lifetime are achieved by using a boundary magnetic field arrangement to confine the ionizing electrons. Details of advanced ion-optics designs are discussed, and performance measurements obtained with an advanced two-grid ion-optics assembly are presented. Scaling of the state-of-the-art hollow cathode for higher emission-current capability is described, and performance and lifetime measurements are presented for the scaled cathode.
Diagnosis and Fault-Tolerant Control for Thruster-Assisted Position Mooring System
DEFF Research Database (Denmark)
Nguyen, Trong Dong; Blanke, Mogens; Sørensen, Asgeir
2007-01-01
Development of fault-tolerant control systems is crucial to maintain safe operation of o®shore installations. The objective of this paper is to develop a fault- tolerant control for thruster-assisted position mooring (PM) system with faults occurring in the mooring lines. Faults in line......'s pretension or line breaks will degrade the performance of the positioning of the vessel. Faults will be detected and isolated through a fault diagnosis procedure. When faults are detected, they can be accommodated through the control action in which only parameter of the controlled plant has to be updated...... to cope with the faulty condition. Simulations will be carried out to verify the advantages of the fault-tolerant control strategy for the PM system....
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
A Cubesat Asteroid Mission: Propulsion Trade-offs
Landis, Geoffrey A.; Oleson, Steven R.; McGuire, Melissa L.; Bur, Michael J.; Burke, Laura M.; Fittje, James E.; Kohout, Lisa L.; Fincannon, James; Packard, Thomas W.; Martini, Michael C.
2014-01-01
A conceptual design was performed for a 6-U cubesat for a technology demonstration to be launched on the NASA Space Launch System (SLS) test launch EM-1, to be launched into a free-return translunar trajectory. The mission purpose was to demonstrate use of electric propulsion systems on a small satellite platform. The candidate objective chosen was a mission to visit a Near-Earth asteroid. Both asteroid fly-by and asteroid rendezvous missions were analyzed. Propulsion systems analyzed included cold-gas thruster systems, Hall and ion thrusters, incorporating either Xenon or Iodine propellant, and an electrospray thruster. The mission takes advantage of the ability of the SLS launch to place it into an initial trajectory of C3=0.
Design and synthesis of 225Ac radioimmunopharmaceuticals
International Nuclear Information System (INIS)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.
2002-01-01
The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
International Nuclear Information System (INIS)
Ruskol, E.L.
1981-01-01
The characteristics of the Saturn satellites are discussed. The satellites close to Saturn - Janus, Mimas, Enceladus, Tethys, Dione and Rhea - rotate along the circular orbits. High reflectivity is attributed to them, and the density of the satellites is 1 g/cm 3 . Titan is one of the biggest Saturn satellites. Titan has atmosphere many times more powerful than that of Mars. The Titan atmosphere is a peculiar medium with a unique methane and hydrogen distribution in the whole Solar system. The external satellites - Hyperion, Japetus and Phoebe - are poorly investigated. Neither satellite substance density, nor their composition are known. The experimental data on the Saturn rings obtained on the ''Pioneer-11'' and ''Voyager-1'' satellites are presented [ru
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
Marketingová komunikace AC Sparta Praha
Fanta, Jan
2016-01-01
Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...
c-axis ac susceptibility in high-Tc superconductors
International Nuclear Information System (INIS)
Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.
1996-01-01
We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
High thrust-to-power ratio micro-cathode arc thruster
Directory of Open Access Journals (Sweden)
Joseph Lukas
2016-02-01
Full Text Available The Micro-Cathode Arc Thruster (μCAT is an electric propulsion device that ablates solid cathode material, through an electrical vacuum arc discharge, to create plasma and ultimately produce thrust in the μN to mN range. About 90% of the arc discharge current is conducted by electrons, which go toward heating the anode and contribute very little to thrust, with only the remaining 10% going toward thrust in the form of ion current. A preliminary set of experiments were conducted to show that, at the same power level, thrust may increase by utilizing an ablative anode. It was shown that ablative anode particles were found on a collection plate, compared to no particles from a non-ablative anode, while another experiment showed an increase in ion-to-arc current by approximately 40% at low frequencies compared to the non-ablative anode. Utilizing anode ablation leads to an increase in thrust-to-power ratio in the case of the μCAT.
Mauro, Stephanie
2016-01-01
The Iodine Satellite (iSAT) is a 12U cubesat with a primary mission to demonstrate the iodine fueled Hall Effect Thruster (HET) propulsion system. The spacecraft (SC) will operate throughout a one year mission in an effort to mature the propulsion system for use in future applications. The benefit of the HET is that it uses a propellant, iodine, which is easy to store and provides a high thrust-to-mass ratio. This paper will describe the thermal analysis and design of the SC between Preliminary Design Review (PDR) and Critical Design Review (CDR). The design of the satellite has undergone many changes due to a variety of challenges, both before PDR and during the time period discussed in this paper. Thermal challenges associated with the system include a high power density, small amounts of available radiative surface area, localized temperature requirements of the propulsion components, and unknown orbital parameters. The thermal control system is implemented to maintain component temperatures within their respective operational limits throughout the mission, while also maintaining propulsion components at the high temperatures needed to allow gaseous iodine propellant to flow. The design includes heaters, insulation, radiators, coatings, and thermal straps. Currently, the maximum temperatures for several components are near to their maximum operation limit, and the battery is close to its minimum operation limit. Mitigation strategies and planned work to solve these challenges will be discussed.