WorldWideScience

Sample records for sars-cov s1 protein

  1. Bioinformatics analysis of SARS-Cov M protein provides information for vaccine development

    Institute of Scientific and Technical Information of China (English)

    LIU Wanli; LU Yun; CHEN Yinghua

    2003-01-01

    The pathogen causing severe acute respiratory syndrome (SARS) is identified to be SARS-Cov. It is urgent to know more about SARS-Cov for developing an efficient SARS vaccine to prevent this epidemic disease. In this report, the homology of SARS-Cov M protein to other members of coronavirus is illustrated, and all amino acid changes in both S and M proteins among all available SARS-Cov isolates in GenBank are described. Furthermore, one topological trans-membrane secondary structure model of M protein is proposed, which is corresponded well with the accepted topology model of M proteins of other members of coronavirus. Hydrophilic profile analysis indicated that one region (aa150~210) on the cytoplasmic domain is fairly hydrophilic, suggesting its property of antigenicity. Based on the fact that cytoplasmic domain of the M protein of some other coronavirus could induce protective activities against virus infection, this region might be one potential target for SARS vaccine development.

  2. Receptor-binding domain of SARS-Cov spike protein: Soluble expression in purification and functional characterization

    Institute of Scientific and Technical Information of China (English)

    Jing Chen; Lin Miao; Jia-Ming Li; Yan-Ying Li; Qing-Yu Zhu; Chang-Lin Zhou; Hong-Qing Fang; Hui-Peng Chen

    2005-01-01

    AIM: To find a soluble and functional recombinant receptor-binding domain of severe acute respiratory syndrome-associated coronavirus (SARS-Cov), and to analyze its receptor binding ability.METHODS: Three fusion tags (glutathione S-transferase,GST; thioredoxin, Trx; maltose-binding protein, MBP),which preferably contributes to increasing solubility and to facilitating the proper folding of heteroprotein, were used to acquire the soluble and functional expression of RBD protein in Escherichia coli( BL21( DE3 ) and Rosetta-gamiB(DE3) strains). The receptor binding ability of the purified soluble RBD protein was then detected by ELISA and flow cytometry assay.RESULTS: RBD of SARS-Cov spike protein was expressed as inclusion body when fused as TrxA tag form in both BL21 (DE3) and Rosetta-gamiB (DE3) under many different cultures and induction conditions. And there was no visible expression band on SDS-PAGE when RBD was expressed as MBP tagged form. Only GST tagged RBD was soluble expressed in BL21(DE3), and the protein was purified by AKTA Prime Chromatography system. The ELISA data anti-RBD mouse monoclonal antibody 1A5. Further flow cytometry assay demonstrated the high efficiency of RBD's binding ability to ACE2 (angiotensin-converting enzyme 2)positive Vero E6 cell. And ACE2 was proved as a cellular receptor that meditated an initial-affinity interaction with SARS-Cov spike protein. The geometrical mean of GST and respectively.CONCLUSION: In this paper, we get sufficient soluble N terminal GST tagged RBD protein expressed in E. coli BL21(DE3); data from ELISA and flow cytometry assay demonstrate that the recombinant protein is functional and binding to ACE2 positive Vero E6 cell efficiently. And the recombinant RBD derived from E. coli can be used to developing subunit vaccine to block S protein binding with receptor and to neutralizing SARS-Cov infection.

  3. CLONING SEGMENT SPIKE PROTEIN GENE OF SARS-COV AND ITS EXPRESSION IN ESCHERICHIA COLI

    Institute of Scientific and Technical Information of China (English)

    刘中华; 许文波; 毛乃颖; 张燕; 朱贞; 崔爱利; 杨建国; 胡海涛

    2004-01-01

    Objective Expressing and purifying the segment of SARS-CoV spike protein in E.Coli. Methods The target gene was obtained by RT-PCR. The PCR product was cloned into pEGM- T Easy Vector, sequencing and double restriction digestion ( BamHⅠ,PstⅠ) were performed. The target gene was subcloned into PQE30 expression vector. The gene was expressed in the E.coli strain M15 cells induced by IPTG. The protein was purified with a nickel HiTrap chelating metal affinity column. Results The recombinant expression plasmid was successfully constructed and the protein was well expressed in E. coli strain M15 cells. The ideal pure protein was obtained by purification. Western blotting analysis suggested the protein could act with the convalescent sera of lab confirmed SARS patients. Conclusion The segment of SARS-CoV spike protein was well expressed and purified, and can be applied in diagnosis and immunological research of SARS.

  4. Reconstruction of the most recent common ancestor sequences of SARS-Cov S gene and detection of adaptive evolution in the spike protein

    Institute of Scientific and Technical Information of China (English)

    ZHANG Yuan; ZHENG Nan; HAO Pei; ZHONG Yang

    2004-01-01

    @@ The genome organization and expression strategy of severe acute respiratory syndrome coronavirus (SARSCoV) have been described extensivelyl1- 10]. As a structural glycoprotein on the virion surface, the spike protein is responsible for binding to host cellular receptors and for the fusion between the viral envelope and the cellular membrane. It also induces neutralizing antibodies in the host and mediates cellular immunity[11]. Previous studies suggested that amino acid replacements in the spike protein could dramatically alter the pathogenesis and virulence of some coronaviruses[11]. It is therefore reasonable to test the hypothesis that radical amino acid replacements in the spike protein, favored by environmental selective pressure during the process of SARS-CoV interspecific transmission[10], might make this pathogen adapt to a new host. In this study, we investigated a total of 108complete sequences of the SARS-CoV S gene from GenBank (until March 23, 2004). After omission of those records containing frame-shift mutations or low quality sequences, e.g. ZJ01, and selection of one sequence for identical records, an alignment of 42 sequences was obtained using the program Clustal-X[13]. Then, we reconstructed the most recent common ancestor (MRCA) sequences of the SARS-CoV S gene and detected the adaptive evolution in the spike protein.

  5. DNA Vaccine of SARS-Cov S Gene Induces Antibody Response in Mice

    Institute of Scientific and Technical Information of China (English)

    PingZHAO; Jin-ShanKE; Zhao-LinQIN; HaoREN; Lan-JuanZHAO; Jian-GuoYU

    2004-01-01

    The spike (S) protein, a main surface antigen of SARS-coronavirus (SARS-CoV), is one of the most important antigen candidates for vaccine design. In the present study, three fragments of the truncated S protein were expressed in E.coli, and analyzed with pooled sera of convalescence phase of SARS patients.The full length S gene DNA vaccine was constructed and used to immunize BALB/c mice. The mouse serum IgG antibody against SARS-CoV was measured by ELISA with E.coli expressed truncated S protein or SARS-CoV lysate as diagnostic antigen. The results showed that all the three fragments of S protein expressed by E.coli was able to react with sera of SARS patients and the S gene DNA candidate vaccine could induce the production of specific IgG antibody against SARS-CoV efficiently in mice with seroconversion ratio of 75% after 3 times of immunization. These findings lay some foundations for further understanding the immunology of SARS-CoV and developing SARS vaccines.

  6. DNA Vaccine of SARS-Cov S Gene Induces Antibody Response in Mice

    Institute of Scientific and Technical Information of China (English)

    Ping ZHAO; Jin-Shan KE; Zhao-Lin QIN; Hao REN; Lan-Juan ZHAO; Jian-Guo YU; Jun GAO; Shi-Ying ZHU; Zhong-Tian QI

    2004-01-01

    The spike (S) protein, a main surface antigen of SARS-coronavirus (SARS-CoV), is one of the most important antigen candidates for vaccine design. In the present study, three fragments of the truncated S protein were expressed in E. Coli, and analyzed with pooled sera of convalescence phase of SARS patients.The full length S gene DNA vaccine was constructed and used to immunize BALB/c mice. The mouse serum IgG antibody against SARS-CoV was measured by ELISA with E. Coli expressed truncated S protein or SARS-CoV lysate as diagnostic antigen. The results showed that all the three fragments of S protein expressed by E. Coli was able to react with sera of SARS patients and the S gene DNA candidate vaccine could induce the production of specific IgG antibody against SARS-CoV efficiently in mice with seroconversion ratio of 75% after 3 times of immunization. These findings lay some foundations for further understanding the immunology of SARS-CoV and developing SARS vaccines.

  7. Direct interaction of the N-terminal domain of ribosomal protein S1 with protein S2 in Escherichia coli.

    Science.gov (United States)

    Byrgazov, Konstantin; Manoharadas, Salim; Kaberdina, Anna C; Vesper, Oliver; Moll, Isabella

    2012-01-01

    Despite of the high resolution structure available for the E. coli ribosome, hitherto the structure and localization of the essential ribosomal protein S1 on the 30 S subunit still remains to be elucidated. It was previously reported that protein S1 binds to the ribosome via protein-protein interaction at the two N-terminal domains. Moreover, protein S2 was shown to be required for binding of protein S1 to the ribosome. Here, we present evidence that the N-terminal domain of S1 (amino acids 1-106; S1(106)) is necessary and sufficient for the interaction with protein S2 as well as for ribosome binding. We show that over production of protein S1(106) affects E. coli growth by displacing native protein S1 from its binding pocket on the ribosome. In addition, our data reveal that the coiled-coil domain of protein S2 (S2α(2)) is sufficient to allow protein S1 to bind to the ribosome. Taken together, these data uncover the crucial elements required for the S1/S2 interaction, which is pivotal for translation initiation on canonical mRNAs in gram-negative bacteria. The results are discussed in terms of a model wherein the S1/S2 interaction surface could represent a possible target to modulate the selectivity of the translational machinery and thereby alter the translational program under distinct conditions.

  8. Blocking peptides against HBV: PreS1 protein selected from a phage display library

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Wei; Liu, Yang; Zu, Xiangyang; Jin, Rui [State Key Laboratory of Virology, Wuhan Institute of Virology, Chinese Academy of Sciences, Wuhan 430071 (China); Xiao, Gengfu, E-mail: xiaogf@wh.iov.cn [State Key Laboratory of Virology, Wuhan Institute of Virology, Chinese Academy of Sciences, Wuhan 430071 (China)

    2011-09-09

    Highlights: {yields} Successfully selected specific PreS1-interacting peptides by using phage displayed library. {yields} Alignment of the positive phage clones revealed a consensus PreS1 binding motif. {yields} A highly enriched peptide named P7 had a strong binding ability for PreS1. {yields} P7 could block PreS1 attachment. -- Abstract: The PreS1 protein is present on the outermost part of the hepatitis B virus (HBV) surface and has been shown to have a pivotal function in viral infectivity and assembly. The development of reagents with high affinity and specificity for PreS1 is of great significance for early diagnosis and treatment of HBV infection. A phage display library of dodecapeptide was screened for interactions with purified PreS1 protein. Alignment of the positive phage clones revealed a putative consensus PreS1 binding motif of HX{sub n}HX{sub m}HP/R. Moreover, a peptide named P7 (KHMHWHPPALNT) was highly enriched and occurred with a surprisingly high frequency of 72%. A thermodynamic study revealed that P7 has a higher binding affinity to PreS1 than the other peptides. Furthermore, P7 was able to abrogate the binding of HBV virions to the PreS1 antibody, suggesting that P7 covers key functional sites on the native PreS1 protein. This newly isolated peptide may, therefore, be a new therapeutic candidate for the treatment of HBV. The consensus motif could be modified to deliver imaging, diagnostic, and therapeutic agents to tissues affected by HBV.

  9. Polynucleotide phosphorylase hinders mRNA degradation upon ribosomal protein S1 overexpression in Escherichia coli.

    Science.gov (United States)

    Briani, Federica; Curti, Serena; Rossi, Francesca; Carzaniga, Thomas; Mauri, Pierluigi; Dehò, Gianni

    2008-11-01

    The exoribonuclease polynucleotide phosphorylase (PNPase, encoded by pnp) is a major player in bacterial RNA decay. In Escherichia coli, PNPase expression is post-transcriptionally regulated at the level of mRNA stability. The primary transcript is very efficiently processed by the endonuclease RNase III at a specific site and the processed pnp mRNA is rapidly degraded in a PNPase-dependent manner. While investigating the PNPase autoregulation mechanism we found, by UV-cross-linking experiments, that the ribosomal protein S1 in crude extracts binds to the pnp-mRNA leader region. We assayed the potential role of S1 protein in pnp gene regulation by modulating S1 expression from depletion to overexpression. We found that S1 depletion led to a sharp decrease of the amount of pnp and other tested mRNAs, as detected by Northern blotting, whereas S1 overexpression caused a strong stabilization of pnp and the other transcripts. Surprisingly, mRNA stabilization depended on PNPase, as it was not observed in a pnp deletion strain. PNPase-dependent stabilization, however, was not detected by chemical decay assay of bulk mRNA. Overall, our data suggest that PNPase exonucleolytic activity may be modulated by the translation potential of the target mRNAs and that, upon ribosomal protein S1 overexpression, PNPase protects from degradation a set of full-length mRNAs. It thus appears that a single mRNA species may be differentially targeted to either decay or PNPase-dependent stabilization, thus preventing its depletion in conditions of fast turnover.

  10. Protein crystallography beamline BL2S1 at the Aichi synchrotron

    Science.gov (United States)

    Watanabe, Nobuhisa; Nagae, Takayuki; Yamada, Yusuke; Tomita, Ayana; Matsugaki, Naohiro; Tabuchi, Masao

    2017-01-01

    The protein crystallography beamline BL2S1, constructed at one of the 5 T superconducting bending-magnet ports of the Aichi synchrotron, is available to users associated with academic and industrial organizations. The beamline is mainly intended for use in X-ray diffraction measurements of single-crystals of macromolecules such as proteins and nucleic acids. Diffraction measurements for crystals of other materials are also possible, such as inorganic and organic compounds. BL2S1 covers the energy range 7–17 keV (1.8–0.7 Å) with an asymmetric-cut curved single-crystal monochromator [Ge(111) or Ge(220)], and a platinum-coated Si mirror is used for vertical focusing and as a higher-order cutoff filter. The beamline is equipped with a single-axis goniometer, a CCD detector, and an open-flow cryogenic sample cooler. High-pressure protein crystallography with a diamond anvil cell can also be performed using this beamline. PMID:28009576

  11. Protein crystallography beamline BL2S1 at the Aichi synchrotron

    Energy Technology Data Exchange (ETDEWEB)

    Watanabe, Nobuhisa; Nagae, Takayuki; Yamada, Yusuke; Tomita, Ayana; Matsugaki, Naohiro; Tabuchi, Masao (Nagoya); (Photon)

    2017-01-01

    The protein crystallography beamline BL2S1, constructed at one of the 5 T superconducting bending-magnet ports of the Aichi synchrotron, is available to users associated with academic and industrial organizations. The beamline is mainly intended for use in X-ray diffraction measurements of single-crystals of macromolecules such as proteins and nucleic acids. Diffraction measurements for crystals of other materials are also possible, such as inorganic and organic compounds. BL2S1 covers the energy range 7–17 keV (1.8–0.7 Å) with an asymmetric-cut curved single-crystal monochromator [Ge(111) or Ge(220)], and a platinum-coated Si mirror is used for vertical focusing and as a higher-order cutoff filter. The beamline is equipped with a single-axis goniometer, a CCD detector, and an open-flow cryogenic sample cooler. Lastly, high-pressure protein crystallography with a diamond anvil cell can also be performed using this beamline.

  12. Effect of neomycin and protein S1 on the binding of streptomycin to the ribosome.

    Science.gov (United States)

    Grisé-Miron, L; Brakier-Gingras, L

    1982-04-01

    The binding of [3H]dihydrostreptomycin to the 70-S ribosome or to the 30-S subunit has been investigated in the presence of neomycin by the Millipore filtration or the equilibrium dialysis procedure. It was observed that dihydrostreptomycin binds equally well to the 30-S subunit and the 70-S ribosome, and that neomycin stimulates the binding of dihydrostreptomycin to the ribosome by increasing the association constant and not by creating new binding sites. Specific removal of protein S1 from the 30-S subunit neither affected the binding of dihydrostreptomycin to the ribosome nor the stimulation of dihydrostreptomycin binding by neomycin.

  13. [Prokaryotic expression of S2 extracellular domain of SARS coronavirus spike protein and its fusion with Hela cell membrane].

    Science.gov (United States)

    Liu, Yun; Liu, Ai-Hua; Deng, Peng; Wu, Xiang-Ling; Li, Tao; Liu, Ya-Wei; Xu, Jia; Jiang, Yong

    2009-03-01

    To construct the expression plasmid of S2 extracellular domain (S2ED) of SARS-coronavirus (SARS- Cov) spike protein (S protein) and enhanced green fluorescent protein (EGFP) to obtain the fusion protein expressed in prokaryotic cells. S2ED based on bioinformatics prediction and EGFP sequence were amplified by PCR and inserted into pET-14b plasmid. The recombinant protein His-S2ED-EGFP was expressed in E. coli by IPTG induction. After purification by Ni-NTA agarose beads, the soluble fractions of the fusion protein were collected and identified by SDS-PAGE and Western blotting. The fusion of S2ED with Hela cell membranes was observed with fluorescent microscope. The pET-14b-S2ED-EGFP plasmid was correctly constructed and highly expressed in BL21 (DE3). When incubated with Hela cells, the purified protein could not internalize through membrane fusion. The expression plasmid containing S2ED of SARS-Cov S protein and EGFP sequence is constructed successfully. Although the recombinant protein obtained has not shown the expected fusion effect with Hela cell membrane, this work may enrich the understanding of the process of membrane fusion mediated by S2 protein and lay the foundation for future study of targeting cell transport system based on cell-specific binding peptide.

  14. Albumin modulates S1P delivery from red blood cells in perfused microvessels: mechanism of the protein effect.

    Science.gov (United States)

    Adamson, R H; Clark, J F; Radeva, M; Kheirolomoom, A; Ferrara, K W; Curry, F E

    2014-04-01

    Removal of plasma proteins from perfusates increases vascular permeability. The common interpretation of the action of albumin is that it forms part of the permeability barrier by electrostatic binding to the endothelial glycocalyx. We tested the alternate hypothesis that removal of perfusate albumin in rat venular microvessels decreased the availability of sphingosine-1-phosphate (S1P), which is normally carried in plasma bound to albumin and lipoproteins and is required to maintain stable baseline endothelial barriers (Am J Physiol Heart Circ Physiol 303: H825-H834, 2012). Red blood cells (RBCs) are a primary source of S1P in the normal circulation. We compared apparent albumin permeability coefficients [solute permeability (Ps)] measured using perfusates containing albumin (10 mg/ml, control) and conditioned by 20-min exposure to rat RBCs with Ps when test perfusates were in RBC-conditioned protein-free Ringer solution. The control perfusate S1P concentration (439 ± 46 nM) was near the normal plasma value at 37 °C and established a stable baseline Ps (0.9 ± 0.4 × 10(-6) cm/s). Ringer solution perfusate contained 52 ± 8 nM S1P and increased Ps more than 10-fold (16.1 ± 3.9 × 10(-6) cm/s). Consistent with albumin-dependent transport of S1P from RBCs, S1P concentrations in RBC-conditioned solutions decreased as albumin concentration, hematocrit, and temperature decreased. Protein-free Ringer solution perfusates that used liposomes instead of RBCs as flow markers failed to maintain normal permeability, reproducing the "albumin effect" in these mammalian microvessels. We conclude that the albumin effect depends on the action of albumin to facilitate the release and transport of S1P from RBCs that normally provide a significant amount of S1P to the endothelium.

  15. GUN1 Controls Accumulation of the Plastid Ribosomal Protein S1 at the Protein Level and Interacts with Proteins Involved in Plastid Protein Homeostasis.

    Science.gov (United States)

    Tadini, Luca; Pesaresi, Paolo; Kleine, Tatjana; Rossi, Fabio; Guljamow, Arthur; Sommer, Frederik; Mühlhaus, Timo; Schroda, Michael; Masiero, Simona; Pribil, Mathias; Rothbart, Maxi; Hedtke, Boris; Grimm, Bernhard; Leister, Dario

    2016-03-01

    Developmental or metabolic changes in chloroplasts can have profound effects on the rest of the plant cell. Such intracellular responses are associated with signals that originate in chloroplasts and convey information on their physiological status to the nucleus, which leads to large-scale changes in gene expression (retrograde signaling). A screen designed to identify components of retrograde signaling resulted in the discovery of the so-called genomes uncoupled (gun) mutants. Genetic evidence suggests that the chloroplast protein GUN1 integrates signals derived from perturbations in plastid redox state, plastid gene expression, and tetrapyrrole biosynthesis (TPB) in Arabidopsis (Arabidopsis thaliana) seedlings, exerting biogenic control of chloroplast functions. However, the molecular mechanism by which GUN1 integrates retrograde signaling in the chloroplast is unclear. Here we show that GUN1 also operates in adult plants, contributing to operational control of chloroplasts. The gun1 mutation genetically interacts with mutations of genes for the chloroplast ribosomal proteins S1 (PRPS1) and L11. Analysis of gun1 prps1 lines indicates that GUN1 controls PRPS1 accumulation at the protein level. The GUN1 protein physically interacts with proteins involved in chloroplast protein homeostasis based on coimmunoprecipitation experiments. Furthermore, yeast two-hybrid and bimolecular fluorescence complementation experiments suggest that GUN1 might transiently interact with several TPB enzymes, including Mg-chelatase subunit D (CHLD) and two other TPB enzymes known to activate retrograde signaling. Moreover, the association of PRPS1 and CHLD with protein complexes is modulated by GUN1. These findings allow us to speculate that retrograde signaling might involve GUN1-dependent formation of protein complexes.

  16. Protein switches identified from diverse insertion libraries created using S1 nuclease digestion of supercoiled-form plasmid DNA.

    Science.gov (United States)

    Tullman, Jennifer; Guntas, Gurkan; Dumont, Matthew; Ostermeier, Marc

    2011-11-01

    We demonstrate that S1 nuclease converts supercoiled plasmid DNA to unit-length, linear dsDNA through the creation of a single, double-stranded break in a plasmid molecule. These double-stranded breaks occur not only in the origin of replication near inverted repeats but also at a wide variety of locations throughout the plasmid. S1 nuclease exhibits this activity under conditions typically employed for the nuclease's single-stranded nuclease activity. Thus, S1 nuclease digestion of plasmid DNA, unlike analogous digestion with DNaseI, effectively halts after the first double-stranded break. This property makes easier the construction of large domain insertion libraries in which the goal is to insert linear DNA at a variety of locations throughout a plasmid. We used this property to create a library in which a circularly permuted TEM1 β-lactamase gene was inserted throughout a plasmid containing the gene encoding Escherichia coli ribose binding protein. Gene fusions that encode allosteric switch proteins in which ribose modulates β-lactamase catalytic activity were isolated from this library using a combination of a genetic selection and a screen.

  17. Taxonomic distribution, repeats, and functions of the S1 domain-containing proteins as members of the OB-fold family.

    Science.gov (United States)

    Deryusheva, Evgeniia I; Machulin, Andrey V; Selivanova, Olga M; Galzitskaya, Oxana V

    2017-04-01

    Proteins of the nucleic acid-binding proteins superfamily perform such functions as processing, transport, storage, stretching, translation, and degradation of RNA. It is one of the 16 superfamilies containing the OB-fold in protein structures. Here, we have analyzed the superfamily of nucleic acid-binding proteins (the number of sequences exceeds 200,000) and obtained that this superfamily prevalently consists of proteins containing the cold shock DNA-binding domain (ca. 131,000 protein sequences). Proteins containing the S1 domain compose 57% from the cold shock DNA-binding domain family. Furthermore, we have found that the S1 domain was identified mainly in the bacterial proteins (ca. 83%) compared to the eukaryotic and archaeal proteins, which are available in the UniProt database. We have found that the number of multiple repeats of S1 domain in the S1 domain-containing proteins depends on the taxonomic affiliation. All archaeal proteins contain one copy of the S1 domain, while the number of repeats in the eukaryotic proteins varies between 1 and 15 and correlates with the protein size. In the bacterial proteins, the number of repeats is no more than 6, regardless of the protein size. The large variation of the repeat number of S1 domain as one of the structural variants of the OB-fold is a distinctive feature of S1 domain-containing proteins. Proteins from the other families and superfamilies have either one OB-fold or change slightly the repeat numbers. On the whole, it can be supposed that the repeat number is a vital for multifunctional activity of the S1 domain-containing proteins. Proteins 2017; 85:602-613. © 2016 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  18. Target Identification in Ory S1 Pollen Protein Allergen from Oryza sativa in the Course of Construction of Hypoallergenic Vaccines

    Directory of Open Access Journals (Sweden)

    Ruchi Sharma

    2009-01-01

    Full Text Available Problem statement: Recombinant-based approaches are mostly focused on genetic modification of allergens to produce molecules with reduced allergenic activity and conserved antigenicity, such as hypoallergens. Recombinant allergens represent promising tools for diagnosis and therapy of type I allergy. This approach was probably feasible with every allergen with known amino acid sequence. Approach: The primary aim of this study was to determine the consensus epitope from twenty homologous protein sequences of Ory S1 allergenic protein sequence from Oryza sativa (indica group pollen. Molecular modeling calculations had been used to investigate the allergenic protein models for the epitope. Results: Oryza sativa (japonica, Phleum pratense, Poa pratensis, Holcus lanatus, Lolium perenne, Triticum aestivum, Dactylis glomerata and Zea mays were found more closely related (alignment score 1145-812 among all the homologs and investigated further. The major binding pocket comprised an area of 604.5 Å2 and 970 Å3 volume and another key binding pocket had 425.6 Ų area and 658.8 ų volume. The residues found in the key site included ile2, lys13, cys14, ser15, lys16, pro17, ala25, leu26, ile27, tyr40, his41, phe42, asp43, leu44, ser45, gly46, leu47, ala48, met49, ala50, asp55, leu58, arg59, ala61, gly62, ile63, ile64, asp65, gln67, phe68; corresponding to the allergen binding site and the IgE binding epitope given in the title. Conclusion: These are the functional sites on the allergenic proteins that can be mutated to develop hypoallergenic vaccine. These sites can be rationalized on the basis of simple arguments that lead to vaccine development, by predicting the structure of the allergenic epitopes and comparative analysis.

  19. Verification of the interaction between ASGPR and HBV preS1 protein%ASGPR 与 HBV preS1蛋白之间相互作用的验证

    Institute of Scientific and Technical Information of China (English)

    张曦; 刘小静; 陈云茹; 孔颖; 杨雪亮; 叶峰; 蔺淑梅

    2016-01-01

    目的:验证去唾液酸糖蛋白受体(asialoglycoprotein receptor,ASGPR)与乙肝病毒前 S1蛋白(HBV preS1蛋白)之间的相互作用,确认 ASGPR 作为乙肝病毒肝细胞膜受体在介导乙肝病毒感染的分子机制中的作用。方法分别用哺乳动物双杂交及体外免疫共沉淀技术验证 ASGPR 与 HBV preS1蛋白之间的相互作用,操作方法参照试剂盒说明书进行。结果哺乳动物双杂交实验结果提示,ASGPR 与 HBV preS1蛋白在细胞环境中具有相互作用;免疫共沉淀实验结果提示,ASGPR 与 HBV preS1蛋白在非细胞环境中具有相互作用。结论ASGPR 可能是介导 HBV 入侵的肝细胞膜受体之一。%Objective To verify the interaction between asialoglycoprotein receptor (ASGPR)and hepatitis B virus (HBV)preS1 protein in vivo and in vitro ,and identify ASGPR as a cell-surface receptor for HBV,which could elucidate the molecular mechanism of HBV infection.Methods The preS1-ASGPR interaction was examined in mammalian two-hybrid and coimmunoprecipitation system by strictly following the manufacturer’s instructions.Results ASGPR interacted specifically and directly with the preS1 domain of HBV in vivo and in vitro .Conclusion ASGPR may be a candidate receptor for HBV that mediates further step of HBV entry.

  20. 酵母双杂交系统筛选HBV PreS1相互作用蛋白%Screening the hepatitis B virus PreS1 associated proteins in yeast two-hybrid system

    Institute of Scientific and Technical Information of China (English)

    叶峰; 张曦; 邸莹; 王小清; 刘小静; 孔颖; 赵英仁; 陈天艳; 刘敏

    2012-01-01

    Objective To screen the interacted protein hepatitis B virus (HBV) PreSl with human hepatocytes from normal human liver cDNA library by sos-recruitment system (SRS) and explore the mechanism of HBV endocylosis. Methods PCR was performed to amplify the gene of HBV PreSl from the plasmid PCP10/ HBV ayw subtype containing the whole fragment of HBV;the PCR product was cloned into yeast expression plasmid pSos. and reconstituted plasmid was tested by auto-sequencing assay and named pSos- PreSl. The pSos-PreSl fusion protein expressed in the yeast cells was confirmed by Western blot after pSos- PreSl was transfected into the yeast cell cdc25.Self-activation of the bait protein was determined by cotransformation of pSos- PreSl and pMyr-Lamin C, and the cytoplasmic localization of the bait protein was verified by cotransformation of pSos- PreSl and pMyr SB. Yeast cells co-transfected with pSos- PreSl and the normal human liver cDNA library grew in selective nutrition and temperature. The true positive clones were submitted for sequencing. The results were submitted to the BLAST notebook of NCBI to seek homologous sequence. Results The yeast expression vector of HBV PreSl gene was constructed successfully and its expression in yeast was verified. The recombinant bait plasmid did not have self-activation and toxicity to yeast cdc25H cells. Furthermore, the cytoplasmic localization of the bait protein was verified correctly. After yeast cells were co-transfected with pSos-PreSl and the normal human liver cDNA library, 5 clones were positive and showed high homology with KCMF1, cyt C, vitamin D binding protein, Homo sapiens albumin (ALB) and Homo sapiens asialoglycoprotein receptor (ASGPR). Conclusion We obtained 5 proteins which may interact with HBV PreSl protein by SRS. This is helpful for exploring the mechanism of HBV endocytosis.%目的 利用Sos招募系统(SRS),构建含HBV PreS1基因的酵母双杂交诱饵载体,筛选人肝细胞与HBV PreS1蛋白相互作用的

  1. Sialic Acid Binding Properties of Soluble Coronavirus Spike (S1 Proteins: Differences between Infectious Bronchitis Virus and Transmissible Gastroenteritis Virus

    Directory of Open Access Journals (Sweden)

    Christine Winter

    2013-07-01

    Full Text Available The spike proteins of a number of coronaviruses are able to bind to sialic acids present on the cell surface. The importance of this sialic acid binding ability during infection is, however, quite different. We compared the spike protein of transmissible gastroenteritis virus (TGEV and the spike protein of infectious bronchitis virus (IBV. Whereas sialic acid is the only receptor determinant known so far for IBV, TGEV requires interaction with its receptor aminopeptidase N to initiate infection of cells. Binding tests with soluble spike proteins carrying an IgG Fc-tag revealed pronounced differences between these two viral proteins. Binding of the IBV spike protein to host cells was in all experiments sialic acid dependent, whereas the soluble TGEV spike showed binding to APN but had no detectable sialic acid binding activity. Our results underline the different ways in which binding to sialoglycoconjugates is mediated by coronavirus spike proteins.

  2. In vitro and in vivo antagonism of a G protein-coupled receptor (S1P3 with a novel blocking monoclonal antibody.

    Directory of Open Access Journals (Sweden)

    Greg L Harris

    Full Text Available BACKGROUND: S1P(3 is a lipid-activated G protein-couple receptor (GPCR that has been implicated in the pathological processes of a number of diseases, including sepsis and cancer. Currently, there are no available high-affinity, subtype-selective drug compounds that can block activation of S1P(3. We have developed a monoclonal antibody (7H9 that specifically recognizes S1P(3 and acts as a functional antagonist. METHODOLOGY/PRINCIPAL FINDINGS: Specific binding of 7H9 was demonstrated by immunocytochemistry using cells that over-express individual members of the S1P receptor family. We show, in vitro, that 7H9 can inhibit the activation of S1P(3-mediated cellular processes, including arrestin translocation, receptor internalization, adenylate cyclase inhibiton, and calcium mobilization. We also demonstrate that 7H9 blocks activation of S1P(3 in vivo, 1 by preventing lethality due to systemic inflammation, and 2 by altering the progression of breast tumor xenografts. CONCLUSIONS/SIGNIFICANCE: We have developed the first-reported monoclonal antibody that selectively recognizes a lipid-activated GPCR and blocks functional activity. In addition to serving as a lead drug compound for the treatment of sepsis and breast cancer, it also provides proof of concept for the generation of novel GPCR-specific therapeutic antibodies.

  3. Small heat shock protein Hsp27 protects myosin S1 from heat-induced aggregation, but not from thermal denaturation and ATPase inactivation.

    Science.gov (United States)

    Markov, Denis I; Pivovarova, Anastasia V; Chernik, Ivan S; Gusev, Nikolai B; Levitsky, Dmitrii I

    2008-04-30

    We applied different methods, such as turbidity measurements, dynamic light scattering, differential scanning calorimetry and co-sedimentation assay, to analyze the interaction of small heat shock protein Hsp27 with isolated myosin head (myosin subfragment 1, S1) under heat-stress conditions. Upon heating at 43 degrees C, Hsp27 effectively suppresses S1 aggregation, and this effect is enhanced by mutations mimicking Hsp27 phosphorylation. However, Hsp27 was unable to prevent thermal unfolding of myosin heads and to maintain their ATPase activity under heat-shock conditions.

  4. Variations in the Regulatory Region of Alpha S1-Casein Milk Protein Gene among Tropically Adapted Indian Native (Bos Indicus) Cattle

    Science.gov (United States)

    Kishore, Amit; Mukesh, Manishi; Sobti, Ranbir C.; Mishra, Bishnu P.; Sodhi, Monika

    2013-01-01

    Regulatory region of milk protein alpha S1-casein (αS1-CN) gene was sequenced, characterized, and analyzed to detect variations among 13 Indian cattle (Bos indicus) breeds. Comparative analysis of 1,587 bp region comprising promoter (1,418 bp), exon-I (53 bp), and partial intron-I (116 bp) revealed 35 nucleotide substitutions (32 within promoter region, 1 in exon-I, and 2 in partial intron-I region) and 4 Indels. Within promoter, 15 variations at positions −1399 (A > G), −1288 (G > A), −1259 (T > C), −1158 (T > C), −1016 (A > T), −941 (T > G), −778 (C > T), −610 (G > A), −536 (A > G), −521 (A > G), −330 (A > C), −214 (A > G), −205 (A > T), −206 (C > A), and −175 (A > G) were located within the potential transcription factor binding sites (TFBSs), namely, NF-κE1/c-Myc, GATA-1, GATA-1/NF-E, Oct-1/POU3F2, MEF-2/YY1, GATA-1, AP-1, POU1F1a/GR, TMF, GAL4, YY1/Oct-1, HNF-1, GRalpha/AR, GRalpha/AR, and AP-1, respectively. Seventy-four percent (26/35) of the observed SNPs were novel to Indian cattle and 11 of these novel SNPs were located within one or more TFBSs. Collectively, these might influence the binding affinity towards their respective nuclear TFs thus modulating the level of transcripts in milk and affecting overall protein composition. The study provides information on several distinct variations across indicine and taurine αS1-CN regulatory domains. PMID:25937984

  5. A single missense mutation in a coiled-coil domain of Escherichia coli ribosomal protein S2 confers a thermosensitive phenotype that can be suppressed by ribosomal protein S1.

    Science.gov (United States)

    Aseev, Leonid V; Chugunov, Anton O; Efremov, Roman G; Boni, Irina V

    2013-01-01

    Ribosomal protein S2 is an essential component of translation machinery, and its viable mutated variants conferring distinct phenotypes serve as a valuable tool in studying the role of S2 in translation regulation. One of a few available rpsB mutants, rpsB1, shows thermosensitivity and ensures enhanced expression of leaderless mRNAs. In this study, we identified the nature of the rpsB1 mutation. Sequencing of the rpsB1 allele revealed a G-to-A transition in the part of the rpsB gene which encodes a coiled-coil domain of S2. The resulting E132K substitution resides in a highly conserved site, TKKE, a so-called N-terminal capping box, at the beginning of the second alpha helix. The protruding coiled-coil domain of S2 is known to provide binding with 16S rRNA in the head of the 30S subunit and, in addition, to interact with a key mRNA binding protein, S1. Molecular dynamics simulations revealed a detrimental impact of the E132K mutation on the coiled-coil structure and thereby on the interactions between S2 and 16S rRNA, providing a clue for the thermosensitivity of the rpsB1 mutant. Using a strain producing a leaderless lacZ transcript from the chromosomal lac promoter, we demonstrated that not only the rpsB1 mutation generating S2/S1-deficient ribosomes but also the rpsA::IS10 mutation leading to partial deficiency in S1 alone increased translation efficiency of the leaderless mRNA by about 10-fold. Moderate overexpression of S1 relieved all these effects and, moreover, suppressed the thermosensitive phenotype of rpsB1, indicating the role of S1 as an extragenic suppressor of the E132K mutation.

  6. Proteomic characterization of the small subunit of Chlamydomonas reinhardtii chloroplast ribosome: identification of a novel S1 domain-containing protein and unusually large orthologs of bacterial S2, S3, and S5.

    Science.gov (United States)

    Yamaguchi, Kenichi; Prieto, Susana; Beligni, María Verónica; Haynes, Paul A; McDonald, W Hayes; Yates, John R; Mayfield, Stephen P

    2002-11-01

    To understand how chloroplast mRNAs are translated into functional proteins, a detailed understanding of all of the components of chloroplast translation is needed. To this end, we performed a proteomic analysis of the plastid ribosomal proteins in the small subunit of the chloroplast ribosome from the green alga Chlamydomonas reinhardtii. Twenty proteins were identified, including orthologs of Escherichia coli S1, S2, S3, S4, S5, S6, S7, S9, S10, S12, S13, S14, S15, S16, S17, S18, S19, S20, and S21 and a homolog of spinach plastid-specific ribosomal protein-3 (PSRP-3). In addition, a novel S1 domain-containing protein, PSRP-7, was identified. Among the identified proteins, S2 (57 kD), S3 (76 kD), and S5 (84 kD) are prominently larger than their E. coli or spinach counterparts, containing N-terminal extensions (S2 and S5) or insertion sequence (S3). Structural predictions based on the crystal structure of the bacterial 30S subunit suggest that the additional domains of S2, S3, and S5 are located adjacent to each other on the solvent side near the binding site of the S1 protein. These additional domains may interact with the S1 protein and PSRP-7 to function in aspects of mRNA recognition and translation initiation that are unique to the Chlamydomonas chloroplast.

  7. Rearrangements of mycoreovirus 1 S1, S2 and S3 induced by the multifunctional protein p29 encoded by the prototypic hypovirus Cryphonectria hypovirus 1 strain EP713.

    Science.gov (United States)

    Tanaka, Toru; Sun, Liying; Tsutani, Kouhei; Suzuki, Nobuhiro

    2011-08-01

    Mycoreovirus 1 (MyRV1), a member of the family Reoviridae possessing a genome consisting of 11 dsRNA segments (S1-S11), infects the chestnut blight fungus and reduces its virulence (hypovirulence). Studies have previously demonstrated reproducible induction of intragenic rearrangements of MyRV1 S6 (S6L: almost full-length duplication) and S10 (S10ss: internal deletion of three-quarters of the ORF), mediated by the multifunctional protein p29 encoded by the prototype hypovirus, Cryphonectria hypovirus 1 (CHV1) strain EP713, of the family Hypoviridae with ssRNA genomes. The current study showed that CHV1 p29 also induced rearrangements of the three largest MyRV1 segments, S1, S2 and S3, which encode structural proteins. These rearranged segments involved in-frame extensions of almost two-thirds of the ORFs (S1L, S2L and S3L, respectively), which is rare for a reovirus rearrangement. MyRV1 variants carrying S1L, S2L or S3L always contained S10ss (MyRV1/S1L+S10ss2, MyRV1/S2L+S10ss2 or MyRV1/S3L+S10ss2). Levels of mRNAs for the rearranged and co-existing unaltered genome segments in fungal colonies infected with each of the MyRV1 variants appeared to be comparable to those for the corresponding normal segments in wild-type MyRV1-infected colonies, suggesting that the rearranged segments were fully competent for packaging and transcription. Protein products of the rearranged segments were detectable in fungal colonies infected with S2L MyRV1/S2L+S10ss2 and S3L MyRV1/S3L+S10ss2, whilst S1L-encoded protein remained undetectable. S1L, S2L and S3L were associated with enhancement of the aerial hyphae growth rate. This study has provided additional examples of MyRV1 intragenic rearrangements induced by p29, and suggests that normal S1, S2 and S3 are required for the symptoms caused by MyRV1.

  8. A novel chimeric Hepatitis B virus S/preS1 antigen produced in mammalian and plant cells elicits stronger humoral and cellular immune response than the standard vaccine-constituent, S protein.

    Science.gov (United States)

    Dobrica, Mihaela-Olivia; Lazar, Catalin; Paruch, Lisa; Skomedal, Hanne; Steen, Hege; Haugslien, Sissel; Tucureanu, Catalin; Caras, Iuliana; Onu, Adrian; Ciulean, Sonya; Branzan, Alexandru; Clarke, Jihong Liu; Stavaru, Crina; Branza-Nichita, Norica

    2017-08-01

    Chronic Hepatitis B Virus (HBV) infection leads to severe liver pathogenesis associated with significant morbidity and mortality. As no curable medication is yet available, vaccination remains the most cost-effective approach to limit HBV spreading and control the infection. Although safe and efficient, the standard vaccine based on production of the small (S) envelope protein in yeast fails to elicit an effective immune response in about 10% of vaccinated individuals, which are at risk of infection. One strategy to address this issue is the development of more immunogenic antigens. Here we describe a novel HBV antigen obtained by combining relevant immunogenic determinants of S and large (L) envelope proteins. Our approach was based on the insertion of residues 21-47 of the preS1 domain of the L protein (nomenclature according to genotype D), involved in virus attachment to hepatocytes, within the external antigenic loop of S. The resulting S/preS1(21-47) chimera was successfully produced in HEK293T and Nicotiana benthamiana plants, as a more economical recombinant protein production platform. Comparative biochemical, functional and electron microscopy analysis indicated assembly of the novel antigen into subviral particles in mammalian and plant cells. Importantly, these particles preserve both S- and preS1-specific epitopes and elicit significantly stronger humoral and cellular immune responses than the S protein, in both expression systems used. Our data promote this antigen as a promising vaccine candidate to overcome poor responsiveness to the conventional, S protein-based, HBV vaccine. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Two novel neutralizing antigenic epitopes of the s1 subunit protein of a QX-like avian infectious bronchitis virus strain Sczy3 as revealed using a phage display peptide library.

    Science.gov (United States)

    Zou, Nianli; Xia, Jing; Wang, Fuyan; Duan, Zhenzhen; Miao, Dan; Yan, Qigui; Cao, Sanjie; Wen, Xintian; Liu, Ping; Huang, Yong

    2015-11-15

    The spike (S) protein of the infectious bronchitis virus (IBV) plays a central role in the pathogenicity, the immune antibody production, serotype and the tissue tropism. In this study, we generate 11 monoclonal antibodies (mAbs) against S1 subunit of IBV Sczy3 strain, and two mAbs 1D5 and 6A12 were positive in indirect ELISA against both His-S1 protein and the purified whole viral antigen. MAb 6A12 and 1D5 could recognized by other 10 IBV strains (IBVs) from five different genotypes, except that 1D5 had a relatively low reaction with two of the 10 tested IBVs. End-point neutralizing assay performed in chicken embro kidney (CEK) cells revealed that the neutralization titer of 6A12 and 1D5 against Sczy3 reached 1:44.7 and 1:40.6, respectively. After screening a phage display peptide library and peptide scanning, we identified two linear B-cell epitopes that were recognized by the mAbs 1D5 and 6A12, which corresponded to the amino acid sequences (87)PPQGMAW(93) and (412)IQTRTEP(418), respectively, in the IBV S1 subunit. Sequences comparison revealed that epitope (412)IQTRTEP(418) was conserved among IBVs, while the epitope (87)PPQGMAW(93) was relatively variable among IBVs. The novel mAbs and the epitopes identified will be useful for developing diagnostic assays for IBV infections.

  10. Screening of proteins interacting with the Hepatitis B Virus PreS1 protein from T7-Phage display library%用T7噬菌体展示技术筛选乙型肝炎病毒PreS1相互作用蛋白

    Institute of Scientific and Technical Information of China (English)

    黄英; 张君; 何茂锐; 陈维贤; 黄爱龙

    2007-01-01

    目的:用T7噬菌体筛选系统筛选乙型肝炎病毒PreS1的相互作用蛋白.方法:应用T7噬菌体展示技术,以通过原核表达的方式得到的乙型肝炎病毒PreS1作为靶分子,对噬菌体人肝细胞cDNA文库进行生物筛选,对筛选到的克隆进行DNA序列分析及同源性搜索.结果:经鉴定得到1个阳性克隆,确定了能与乙型肝炎病毒PreS1相互作用的蛋白可能为:细胞色素C氧化酶1(Cytochrome c Oxidase Subunit Ⅰ,COX1).结论:T7噬菌体展示筛选系统是筛选相互作用蛋白的一种简单、快速和有效的手段,筛选到的相互作用蛋白为进一步探讨PreSI的致病机制提供重要依据.

  11. Main: S1FBOXSORPS1L21 [PLACE

    Lifescience Database Archive (English)

    Full Text Available S1FBOXSORPS1L21 S000223 10-May-1998 (last modified) kehi S1F box conserved both in ...e element; Might play a role in downregulating RPS1 and RPL21 promoter activity (Lagrange et al., 1993); See S000211 (SITE1SOR...PS1), S000215 (S1FSORPL21); S1F; S1F box; S1F-box; S1; plastid protein; RPS1; RPL21; leaf; negative; spinach (Spinacia oleracea) ATGGTA ...

  12. Main: O2F2BE2S1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available coxin, the maize b-32 genes and the AP-1 pseudopalindrome; O2; opaque-2; be2S1; seed; Brazil nut tree (Bertholletia excelsa) GCCACCTCAT ... ...O2F2BE2S1 S000163 17-May-1998 (last modified) kehi opaque-2 recognition site F2 in Bertholletia excelsa (Bra...zil nut tree) 2S storage protein gene (be2S1); O2 protein binds to F1, F2 and F3 se

  13. Targeting sphingosine 1-phosphate (S1P) levels and S1P receptor functions for therapeutic immune interventions.

    Science.gov (United States)

    Gräler, Markus H

    2010-01-01

    Sphingosine 1-phosphate (S1P) is an important regulator of many different immune functions including lymphocyte circulation, antigen presentation, and T cell development. It stimulates five G protein-coupled receptors designated S1P(1-5), which are also expressed by immune cells. S1P receptors couple to different heterotrimeric G proteins including G alpha i, q, and 12/13, and elicit cellular signalling events by activating the small GTPases Rac and Rho and protein kinases Akt, ERK, and JNK, and by inducing cellular calcium flux and inhibiting cAMP accumulation, amongst others. S1P is the exit signal for lymphocytes leaving lymphoid organs and present in blood and lymph at high nanomolar concentrations due to the S1P-producing activity of sphingosine kinases (SK). The S1P-degrading enzyme S1P-lyase maintains low amounts of S1P in lymphoid organs. Disrupting this concentration difference by S1P receptor agonists and antagonists like FTY720, SEW2871, and VPC23019, by an anti-S1P antibody, or by inhibiting the S1P-lyase has therapeutic potential for autoimmune diseases like multiple sclerosis (MS) and rheumatoid arthritis and for many other disorders like cancer, fibrosis, inflammation, macular degeneration, diabetic retinopathy, and glaucoma. This report aims to provide a brief overview of concepts, approaches, pharmaceutical compounds, and targets that are currently used to modulate S1P-driven immune functions.

  14. Main: O2F3BE2S1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available quences of be2S1 promoter; F3 is hybrid of A/G box; O2; opaque-2; be2S1; seed; Brazil nut tree (Bertholletia excelsa) TCCACGTACT ... ...O2F3BE2S1 S000164 17-May-1998 (last modified) kehi opaque-2 recognition site F3 in Bertholletia excelsa (Bra...zil nut tree) 2S storage protein gene (be2S1); O2 protein binds to F1, F2 and F3 se

  15. Main: O2F1BE2S1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available quences of be2S1 promoter; F1 is hybrid C/G box; O2; opaque-2; be2S1; F1; seed; Brazil nut tree (Bertholletia excelsa); TCCACGTCGA ... ...O2F1BE2S1 S000162 17-May-1998 (last modified) kehi opaque-2 recognition site F1 in Bertholletia excelsa (Bra...zil nut tree) 2S storage protein gene (be2S1); O2 protein binds to F1, F2 and F3 se

  16. S1P in HDL promotes interaction between SR-BI and S1PR1 and activates S1PR1-mediated biological functions: calcium flux and S1PR1 internalization.

    Science.gov (United States)

    Lee, Mi-Hye; Appleton, Kathryn M; El-Shewy, Hesham M; Sorci-Thomas, Mary G; Thomas, Michael J; Lopes-Virella, Maria F; Luttrell, Louis M; Hammad, Samar M; Klein, Richard L

    2017-02-01

    HDL normally transports about 50-70% of plasma sphingosine 1-phosphate (S1P), and the S1P in HDL reportedly mediates several HDL-associated biological effects and signaling pathways. The HDL receptor, SR-BI, as well as the cell surface receptors for S1P (S1PRs) may be involved partially and/or completely in these HDL-induced processes. Here we investigate the nature of the HDL-stimulated interaction between the HDL receptor, SR-BI, and S1PR1 using a protein-fragment complementation assay and confocal microscopy. In both primary rat aortic vascular smooth muscle cells and HEK293 cells, the S1P content in HDL particles increased intracellular calcium concentration, which was mediated by S1PR1. Mechanistic studies performed in HEK293 cells showed that incubation of cells with HDL led to an increase in the physical interaction between the SR-BI and S1PR1 receptors that mainly occurred on the plasma membrane. Model recombinant HDL (rHDL) particles formed in vitro with S1P incorporated into the particle initiated the internalization of S1PR1, whereas rHDL without supplemented S1P did not, suggesting that S1P transported in HDL can selectively activate S1PR1. In conclusion, these data suggest that S1P in HDL stimulates the transient interaction between SR-BI and S1PRs that can activate S1PRs and induce an elevation in intracellular calcium concentration.

  17. Evolution of RLSB, a nuclear-encoded S1 domain RNA binding protein associated with post-transcriptional regulation of plastid-encoded rbcL mRNA in vascular plants.

    Science.gov (United States)

    Yerramsetty, Pradeep; Stata, Matt; Siford, Rebecca; Sage, Tammy L; Sage, Rowan F; Wong, Gane Ka-Shu; Albert, Victor A; Berry, James O

    2016-06-29

    RLSB, an S-1 domain RNA binding protein of Arabidopsis, selectively binds rbcL mRNA and co-localizes with Ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) within chloroplasts of C3 and C4 plants. Previous studies using both Arabidopsis (C3) and maize (C4) suggest RLSB homologs are post-transcriptional regulators of plastid-encoded rbcL mRNA. While RLSB accumulates in all Arabidopsis leaf chlorenchyma cells, in C4 leaves RLSB-like proteins accumulate only within Rubisco-containing bundle sheath chloroplasts of Kranz-type species, and only within central compartment chloroplasts in the single cell C4 plant Bienertia. Our recent evidence implicates this mRNA binding protein as a primary determinant of rbcL expression, cellular localization/compartmentalization, and photosynthetic function in all multicellular green plants. This study addresses the hypothesis that RLSB is a highly conserved Rubisco regulatory factor that occurs in the chloroplasts all higher plants. Phylogenetic analysis has identified RLSB orthologs and paralogs in all major plant groups, from ancient liverworts to recent angiosperms. RLSB homologs were also identified in algae of the division Charophyta, a lineage closely related to land plants. RLSB-like sequences were not identified in any other algae, suggesting that it may be specific to the evolutionary line leading to land plants. The RLSB family occurs in single copy across most angiosperms, although a few species with two copies were identified, seemingly randomly distributed throughout the various taxa, although perhaps correlating in some cases with known ancient whole genome duplications. Monocots of the order Poales (Poaceae and Cyperaceae) were found to contain two copies, designated here as RLSB-a and RLSB-b, with only RLSB-a implicated in the regulation of rbcL across the maize developmental gradient. Analysis of microsynteny in angiosperms revealed high levels of conservation across eudicot species and for both paralogs in

  18. Inhibition of skeletal muscle S1-myosin ATPase by peroxynitrite.

    Science.gov (United States)

    Tiago, Teresa; Simão, Sónia; Aureliano, Manuel; Martín-Romero, Francisco Javier; Gutiérrez-Merino, Carlos

    2006-03-21

    Exposure of myosin subfragment 1 (S1) to 3-morpholinosydnonimine (SIN-1) produced a time-dependent inhibition of the F-actin-stimulated S1 Mg(2+)-ATPase activity, reaching 50% inhibition with 46.7 +/- 8.3 microM SIN-1 for 8.7 microM S1, that is, at a SIN-1/S1 molar ratio of approximately 5.5. The inhibition was due to the peroxynitrite produced by SIN-1 decomposition because (1) decomposed SIN-1 was found to have no effect on S1 ATPase activity, (2) addition of SIN-1 in the presence of superoxide dismutase and catalase fully prevented inhibition by SIN-1, and (3) micromolar pulses of chemically synthesized peroxynitrite produced inhibition of F-actin-stimulated S1 Mg(2+)-ATPase activity. In parallel, SIN-1 produced the inhibition of the nonphysiological Ca(2+)-dependent and K(+)/EDTA-dependent S1 ATPase activity of S1 and, therefore, suggested that the inhibition of F-actin-stimulated S1 Mg(2+)-ATPase activity is produced by the oxidation of highly reactive cysteines of S1 (Cys(707) and Cys(697)), located close to the catalytic center. This point was further confirmed by the titration of S1 cysteines with 5,5'-dithiobis(2-nitrobenzoic acid) and by the parallel decrease of Cys(707) labeling by 5-(iodoacetamido)fluorescein, and it was reinforced by the fact that other common protein modifications produced by peroxynitrite, for example, protein carbonyl and nitrotyrosine formation, were barely detected at the concentrations of SIN-1 that produced more than 50% inhibition of the F-actin-stimulated S1 Mg(2+)-ATPase activity. Differential scanning calorimetry of S1 (untreated and treated with different SIN-1 concentrations) pointed out that SIN-1, at concentrations that generate micromolar peroxynitrite fluxes, impaired the ability of ADP.V(1) to induce the intermediate catalytic transition state and also produced the partial unfolding of S1 that leads to an enhanced susceptibility of S1 to trypsin digestion, which can be fully protected by 2 mM GSH.

  19. Main: S1FSORPL21 [PLACE

    Lifescience Database Archive (English)

    Full Text Available S1FSORPL21 S000215 19-August-2004 (last modified) kehi S1F binding site (S1 site) i...in downregulating RPL21 promoter activity (Lagrange et al., 1993); See S000211 (SITE1SORPS1), S000166 (S2FSOR

  20. Sphingosine 1 Phosphate (S1P) Receptors 1 and 2 Coordinately Induce Osteoblast Migration Through S1P Activation of Complementary Kinase Pathways

    DEFF Research Database (Denmark)

    Quint, Patrick; Ruan, Ming; Pederson, Larry

    2013-01-01

    to sites of bone resorption as an initial step in replacing lost bone. In this study we investigated the mechanisms by which S1P stimulates mesenchymal (skeletal) stem cell (MSC) chemotaxis. S1P treatment of MSC activated RhoA GTPase, but this small G protein did not contribute to migration. Rather, two S1...... metabolism, it is crucial to determine the mechanisms by which osteoclasts and osteoblast precursors interact and contribute to coupling. We showed osteoclasts produce the chemokine sphingosine 1 phosphate (S1P), which stimulates osteoblast migration. Thus, osteoclast-derived S1P may recruit osteoblasts...

  1. Tumor necrosis factor (TNF) receptor-associated factor (TRAF)-interacting protein (TRIP) negatively regulates the TRAF2 ubiquitin-dependent pathway by suppressing the TRAF2-sphingosine 1-phosphate (S1P) interaction.

    Science.gov (United States)

    Park, Eui-Soon; Choi, Seunga; Shin, Bongjin; Yu, Jungeun; Yu, Jiyeon; Hwang, Jung-Me; Yun, Hyeongseok; Chung, Young-Ho; Choi, Jong-Soon; Choi, Yongwon; Rho, Jaerang

    2015-04-10

    The signaling pathway downstream of TNF receptor (TNFR) is involved in the induction of a wide range of cellular processes, including cell proliferation, activation, differentiation, and apoptosis. TNFR-associated factor 2 (TRAF2) is a key adaptor molecule in TNFR signaling complexes that promotes downstream signaling cascades, such as nuclear factor-κB (NF-κB) and mitogen-activated protein kinase activation. TRAF-interacting protein (TRIP) is a known cellular binding partner of TRAF2 and inhibits TNF-induced NF-κB activation. Recent findings that TRIP plays a multifunctional role in antiviral response, cell proliferation, apoptosis, and embryonic development have increased our interest in exploring how TRIP can affect the TNFR-signaling pathway on a molecular level. In our current study, we demonstrated that TRIP is negatively involved in the TNF-induced inflammatory response through the down-regulation of proinflammatory cytokine production. Here, we demonstrated that the TRAF2-TRIP interaction inhibits Lys(63)-linked TRAF2 ubiquitination by inhibiting TRAF2 E3 ubiquitin (Ub) ligase activity. The TRAF2-TRIP interaction inhibited the binding of sphingosine 1-phosphate, which is a cofactor of TRAF2 E3 Ub ligase, to the TRAF2 RING domain. Finally, we demonstrated that TRIP functions as a negative regulator of proinflammatory cytokine production by inhibiting TNF-induced NF-κB activation. These results indicate that TRIP is an important cellular regulator of the TNF-induced inflammatory response.

  2. Identification of benzoxazole analogs as novel, S1P(3) sparing S1P(1) agonists.

    Science.gov (United States)

    Deng, Guanghui; Meng, Qinghua; Liu, Qian; Xu, Xuesong; Xu, Qiongfeng; Ren, Feng; Guo, Taylor B; Lu, Hongtao; Xiang, Jia-Ning; Elliott, John D; Lin, Xichen

    2012-06-15

    A novel series of benzoxazole-derived S1P(1) agonists were designed based on scaffold hopping molecular design strategy combined with computational approaches. Extensive SAR studies led to the discovery of compound 17d as a selective S1P(1) agonist (over S1P(3)) with high CNS penetration and favorable DMPK properties. 17d also demonstrated in vivo pharmacological efficacy to reduce blood lymphocyte in mice after oral administration.

  3. Functional analysis of NifS1 in procyclic \\kur{Trypanosoma brucei}

    OpenAIRE

    Poliak, Pavel

    2008-01-01

    Aim of this work was to identify the function of NifS-like protein in Trypanosoma brucei that seems to belong to selenocysteine lyases. I have shown by RNA interference that it is not essential for procyclic stages. Moreover, by taging the protein, NifS1 was localized to the cytoplasm. Measurement of selenocysteine lyase activities in wild type cells and cells with eliminated NifS1 protein are under way.

  4. Restless legs syndrome mimicking S1 radiculopathy.

    Science.gov (United States)

    Zambelis, Th; Wolgamuth, B R; Papoutsi, S N; Economou, N T

    2016-01-01

    Α case of a chronic idiopathic form of a severe type of Restless Legs Syndrome (RLS), which developed during pregnancy and persisted after this, misdiagnosed for 34 years as radiculopathy S1, is reported. In spite of the thorough clinical and laboratory investigation, in addition to constant changes of the therapeutic approach, the diagnosis of S1 radiculopathy could not be confirmed, resulting in a chronic clinical course; the latter was characterized by relapses and remissions not attributed or linked in any way to the treatment (various types of). In fact, it was due to a routine workup in a sleep clinic, where the patient was referred because of a coincident chronic insomnia (Restless Legs Syndrome is a known and important cause of insomnia/chronic insomnia), which resulted in a proper diagnosis and treatment of this case. With the use of Restless Legs Syndrome appropriate treatment (Pramipexole 0.18 mg taken at bedtime, a dopaminergic agent and Level A recommended drug for Restless Legs Syndrome) an excellent response and immediate elimination of symptoms was achieved. Restless Legs Syndrome may present with a variety of symptoms (with the most prominent shortly being reported with the acronym URGE: Urge to move the legs usually associated with unpleasant leg sensations, Rest induces symptoms, Getting active brings relief, Evening and night deteriorate symptoms); given the fact that Restless Legs Syndrome presents with a great variety and heterogeneity of symptoms (mostly pain, dysesthesia and paresthesia), which may occur in several other diseases (the so called "RLS mimics"), proper diagnosis of Restless Legs Syndrome usually fails. Restless Legs Syndrome misinterpreted as S1 radiculopathy, to the best of our knowledge, has not been reported yet in the literature. Here, case history, clinical course and common RLS mimics are presented. Different forms of Restless Legs Syndrome manifestations, which are commonly -as in this case- misinterpreted due to their

  5. Effect of alphas1-casein ( CSN1S1) genotype on milk CSN1S1 content in Malagueña and Murciano-Granadina goats.

    Science.gov (United States)

    Caravaca, Francisco; Amills, Marcel; Jordana, Jordi; Angiolillo, Antonella; Agüera, Pastora; Aranda, Cristina; Menéndez-Buxadera, Alberto; Sánchez, Alfonso; Carrizosa, Juan; Urrutia, Baltasar; Sànchez, Armand; Serradilla, Juan Manuel

    2008-11-01

    There is substantial evidence showing that the polymorphism of the goat alphas1-casein (CSN1S1) gene has a major effect on milk protein, casein and fat content as well as on cheese yield. However, its influence on the synthesis rate of CSN1S1 has been less studied, with measurements only available in French breeds. In this article, we have measured milk CSN1S1 content in 89 Malagueña and 138 Murciano-Granadina goats with 305 and 460 phenotypic registers, respectively. In the Malagueña breed, average values of CSN1S1 content estimated for BB, BF, EE and FF genotypes were 6.94+/-0.38, 5.36+/-0.22, 4.58+/-0.13 and 3.98+/-0.27 g/l, respectively, being all significantly different (Pgene polymorphism on the synthesis rate of the corresponding protein.

  6. Integrable KdV Hierarchies on $T^2=S^1\\times S^1$

    CERN Document Server

    Sedra, M B

    2007-01-01

    Following our previous works on extended higher spin symmetries on the torus we focus in the present contribution to make a setup of the integrable KdV hierarchies on $T^{2} = S^{1} \\times S^{1}$. Actually two particular systems are considered, namely the KdV and the Burgers non linear integrable model associated to currents of conformal weights (2, 2) and (1, 1) respectively. One key steps towards proving the integrability of these systems is to find their Lax pair operators. This is explicitly done and a mapping between the two systems is discussed.

  7. MANAJEMEN PEMBELAJARAN S1 KEPERAWATAN STIKES YOGYAKARTA

    Directory of Open Access Journals (Sweden)

    Teti Indriati Kastuti

    2014-10-01

    Full Text Available Penelitian ini bertujuan untuk mendeskripsikan manajemen pembelajaran dilihat dari segi pe-rencanaan, pelaksanaan, dan evaluasi kurikulum di S1 Keperawatan STIKES Yogyakarta. Penelitian ini merupakan penelitian deskriptif dengan pendekatan kualitatif. Subjek penelitian adalah Pembantu Ketua I, III, dosen, kepala bagain akademik, perpustakaan, laboratorium, dan mahasiswa. Data peneli-tian dikumpulkan melalui wawancara, observasi, dan studi dokumentasi. Dianalisis secara kualitatif dengan menggunakan teknik analisis interaktif model Miles dan Huberman. Hasil penelitian bahwa perencanaan pembelajaran: 1 rumusan kompetensi pendukung dan lainnya tidak terjabarkan dalam elemen kompetensi; 2 proses pembelajaran memerlukan team teaching. Pelaksanaan pembelajaran: 1 pembinaan motivasi belajar mahasiswa masih ada dosen yang mengajar berdasarkan mood; 2 bahan ajar dimanfaatkan dengan baik untuk mencapai tujuan instruksional pembelajaran; 3 bimbing-an dan konseling pada saat pengisian KRS; 4 masih ada dosen yang mengganti jadwal. Evaluasi pembelajaran: 1 penamaan mata kuliah IKD 1 dan 2, yang menunjukkan prerequisite, kenyataannya tidak berhubungan; 2 evaluasi dosen  sebatas pelaksanaan administratif. Kata kunci: manajemen, kurikulum, pembelajaran, keperawatan

  8. Expression and purification of the Bordella Pertussis toxin S1 subunit mutant in Escherichia coli

    Institute of Scientific and Technical Information of China (English)

    Xiao L. Zhang; Quan M. Zou

    2007-01-01

    Bordella pertussis is the causative agent of whooping cough.Traditional vaccines against this disease are inherently reactogenic, thus research is currentlly focussed on the production of less reactive,acellular vaccines.Expression of candidate antigens for these vaccines in Escherichia coli would be preferable. Pertussis toxin S1 subunit plays a critical role in the bacterium-host interplay.The mutant(rS1) containing two key amino acids substitution(Arg9-Lys/Glu129-Gly)is nontoxin and immunogenic and while retaining the protective epitopes. In this study, the immunoprotective S1 fragment of pertussis toxin fusion was verified by restriction endonuclease analysis and Western immunoblotting. Escherichia coli carrying the recombinant plasmid(pQE-rS1)produced a 26 kDa protein that was recognized by antibodies specific to the S1. Expressed rS1 in E. coli was purified from the inclusion bodies. The N-terminal 6 histidines could easily be captured by Ni-NTA affinity chromatography. Then, the rS1 of interest was purified to 92% homogeneity. Antisera generated against the purified S1 mutant protein recognized the native toxin indicating that some, if not all, of the native epitope were conserved. Thus, this vaccine preparation is potentially applicable for the production of novel vaccines against B. pertussis infection.

  9. Complete genome sequence of Rhodospirillum rubrum type strain (S1).

    Science.gov (United States)

    Munk, A Christine; Copeland, Alex; Lucas, Susan; Lapidus, Alla; Del Rio, Tijana Glavina; Barry, Kerrie; Detter, John C; Hammon, Nancy; Israni, Sanjay; Pitluck, Sam; Brettin, Thomas; Bruce, David; Han, Cliff; Tapia, Roxanne; Gilna, Paul; Schmutz, Jeremy; Larimer, Frank; Land, Miriam; Kyrpides, Nikos C; Mavromatis, Konstantinos; Richardson, Paul; Rohde, Manfred; Göker, Markus; Klenk, Hans-Peter; Zhang, Yaoping; Roberts, Gary P; Reslewic, Susan; Schwartz, David C

    2011-07-01

    Rhodospirillum rubrum (Esmarch 1887) Molisch 1907 is the type species of the genus Rhodospirillum, which is the type genus of the family Rhodospirillaceae in the class Alphaproteobacteria. The species is of special interest because it is an anoxygenic phototroph that produces extracellular elemental sulfur (instead of oxygen) while harvesting light. It contains one of the most simple photosynthetic systems currently known, lacking light harvesting complex 2. Strain S1(T) can grow on carbon monoxide as sole energy source. With currently over 1,750 PubMed entries, R. rubrum is one of the most intensively studied microbial species, in particular for physiological and genetic studies. Next to R. centenum strain SW, the genome sequence of strain S1(T) is only the second genome of a member of the genus Rhodospirillum to be published, but the first type strain genome from the genus. The 4,352,825 bp long chromosome and 53,732 bp plasmid with a total of 3,850 protein-coding and 83 RNA genes were sequenced as part of the DOE Joint Genome Institute Program DOEM 2002.

  10. Edg8/S1P5: an oligodendroglial receptor with dual function on process retraction and cell survival.

    Science.gov (United States)

    Jaillard, C; Harrison, S; Stankoff, B; Aigrot, M S; Calver, A R; Duddy, G; Walsh, F S; Pangalos, M N; Arimura, N; Kaibuchi, K; Zalc, B; Lubetzki, C

    2005-02-09

    Endothelial differentiation gene (Edg) proteins are G-protein-coupled receptors activated by lysophospholipid mediators: sphingosine-1-phosphate (S1P) or lysophosphatidic acid. We show that in the CNS, expression of Edg8/S1P5, a high-affinity S1P receptor, is restricted to oligodendrocytes and expressed throughout development from the immature stages to the mature myelin-forming cell. S1P activation of Edg8/S1P5 on O4-positive pre-oligodendrocytes induced process retraction via a Rho kinase/collapsin response-mediated protein signaling pathway, whereas no retraction was elicited by S1P on these cells derived from Edg8/S1P5-deficient mice. Edg8/S1P5-mediated process retraction was restricted to immature cells and was no longer observed at later developmental stages. In contrast, S1P activation promoted the survival of mature oligodendrocytes but not of pre-oligodendrocytes. The S1P-induced survival of mature oligodendrocytes was mediated through a pertussis toxin-sensitive, Akt-dependent pathway. Our data demonstrate that Edg8/S1P5 activation on oligodendroglial cells modulates two distinct functional pathways mediating either process retraction or cell survival and that these effects depend on the developmental stage of the cell.

  11. Exogenous S1P Exposure Potentiates Ischemic Stroke Damage That Is Reduced Possibly by Inhibiting S1P Receptor Signaling.

    Science.gov (United States)

    Moon, Eunjung; Han, Jeong Eun; Jeon, Sejin; Ryu, Jong Hoon; Choi, Ji Woong; Chun, Jerold

    2015-01-01

    Initial and recurrent stroke produces central nervous system (CNS) damage, involving neuroinflammation. Receptor-mediated S1P signaling can influence neuroinflammation and has been implicated in cerebral ischemia through effects on the immune system. However, S1P-mediated events also occur within the brain itself where its roles during stroke have been less well studied. Here we investigated the involvement of S1P signaling in initial and recurrent stroke by using a transient middle cerebral artery occlusion/reperfusion (M/R) model combined with analyses of S1P signaling. Gene expression for S1P receptors and involved enzymes was altered during M/R, supporting changes in S1P signaling. Direct S1P microinjection into the normal CNS induced neuroglial activation, implicating S1P-initiated neuroinflammatory responses that resembled CNS changes seen during initial M/R challenge. Moreover, S1P microinjection combined with M/R potentiated brain damage, approximating a model for recurrent stroke dependent on S1P and suggesting that reduction in S1P signaling could ameliorate stroke damage. Delivery of FTY720 that removes S1P signaling with chronic exposure reduced damage in both initial and S1P-potentiated M/R-challenged brain, while reducing stroke markers like TNF-α. These results implicate direct S1P CNS signaling in the etiology of initial and recurrent stroke that can be therapeutically accessed by S1P modulators acting within the brain.

  12. Blocking S1P interaction with S1P{sub 1} receptor by a novel competitive S1P{sub 1}-selective antagonist inhibits angiogenesis

    Energy Technology Data Exchange (ETDEWEB)

    Fujii, Yasuyuki, E-mail: y.fujii@po.rd.taisho.co.jp [Department of Molecular Function and Pharmacology Laboratories, Taisho Pharmaceutical Co. Ltd., 1-403 Saitama, Saitama 331-9530 (Japan); Ueda, Yasuji; Ohtake, Hidenori; Ono, Naoya; Takayama, Tetsuo; Nakazawa, Kiyoshi [Department of Molecular Function and Pharmacology Laboratories, Taisho Pharmaceutical Co. Ltd., 1-403 Saitama, Saitama 331-9530 (Japan); Igarashi, Yasuyuki [Laboratory of Biomembrane and Biofunctional Chemistry, Hokkaido University, Sapporo, Hokkaido 060-0812 (Japan); Goitsuka, Ryo [Division of Development and Aging, Research Institute for Biological Sciences, Tokyo University of Science, Noda, Chiba 278-0022 (Japan)

    2012-03-23

    Highlights: Black-Right-Pointing-Pointer The effect of a newly developed S1P{sub 1}-selective antagonist on angiogenic responses. Black-Right-Pointing-Pointer S1P{sub 1} is a critical component of VEGF-related angiogenic responses. Black-Right-Pointing-Pointer S1P{sub 1}-selective antagonist showed in vitro activity to inhibit angiogenesis. Black-Right-Pointing-Pointer S1P{sub 1}-selective antagonist showed in vivo activity to inhibit angiogenesis. Black-Right-Pointing-Pointer The efficacy of S1P{sub 1}-selective antagonist for anti-cancer therapies. -- Abstract: Sphingosine 1-phosphate receptor type 1 (S1P{sub 1}) was shown to be essential for vascular maturation during embryonic development and it has been demonstrated that substantial crosstalk exists between S1P{sub 1} and other pro-angiogenic growth factors, such as vascular endothelial growth factor (VEGF) and basic fibroblast growth factor. We developed a novel S1P{sub 1}-selective antagonist, TASP0277308, which is structurally unrelated to S1P as well as previously described S1P{sub 1} antagonists. TASP0277308 inhibited S1P- as well as VEGF-induced cellular responses, including migration and proliferation of human umbilical vein endothelial cells. Furthermore, TASP0277308 effectively blocked a VEGF-induced tube formation in vitro and significantly suppressed tumor cell-induced angiogenesis in vivo. These findings revealed that S1P{sub 1} is a critical component of VEGF-related angiogenic responses and also provide evidence for the efficacy of TASP0277308 for anti-cancer therapies.

  13. Cohomology of the Schro¨dinger Algebra S (1)

    Institute of Scientific and Technical Information of China (English)

    Yue Zhu WU; Xiao Qing YUE; Lin Sheng ZHU

    2014-01-01

    We explicitly compute the first and second cohomology groups of the Schr¨odinger algebra S(1) with coeffi cients in the trivial module and the finite-dimensional irreducible modules. We also show that the first and second cohomology groups of S(1) with coeffi cients in the universal enveloping algebras U (S (1)) (under the adjoint action) are infinite dimensional.

  14. Protein

    Science.gov (United States)

    ... Food Service Resources Additional Resources About FAQ Contact Protein Protein is found throughout the body—in muscle, ... the heart and respiratory system, and death. All Protein Isn’t Alike Protein is built from building ...

  15. Detection of anti-preS1 antibodies for recovery of hepatitis B patients by immunoassay

    Institute of Scientific and Technical Information of China (English)

    Jun Wei; Yu-Qin Wang; Zhi-Meng Lu; Guang-Di Li; Yuan Wang; Zu-Chuan Zhang

    2002-01-01

    AIM: To establish a convenient immuncassay method based on recombinant antigen preS1(21-1l9aa) to detect anti-preS1antibodies and evaluate the clinical significance of antibodies in hepatitis B.METHODS: The expression plasmid pET-28a-preS1 wasconstructed, and a large quantity of preS1 (21-119aa)fragment of the large HBsAg protein was obtained. ThepreS1 fragment purified by Ni2+ -IDA affinity chromatographywas used as coated antigen to establish the indirect ELISAbased on streptavidin-biotin system for detection of the anti-preS1 antibodies in sera from HBV-infected patients. Forfollow-up study, serial sera were collected during theclinical course of 21 HBV-infected patients and anti-preS1antibodies, preS1 antigen, HBV-DNA and other serologicalHBV markers were analyzed.RESULTS: preS1 (21-119aa) fragment was highly expressedfrom the plasmid pET-28a-preS1 in a soluble form in E. Coli(30 rog@ L-1 ), and easily purified to high purity over 90 % byone step of Ni2+ -IDA-sepharose 6B affinity chromatography.The purity and antigenicity of the purified preS1 (21-119aa)protein was determined by 150 g@ L-1 SDS-PAGE, Westemblot and a direct ELISA. Recombinant preS1 (21-119aa)protein was successfully applied in the immunoessay whichcould sensitively detect the anti-preS1 antibodies in serumspecimens of acute or chronic hepatitis B patients. Resultsshowed that more than half of 19 acute hepatitis B patientsproduced anti-preS1 antibodies during recovery of thedisease, however, the response was only found in a few ofchronic patients. In the clinical follow-up study of 11patients with anti-preS1 positive serological profile, HBsAgand HBV-DNA clearance occurred in 6 of 10 acute hepatitis Bpatients in 5-6 months, and seroconversion of HBeAg anddisappearance of HBV-DNA occurred in 1 chronic patientstreated with lavumidine, a antiviral agent.CONCLUSION: The high-purity preS1 ( 21-119aa) coatedantigen was successfully prepared by gene expression andaffinity chromatography. Using this

  16. S1PR1 expression correlates with inflammatory responses to Newcastle disease virus infection.

    Science.gov (United States)

    Li, Yaling; Xie, Peng; Sun, Minhua; Xiang, Bin; Kang, Yinfeng; Gao, Pei; Zhu, Wenxian; Ning, Zhangyong; Ren, Tao

    2016-01-01

    Newcastle disease virus (NDV) is the causative agent of Newcastle disease, which is characterized by inflammatory pathological changes in the organs of chickens. The inflammatory response to this disease has not been well characterized. Previous reports showed that the sphingosine-1-phosphate-1 receptor (S1PR1), a G protein-coupled receptor, is important to the activation of inflammatory responses. To understand better the viral pathogenesis and host inflammatory response, we analyzed S1PR1 expression during NDV infection. We observed a direct correlation between chicken embryo fibroblast (CEF) cellular inflammatory responses and S1PR1 expression. Virulent NDV-infected CEF cells also had elevated levels of pro-inflammatory cytokines (IL-1β, IL-6 and IL-18). When S1PR1 was inhibited by using the specific antagonist W146, pro-inflammatory cytokine production declined. Overexpression of S1PR1 resulted in increased virus-induced IL-1β production. S1PR1 expression levels did not impact significantly NDV replication. These findings highlight the important role of S1PR1 in inflammatory responses in NDV infection.

  17. Phosphorylation of αS1-casein is regulated by different genes.

    Science.gov (United States)

    Bijl, E; van Valenberg, H J F; Huppertz, T; van Hooijdonk, A C M; Bovenhuis, H

    2014-11-01

    Casein phosphorylation is a posttranslational modification catalyzed by kinase enzymes that attach phosphate groups to specific AA in the protein sequence. This modification is one of the key factors responsible for the stabilization of calcium phosphate nanoclusters in casein micelles and for the internal structure of the casein micelles. α(S1)-Casein (α(s1)-CN) is of special interest because it constitutes up to 40% of the total casein fraction in milk, and it has 2 common phosphorylation states, with 8 (α(S1)-CN-8P) and 9 (α(S1)-CN-9P) phosphorylated serine residues. Factors affecting this variation in the degree of phosphorylation are not currently known. The objective of this research was to determine the genetic background of α(S1)-CN-8P and α(S1)-CN-9P. The genetic and phenotypic correlation between α(S1)-CN-8P and α(S1)-CN-9P was low (0.18 and 0.19, respectively). This low genetic correlation suggests a different genetic background. These differences were further investigated by means of a genome-wide association study, which showed that both α(S1)-CN-8P and α(S1)-CN-9P were affected by a region on Bos taurus autosome (BTA) 6, but only α(S1)-CN-8P was affected by a region on BTA11 that contains the gene that encodes for β-lactoglobulin (β-LG), and only α(S1)-CN-9P was affected by a region on BTA14 that contains the diacylglycerol acyltransferase 1 (DGAT1) gene. Estimated effects of β-LG protein genotypes showed that only α(S1)-CN-8P was associated with the β-LG A/B polymorphism (g.1772G>A and g.3054C>T); the AA genotype of β-LG was associated with a lower concentration of α(S1)-CN-8P (-0.32% wt/wt) than the BB genotype (+0.41% wt/wt). Estimated effects of DGAT1 K232A genotypes showed that only α(S1)-CN-9P was associated with the DGAT1 gene polymorphism; DGAT1 AA genotype was associated with a higher α(S1)-CN-9P concentration (+0.53% wt/wt) than the DGAT1 KK genotype (-0.44% wt/wt). The results give insight in phosphorylation of α(S1

  18. Resonating Valence Bond states for low dimensional S=1 antiferromagnets

    Science.gov (United States)

    Liu, Zheng-Xin; Zhou, Yi; Ng, Tai-Kai

    2014-03-01

    We study S = 1 spin liquid states in low dimensions. We show that the resonating-valence-bond (RVB) picture of S = 1 / 2 spin liquid state can be generalized to S = 1 case. For S = 1 system, a many-body singlet (with even site number) can be decomposed into superposition of products of two-body singlets. In other words, the product states of two-body singlets, called the singlet pair states (SPSs), are over complete to span the Hilbert space of many-body singlets. Furthermore, we generalized fermionic representation and the corresponding mean field theory and Gutzwiller projected stats to S = 1 models. We applied our theory to study 1D anti-ferromagnetic bilinear-biquadratic model and show that both the ground states (including the phase transition point) and the excited states can be understood excellently well within the framework. Our method can be applied to 2D S = 1 antiferromagnets.

  19. The sphingolipid receptor S1PR2 is a receptor for Nogo-a repressing synaptic plasticity.

    Directory of Open Access Journals (Sweden)

    Anissa Kempf

    2014-01-01

    Full Text Available Nogo-A is a membrane protein of the central nervous system (CNS restricting neurite growth and synaptic plasticity via two extracellular domains: Nogo-66 and Nogo-A-Δ20. Receptors transducing Nogo-A-Δ20 signaling remained elusive so far. Here we identify the G protein-coupled receptor (GPCR sphingosine 1-phosphate receptor 2 (S1PR2 as a Nogo-A-Δ20-specific receptor. Nogo-A-Δ20 binds S1PR2 on sites distinct from the pocket of the sphingolipid sphingosine 1-phosphate (S1P and signals via the G protein G13, the Rho GEF LARG, and RhoA. Deleting or blocking S1PR2 counteracts Nogo-A-Δ20- and myelin-mediated inhibition of neurite outgrowth and cell spreading. Blockade of S1PR2 strongly enhances long-term potentiation (LTP in the hippocampus of wild-type but not Nogo-A(-/- mice, indicating a repressor function of the Nogo-A/S1PR2 axis in synaptic plasticity. A similar increase in LTP was also observed in the motor cortex after S1PR2 blockade. We propose a novel signaling model in which a GPCR functions as a receptor for two structurally unrelated ligands, a membrane protein and a sphingolipid. Elucidating Nogo-A/S1PR2 signaling platforms will provide new insights into regulation of synaptic plasticity.

  20. 26 CFR 1.414(s)-1 - Definition of compensation.

    Science.gov (United States)

    2010-04-01

    ... prior regulation provisions of § 1.414(s)-1T. (See § 1.414(s)-1T as contained in the CFR edition revised... to the extent necessary to satisfy the requirements of 29 CFR 2530.204-2(d) (regarding double... 26 Internal Revenue 5 2010-04-01 2010-04-01 false Definition of compensation. 1.414(s)-1 Section...

  1. Structural interactions between lipids, water and S1-S4 voltage-sensing domains.

    Science.gov (United States)

    Krepkiy, Dmitriy; Gawrisch, Klaus; Swartz, Kenton J

    2012-11-01

    Membrane proteins serve crucial signaling and transport functions, yet relatively little is known about their structures in membrane environments or how lipids interact with these proteins. For voltage-activated ion channels, X-ray structures suggest that the mobile voltage-sensing S4 helix would be exposed to the membrane, and functional studies reveal that lipid modification can profoundly alter channel activity. Here, we use solid-state NMR to investigate structural interactions of lipids and water with S1-S4 voltage-sensing domains and to explore whether lipids influence the structure of the protein. Our results demonstrate that S1-S4 domains exhibit extensive interactions with lipids and that these domains are heavily hydrated when embedded in a membrane. We also find evidence for preferential interactions of anionic lipids with S1-S4 domains and that these interactions have lifetimes on the timescale of ≤ 10(-3)s. Arg residues within S1-S4 domains are well hydrated and are positioned in close proximity to lipids, exhibiting local interactions with both lipid headgroups and acyl chains. Comparative studies with a positively charged lipid lacking a phosphodiester group reveal that this lipid modification has only modest effects on the structure and hydration of S1-S4 domains. Taken together, our results demonstrate that Arg residues in S1-S4 voltage-sensing domains reside in close proximity to the hydrophobic interior of the membrane yet are well hydrated, a requirement for carrying charge and driving protein motions in response to changes in membrane voltage.

  2. 牛αS1-酪蛋白基因研究新进展%The Study Progress of Alpha-s1-casein Gene

    Institute of Scientific and Technical Information of China (English)

    田青

    2011-01-01

    Casein is the main component of milk protein,accounts for about 70~80 percent of total protein.as1-casein is the main component of casein,accounting for about 39~46 percent of total milk protein.It is one of the quite active functional genes in the cattle's mammary gland tissue,so it is important and very necessary to study the cow alpha S1-casein gene.The paper summarized the gene structure,genetic diversity and casein active peptide of alpha-s1-casein gene,which would provide the theory basis to study alpha-s1-casein gene deeply and to improve the milk protein content by regulating as1-casein gene.%酪蛋白是牛奶蛋白质的主要组成部分,约占总蛋白的70%~80%,而as1-酪蛋白又是酪蛋白的主要组成部分,约占牛奶总蛋白的39%~46%,是牛乳腺组织中转录相当活跃的一个功能基因,因此研究牛αS1-酪蛋白基因就显得尤为重要而且很有必要。本文从牛as1-酪蛋白基因结构、遗传多态性和酪蛋白活性肽方面做了综述,旨在为以后牛as1-酪蛋白基因的深入研究和通过调控as1-酪蛋白基因而提高牛奶蛋白质的含量提供理论基础。

  3. Sphingosine-1-Phosphate Induces Dose-Dependent Chemotaxis or Fugetaxis of T-ALL Blasts through S1P1 Activation.

    Directory of Open Access Journals (Sweden)

    Carolina V Messias

    Full Text Available Sphingosine-1-phosphate (S1P is a bioactive sphingolipid involved in several physiological processes including cell migration and differentiation. S1P signaling is mediated through five G protein-coupled receptors (S1P1-S1P5. S1P1 is crucial to the exit of T-lymphocytes from the thymus and peripheral lymphoid organs through a gradient of S1P. We have previously observed that T-ALL and T-LBL blasts express S1P1. Herein we analyzed the role of S1P receptors in the migratory pattern of human T-cell neoplastic blasts. S1P-triggered cell migration was directly related to S1P1 expression. T-ALL blasts expressing low levels of S1P1 mRNA (HPB-ALL did not migrate toward S1P, whereas those expressing higher levels of S1P1 (MOLT-4, JURKAT and CEM did migrate. The S1P ligand induced T-ALL cells chemotaxis in concentrations up to 500 nM and induced fugetaxis in higher concentrations (1000-10000 nM through interactions with S1P1. When S1P1 was specifically blocked by the W146 compound, S1P-induced migration at lower concentrations was reduced, whereas higher concentrations induced cell migration. Furthermore, we observed that S1P/S1P1 interactions induced ERK and AKT phosphorylation, and modulation of Rac1 activity. Responding T-ALL blasts also expressed S1P3 mRNA but blockage of this receptor did not modify migratory responses. Our results indicate that S1P is involved in the migration of T-ALL/LBL blasts, which is dependent on S1P1 expression. Moreover, S1P concentrations in the given microenvironment might induce dose-dependent chemotaxis or fugetaxis of T-ALL blasts.

  4. Differential S1P Receptor Profiles on M1- and M2-Polarized Macrophages Affect Macrophage Cytokine Production and Migration

    Science.gov (United States)

    Müller, Jan; von Bernstorff, Wolfram; Heidecke, Claus-Dieter

    2017-01-01

    Introduction. Macrophages are key players in complex biological processes. In response to environmental signals, macrophages undergo polarization towards a proinflammatory (M1) or anti-inflammatory (M2) phenotype. Sphingosine 1-phosphate (S1P) is a bioactive lysophospholipid that acts via 5 G-protein coupled receptors (S1P1–5) in order to influence a broad spectrum of biological processes. This study assesses S1P receptor expression on macrophages before and after M1 and M2 polarization and performs a comparative analysis of S1P signalling in the two activational states of macrophages. Methods. Bone marrow derived macrophages (BMDM) from C57 BL/6 mice were cultured under either M1- or M2-polarizing conditions. S1P-receptor expression was determined by quantitative RT-PCR. Influence of S1P on macrophage activation, migration, phagocytosis, and cytokine secretion was assessed in vitro. Results. All 5 S1P receptor subclasses were expressed in macrophages. Culture under both M1- and M2-polarizing conditions led to significant downregulation of S1P1. In contrast, M1-polarized macrophages significantly downregulated S1P4. The expression of the remaining three S1P receptors did not change. S1P increased expression of iNOS under M2-polarizing conditions. Furthermore, S1P induced chemotaxis in M1 macrophages and changed cytokine production in M2 macrophages. Phagocytosis was not affected by S1P-signalling. Discussion. The expression of different specific S1P receptor profiles may provide a possibility to selectively influence M1- or M2-polarized macrophages.

  5. Quantification of αS1-casein in breast milk using a targeted mass spectrometry-based approach.

    Science.gov (United States)

    Altendorfer, Irina; König, Simone; Braukmann, Achim; Saenger, Thorsten; Bleck, Ellen; Vordenbäumen, Stefan; Kubiak, Anna; Schneider, Matthias; Jose, Joachim

    2015-01-25

    The caseins comprise a milk protein fraction of high nutritional value and, as more recently discovered, of immunologic relevance. In particular, αS1-casein (CSN1S1) is of interest being a potential autoantigen. So far, the concentration of caseins in human milk was primarily determined by indirect methods. The aim of this study was to directly measure the CSN1S1 content in breast milk using mass spectrometry (MS). The quantification was based on tryptic CSN1S1 peptides with the best response in liquid chromatography (LC)-MS/MS analysis. Targeted experiments allowed both specific and sensitive detection at the low fmol level. For this pilot study, twenty breast milk samples of the first week post-partum were analyzed and contained between 3 and 540μg/ml CSN1S1. Limitations of CSN1S1 quantification are discussed.

  6. Attenuation of cell motility observed with high doses of sphingosine 1-phosphate or phosphorylated FTY720 involves RGS2 through its interactions with the receptor S1P.

    Science.gov (United States)

    Kohno, Takayuki; Igarashi, Yasuyuki

    2008-07-01

    Sphingosine 1-phosphate (S1P) stimulation enhances cell motility via the G-protein coupled S1P receptor S1P1. This ligand-induced, receptor-mediated cell motility follows a typical bell-shaped dose-response curve, that is, stimulation with low concentrations of S1P enhances cell motility, whereas excess ligand stimulation does not enhance it. So far, the attenuation of the response at higher ligand concentrations has not been explained. We report here that S1P1 interacts with the regulator of G protein signaling (RGS)-2 protein, which is a GTPase-activating protein (GAP) for heterotrimeric G proteins, in a concentration dependent manner. The RGS2-S1P1 complex dissociated at higher ligand concentrations, yet it was unaffected at low concentrations, suggesting that the dissociated RGS2 is involved in the concurrent decrease of cell motility. In RGS2 knockdown cells, the decrease of cell motility induced by high ligand concentrations was rescued. S1P1 internalization was not implicated in the attenuation of the response. Similar results were observed upon stimulation with the phosphorylated form of FTY720 (FTYP), which is an S1P1 agonist. In conclusion, the suppressed response in cell motility induced by excess S1P or FTYP via S1P1 is regulated by RGS2 functioning through a mechanism that is independent of S1P1 internalization.

  7. Localization on $AdS_2\\times S^1$

    CERN Document Server

    David, Justin R; Gupta, Rajesh Kumar; Narain, Kumar

    2016-01-01

    Conformal symmetry relates the metric on $AdS_2 \\times S^{1}$ to that of $S^3$. This implies that under a suitable choice of boundary conditions for fields on $AdS_2$ the partition function of conformal field theories on these spaces must agree which makes $AdS_2 \\times S^{1}$ a good testing ground to study localization on non-compact spaces. We study supersymmetry on $AdS_2\\times S^1$ and determine the localizing Lagrangian for ${\\cal N}=2$ supersymmetric Chern-Simons theory on $AdS_2\\times S^1$. We evaluate the partition function of ${\\cal N}=2$ supersymmetric Chern-Simons theory on $AdS_2 \\times S^1$ using localization, where the radius of $S^1$ is $q$ times that of $AdS_2$. With boundary conditions on $AdS_2\\times S^1$ which ensure that all the physical fields are normalizable and lie in the space of square integrable wave functions in $AdS_2$, the result for the partition function precisely agrees with that of the theory on the $q$-fold covering of $S^3$.

  8. Epson EMP-S1投影机的升级产品EMP-S1H

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    EMP-S1是Epson公司推出的1款颇具影响力的经济型投影机,2004年5月Epson推出了EMP-S1的升级产品EMP-S1H。EMP.S1H在原有EMP-S1投影机的基础上亮度提高到了1400流明,同时对比度也提高到500:1,对比度的提高使图像层次感更好,影像更富有质感。

  9. Assignment of Isodoublet of 23S1 Meson Nonet

    Institute of Scientific and Technical Information of China (English)

    FENG Xue-Chao; JIANG Feng-Chun

    2007-01-01

    Inserting the masses of some states, which have been established in the experiments or the theory of lattice QCD, we investigate the mass of the isodoublet of the 23S1 meson nonet. The agreement results, 1567 ± 22.6 MeV and 1576.8 MeV, are given by two different approaches. We suggest that the assignment of 23S1 meson nonet should be re-examined in future experiments.

  10. Isolation of New Stenotrophomonas Bacteriophages and Genomic Characterization of Temperate Phage S1

    Science.gov (United States)

    García, Pilar; Monjardín, Cristina; Martín, Rebeca; Madera, Carmen; Soberón, Nora; Garcia, Eva; Meana, Álvaro; Suárez, Juan E.

    2008-01-01

    Twenty-two phages that infect Stenotrophomonas species were isolated through sewage enrichment and prophage induction. Of them, S1, S3, and S4 were selected due to their wide host ranges compared to those of the other phages. S1 and S4 are temperate siphoviruses, while S3 is a virulent myovirus. The genomes of S3 and S4, about 33 and 200 kb, were resistant to restriction digestion. The lytic cycles lasted 30 min for S3 and about 75 min for S1 and S4. The burst size for S3 was 100 virions/cell, while S1 and S4 produced about 75 virus particles/cell. The frequency of bacteriophage-insensitive host mutants, calculated by dividing the number of surviving colonies by the bacterial titer of a parallel, uninfected culture, ranged between 10−5 and 10−6 for S3 and 10−3 and 10−4 for S1 and S4. The 40,287-bp genome of S1 contains 48 open reading frames (ORFs) and 12-bp 5′ protruding cohesive ends. By using a combination of bioinformatics and experimental evidence, functions were ascribed to 21 ORFs. The morphogenetic and lysis modules are well-conserved, but no lysis-lysogeny switch or DNA replication gene clusters were recognized. Two major clusters of genes with respect to transcriptional orientation were observed. Interspersed among them were lysogenic conversion genes encoding phosphoadenosine phosphosulfate reductase and GspM, a protein involved in the general secretion system II. The attP site of S1 may be located within a gene that presents over 75% homology to a Stenotrophomonas chromosomal determinant. PMID:18952876

  11. Molecular characterization of a novel reovirus isolated from SARS patients with distinct S1 segment

    Institute of Scientific and Technical Information of China (English)

    LI HUA SONG; JUN HE; HONG ZHU; YU XIN SU; RU TONG HUANG; HONG YUAN DUAN; PAN YONG MAO; QING DUAN

    2006-01-01

    We reported a novel mammalian reovirus, designed BYD1, isolated from throat swabs of patients with severe acute respiratory syndrome (SARS), in 2003. In the present study, we firstly compared the genome electrophoretic migration patterns of reovirus BYD1 with 3 prototype reovirus strains by polyacrylamide gel electrophoresis (PAGE) and determined the complete nucleotide sequence of the S1 gene segment of BYD1 by single primer amplification technique. The electropherogram of BYD1 was differentfrom those of the 3 prototype strains and any other reovirus isolates reported before. The entire S1 segment sequence of BYD1 is 1437 bp long with two meaningful open reading frames (ORFs). The longest ORF encodes σ1, the cell attachment protein, and the second longest ORF supposedly encodes σ1s, an important nonstructural virulence factor. The terminal sequences of S1 segment are 5'GCUA and 3'UCAUC,which are consistent with those of other mammalian reoviruses. The highest homology of deduced σ1 amino acid sequence is 64% identity with known mammalian reoviruses. Phylogenetic analysis of both S1 nucleotide sequence and σ1 amino acid sequence indicated the BYD1 isolate belonged to a new clade of serotype 2 group. The results of this study showed that the BYD1 S1 segment was markedly different from those of isolates reported before and BYD1 was a novel human reovirus isolate.

  12. Sphingosine-1-phosphate enhances satellite cell activation in dystrophic muscles through a S1PR2/STAT3 signaling pathway.

    Directory of Open Access Journals (Sweden)

    Kenneth C Loh

    Full Text Available Sphingosine-1-phosphate (S1P activates a widely expressed family of G protein-coupled receptors, serves as a muscle trophic factor and activates muscle stem cells called satellite cells (SCs through unknown mechanisms. Here we show that muscle injury induces dynamic changes in S1P signaling and metabolism in vivo. These changes include early and profound induction of the gene encoding the S1P biosynthetic enzyme SphK1, followed by induction of the catabolic enzyme sphingosine phosphate lyase (SPL 3 days later. These changes correlate with a transient increase in circulating S1P levels after muscle injury. We show a specific requirement for SphK1 to support efficient muscle regeneration and SC proliferation and differentiation. Mdx mice, which serve as a model for muscular dystrophy (MD, were found to be S1P-deficient and exhibited muscle SPL upregulation, suggesting that S1P catabolism is enhanced in dystrophic muscle. Pharmacological SPL inhibition increased muscle S1P levels, improved mdx muscle regeneration and enhanced SC proliferation via S1P receptor 2 (S1PR2-dependent inhibition of Rac1, thereby activating Signal Transducer and Activator of Transcription 3 (STAT3, a central player in inflammatory signaling. STAT3 activation resulted in p21 and p27 downregulation in a S1PR2-dependent fashion in myoblasts. Our findings suggest that S1P promotes SC progression through the cell cycle by repression of cell cycle inhibitors via S1PR2/STAT3-dependent signaling and that SPL inhibition may provide a therapeutic strategy for MD.

  13. Highly selective and potent agonists of sphingosine-1-phosphate 1 (S1P1) receptor.

    Science.gov (United States)

    Vachal, Petr; Toth, Leslie M; Hale, Jeffrey J; Yan, Lin; Mills, Sander G; Chrebet, Gary L; Koehane, Carol A; Hajdu, Richard; Milligan, James A; Rosenbach, Mark J; Mandala, Suzanne

    2006-07-15

    Novel series of sphingosine-1-phosphate (S1P) receptor agonists were developed through a systematic SAR aimed to achieve high selectivity for a single member of the S1P family of receptors, S1P1. The optimized structure represents a highly S1P1-selective and efficacious agonist: S1P1/S1P2, S1P1/S1P3, S1P1/S1P4>10,000-fold, S1P1/S1P5>600-fold, while EC50 (S1P1) effect.

  14. S1 gene sequence analysis of a nephropathogenic strain of avian infectious bronchitis virus in Egypt

    OpenAIRE

    Ladman Brian S; El-Kady Magdy F; Abdel-Moneim Ahmed S; Gelb Jack

    2006-01-01

    Abstract Background Infectious bronchitis is highly contagious and constitutes one of the most common and difficult poultry diseases to control. IBV is endemic in probably all countries that raise chickens. It exists as dozens of serotypes/genotypes. Only a few amino acid differences in the S1 protein of vaccine and challenge strains of IBV may result in poor protection. Tropism of IBV includes the respiratory tract tissues, proventriculus and caecal tonsils of the alimentary tract, the ovidu...

  15. Sphingosine-1-phosphate/S1P receptors signaling modulates cell migration in human bone marrow-derived mesenchymal stem cells.

    Science.gov (United States)

    Kong, Yaxian; Wang, Hong; Lin, Tao; Wang, Shuling

    2014-01-01

    The recruitment of bone marrow-derived mesenchymal stem cells (BMSCs) to damaged tissues and sites of inflammation is an essential step for clinical therapy. However, the signals regulating the motility of these cells are still not fully understood. Sphingosine-1-phosphate (S1P), a bioactive sphingolipid metabolite, is known to have a variety of biological effects on various cells. Here, we investigated the roles of S1P and S1P receptors (S1PRs) in migration of human BMSCs. We found that S1P exerted a powerful migratory action on human BMSCs. Moreover, by employing RNA interference technology and pharmacological tools, we demonstrated that S1PR1 and S1PR3 are responsible for S1P-induced migration of human BMSCs. In contrast, S1PR2 mediates the inhibition of migration. Additionally, we explored the downstream signaling pathway of the S1P/S1PRs axis and found that activation of S1PR1 or S1PR3 increased migration of human BMSCs through a G i /extracellular regulated protein kinases 1/2- (ERK1/2-) dependent pathway, whereas activation of S1PR2 decreased migration through the Rho/Rho-associated protein kinase (ROCK) pathway. In conclusion, we reveal that the S1P/S1PRs signaling axis regulates the migration of human BMSCs via a dual-directional mechanism. Thus, selective modulation of S1PR's activity on human BMSCs may provide an effective approach to immunotherapy or tissue regeneration.

  16. Improvement of S-1 photocathode shelf life stability. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Fitts, R.W.

    1977-03-01

    The purpose of this program was to stabilize sensitivity of S-1 photocathodes in C73435AG high speed image converters. Variations in bulb pre- and post-heating and in aging were investigated using partial tube assemblies consisting of the cathode bulb half of the standard tube. Successful processing of stable S-1 photocathodes in partial tubes led to adapting the schedules to complete tube assemblies. Five tubes processed on this contract yielded high but unstable photocathode sensitivity. Continued testing of tubes being made to fill customer orders shows that control of tube heating and cooling, together with careful control of evaporated cesium, can yield stable S-1 photocathodes. Additional experimentation is required to optimize a schedule yielding consistently stable photocathodes.

  17. In vivo analysis of the Notch receptor S1 cleavage.

    Directory of Open Access Journals (Sweden)

    Robert J Lake

    Full Text Available A ligand-independent cleavage (S1 in the extracellular domain of the mammalian Notch receptor results in what is considered to be the canonical heterodimeric form of Notch on the cell surface. The in vivo consequences and significance of this cleavage on Drosophila Notch signaling remain unclear and contradictory. We determined the cleavage site in Drosophila and examined its in vivo function by a transgenic analysis of receptors that cannot be cleaved. Our results demonstrate a correlation between loss of cleavage and loss of in vivo function of the Notch receptor, supporting the notion that S1 cleavage is an in vivo mechanism of Notch signal control.

  18. Inhibition of preS1-hepatocyte interaction by an array of recombinant human antibodies from naturally recovered individuals

    DEFF Research Database (Denmark)

    Sankhyan, Anurag; Sharma, Chandresh; Dutta, Durgashree;

    2016-01-01

    binding signature, interacting with different amino acids within the preS1-peptide region. Ability to prevent binding of the preS1 protein (N-terminus 60a.a.) to HepG2 cells stably expressing hNTCP (HepG2-hNTCP-C4 cells), the HBV receptor on human hepatocytes was taken as a surrogate marker...

  19. Characterization and genetic analysis of bovine alpha S1-casein I variant.

    Science.gov (United States)

    Lühken, G; Caroli, A; Ibeagha-Awemu, E M; Erhardt, G

    2009-08-01

    The aim of this study was to identify the molecular genetic origin underlying the I variant of alpha(s1)-casein and to develop a DNA-based test for this polymorphism as a tool for genetic analyses independent of milk sample testing. All coding exons and flanking regions of the alpha(s1)-casein gene were sequenced in DNA samples from cattle of known alpha(s1)-casein genotypes (BI, CI, II, CC), determined by isoelectric focusing of milk samples. A nucleotide substitution (A>T) in exon 11 (g.19836A>T) leads to the exchange of Glu with Asp at amino acid position 84 of the mature protein (p.Glu84Asp) and perfectly co-segregated with the presence of the alpha(s1)-casein I variant in the milk of the analysed animals. Genotyping of a total of 680 DNA samples from 31 Bos taurus and Bos indicus cattle breeds and from Bos grunniens, Bison bison and Bison bonasus by restriction fragment length polymorphism analysis revealed the occurrence of Asp at position 84 at low frequencies in Bos taurus and Bos indicus breeds and established its origin from the alpha(s1)-casein C variant (p.Glu192Gly). Ten different intragenic haplotypes in the gene region from intron 8 to intron 12 were observed by sequencing, of which two occurred in Bison bison and one in Bison bonasus only. Using available casein gene complex information, an association of Asp at position 84 to beta-casein A(2) and kappa-casein B was shown in the Bos indicus breed Banyo Gudali. Taken together, we can postulate that the alpha(s1)-casein variant I is caused by a non-synonymous nucleotide substitution in exon 11 of the gene and that it originated within Bos indicus and spread to Bos taurus subsequently.

  20. Autoantibodies to αS1-casein are induced by breast-feeding.

    Directory of Open Access Journals (Sweden)

    Klaudia Petermann

    Full Text Available BACKGROUND: The generation of antibodies is impaired in newborns due to an immature immune system and reduced exposure to pathogens due to maternally derived antibodies and placental functions. During nursing, the immune system of newborns is challenged with multiple milk-derived proteins. Amongst them, caseins are the main constituent. In particular, human αS1-casein (CSN1S1 was recently shown to possess immunomodulatory properties. We were thus interested to determine if auto-antibodies to CSN1S1 are induced by breast-feeding and may be sustained into adulthood. METHODS: 62 sera of healthy adult individuals who were (n = 37 or were not (n = 25 breast-fed against human CSN1S1 were investigated by a new SD (surface display-ELISA. For cross-checking, these sera were tested for anti Epstein-Barr virus (EBV antibodies by a commercial ELISA. RESULTS: IgG-antibodies were predominantly detected in individuals who had been nursed. At a cut-off value of 0.4, the SD-ELISA identified individuals with a history of having been breast-fed with a sensitivity of 80% and a specificity of 92%. Under these conditions, 35 out of 37 sera from healthy donors, who where breast-fed, reacted positively but only 5 sera of the 25 donors who were not breast-fed. The duration of breast-feeding was of no consequence to the antibody reaction as some healthy donors were only short term breast-fed (5 days minimum until 6 weeks maximum, but exhibited significant serum reaction against human CSN1S1 nonetheless. CONCLUSION: We postulate that human CSN1S1 is an autoantigen. The antigenicity is orally determined, caused by breast-feeding, and sustained into adulthood.

  1. Anomalous Dispersion of the S1 Lamb Mode

    Directory of Open Access Journals (Sweden)

    Faiz Ahmad

    2013-01-01

    Full Text Available The S1 mode of the Lamb spectrum of an isotropic plate exhibits negative group velocity in a narrow frequency domain. This anomalous behavior is explained analytically by examining the slope of each mode first in its initial state and then near its turning points.

  2. Emerging role of S-1 in gastric cancer

    Directory of Open Access Journals (Sweden)

    Eriseld Krasniqi

    2015-01-01

    Full Text Available Gastric cancer remains one of the most important malignancies worldwide in terms of incidence and mortality. The treatment is based on the combination of local surgery and radiation therapy as well as systemic chemotherapy and targeted molecules. Fluoropyrimidines and particularly 5-fluorouracil (FU represent still the backbone for gastric cancer chemotherapy and new molecular versions of this molecule have been brought to clinical practice in order to improve benefits and reduce adverse effects. S-1 is an oral prodrug of 5-FU, which has demonstrated high effectiveness for gastric cancer treatment and a favorable safety profile. Currently, there are geographic differences in the treatment of gastric cancer and in the use of S-1, which is a mainstay of gastric cancer management in Eastern countries, but is not part of the standard care in the rest of the world. In this review, we gathered data from phase I, II, and III trials of S-1 in gastric cancer, in order to define its real benefit-risk ratio and assess whether geographic differences in S-1 use are justified by unchangeable factors.

  3. Spin diffusion in anisotropic Heisenberg chains: S{>=}1/2

    Energy Technology Data Exchange (ETDEWEB)

    Huber, D.L., E-mail: huber@src.wisc.edu [Physics Department, University of Wisconsin-Madison, 1150 University Avenue, Madison WI 53706 (United States)

    2012-11-01

    In this paper, we investigate spin diffusion in Heisenberg chains with uniaxial nearest-neighbor interactions. The approach followed is based on an analysis of the infinite-temperature longitudinal spin density and spin current correlation functions. For S=1/2, exact results are presented for the time-dependent correlation functions in the XY limit. Away from this limit, the second and fourth moments of the Fourier transform of the spin density correlation function provide information about spin dynamics for arbitrary values of the spin. The moments are used in an assessment of the accuracy of the Gaussian approximation for the spin diffusion constant for S=1/2. The general behavior of the Gaussian approximation when S>1/2 is discussed, and numerical results for the spin diffusion constant are presented for S=1/2, 1, 3/2, 2 and in the classical limit. A moment-based criterion for the boundary in reciprocal space between diffusive and non-diffusive dynamics that applies to arbitrary values of the spin is presented.

  4. Late-stage optimization of a tercyclic class of S1P3-sparing, S1P1 receptor agonists.

    Science.gov (United States)

    Horan, Joshua C; Kuzmich, Daniel; Liu, Pingrong; DiSalvo, Darren; Lord, John; Mao, Can; Hopkins, Tamara D; Yu, Hui; Harcken, Christian; Betageri, Raj; Hill-Drzewi, Melissa; Patenaude, Lori; Patel, Monica; Fletcher, Kimberly; Terenzzio, Donna; Linehan, Brian; Xia, Heather; Patel, Mita; Studwell, Debbie; Miller, Craig; Hickey, Eugene; Levin, Jeremy I; Smith, Dustin; Kemper, Raymond A; Modis, Louise K; Bannen, Lynne C; Chan, Diva S; Mac, Morrison B; Ng, Stephanie; Wang, Yong; Xu, Wei; Lemieux, René M

    2016-01-15

    Poor solubility and cationic amphiphilic drug-likeness were liabilities identified for a lead series of S1P3-sparing, S1P1 agonists originally developed from a high-throughput screening campaign. This work describes the subsequent optimization of these leads by balancing potency, selectivity, solubility and overall molecular charge. Focused SAR studies revealed favorable structural modifications that, when combined, produced compounds with overall balanced profiles. The low brain exposure observed in rat suggests that these compounds would be best suited for the potential treatment of peripheral autoimmune disorders.

  5. SKI-1/S1P inhibitor PF-429242 impairs the onset of HCV infection.

    Science.gov (United States)

    Blanchet, Matthieu; Sureau, Camille; Guévin, Carl; Seidah, Nabil G; Labonté, Patrick

    2015-03-01

    Worldwide, approximately 170 million individuals are afflicted with chronic hepatitis C virus (HCV) infection. To prevent the development of inherent diseases such as cirrhosis and hepatocellular carcinoma, tremendous efforts have been made, leading to the development of promising new treatments. However, their efficiency is still dependent on the viral genotype. Additionally, these treatments that target the virus directly can trigger the emergence of resistant variants. In a previous study, we have demonstrated that a long-term (72h) inhibition of SKI-1/S1P, a master lipogenic pathway regulator through activation of SREBP, resulted in impaired HCV genome replication and infectious virion secretion. In the present study, we sought to investigate the antiviral effect of the SKI-1/S1P small molecule inhibitor PF-429242 at the early steps of the HCV lifecycle. Our results indicate a very potent antiviral effect of the inhibitor early in the viral lifecycle and that the overall action of the compound relies on two different contributions. The first one is SREBP/SKI-1/S1P dependent and involves LDLR and NPC1L1 proteins, while the second one is SREBP independent. Overall, our study confirms that SKI-1/S1P is a relevant target to impair HCV infection and that PF-429242 could be a promising candidate in the field of HCV infection treatment.

  6. Goat's αS1-casein polymorphism affects gene expression profile of lactating mammary gland.

    Science.gov (United States)

    Ollier, S; Chauvet, S; Martin, P; Chilliard, Y; Leroux, C

    2008-04-01

    Goat's αS1-casein (CSN1S1) polymorphism has a significant effect on milk protein and lipid composition, which affects the nutritional quality and technological properties of milk. Moreover, this polymorphism has a large impact on the morphology of mammary epithelial cells. To explore the metabolic pathways modulated in relation to this polymorphism, we compared the mammary gene expression profiles of two groups of lactating goats carrying either two reference or two defective alleles, using a bovine oligonucleotide microarray representing 8379 genes. We identified 41 differentially expressed genes between the two genotype groups. In particular, we showed a downregulation of two key lipogenic genes encoding fatty acid synthase and glycerol-3-phosphate acyltransferase in agreement with the low fat concentration associated with CSN1S1 deficiency. In addition, this study highlights changes in the expression level of several genes known to influence membrane fluidity, cell-cell interaction or chromatin organization. Our results open up new fields of investigation on structural modifications associated with CSN1S1 deficiency that could affect mammary gland function.

  7. Photolabeling of Glu-129 of the S-1 subunit of pertussis toxin with NAD

    Energy Technology Data Exchange (ETDEWEB)

    Barbieri, J.T.; Mende-Mueller, L.M.; Rappuoli, R.; Collier, R.J. (Medical College of Wisconsin, Milwaukee (USA))

    1989-11-01

    UV irradiation was shown to induce efficient transfer of radiolabel from nicotinamide-labeled NAD to a recombinant protein (C180 peptide) containing the catalytic region of the S-1 subunit of pertussis toxin. Incorporation of label from (3H-nicotinamide)NAD was efficient (0.5 to 0.6 mol/mol of protein) relative to incorporation from (32P-adenylate)NAD (0.2 mol/mol of protein). Label from (3H-nicotinamide)NAD was specifically associated with Glu-129. Replacement of Glu-129 with glycine or aspartic acid made the protein refractory to photolabeling with (3H-nicotinamide)NAD, whereas replacement of a nearby glutamic acid, Glu-139, with serine did not. Photolabeling of the C180 peptide with NAD is similar to that observed with diphtheria toxin and exotoxin A of Pseudomonas aeruginosa, in which the nicotinamide portion of NAD is transferred to Glu-148 and Glu-553, respectively, in the two toxins. These results implicate Glu-129 of the S-1 subunit as an active-site residue and a potentially important site for genetic modification of pertussis toxin for development of an acellular vaccine against Bordetella pertussis.

  8. 毛竹PePsbS1基因的分子特征及其原核表达%Molecular characteristics and prokaryotic expression of PePsbS1 gene from Phyllostachys edulis

    Institute of Scientific and Technical Information of China (English)

    陈东亮; 彭镇华; 高志民

    2013-01-01

    PsbS protein has a key role in non-photochemical quenching (NPQ) in plants. A PsbS homologous gene was cloned from the full length cDNA library of Phyllostachys edulis by alignment method, and designed as PePsbS1 (GenBank No. FP091683). The full length cDNA of PePsbS1 is 1 069 bp, containing many kinds of light responsive elements and cis-acting regulatory elements involved in light responsiveness. The open reading frame of PePsbS1 is 807 bp encoding a polypeptide with 268 amino acids. The protein structure analysis indicated that PePsbS1 consisted of transit peptide (53 aa) and mature protein (215 aa) including one chlorophyll a/b binding protein domain and four transmembrane domains. Blastp analysis showed that PePsbS1 had high identities with PsbS1 of Zea mays to 80.3%. Hydropathy analysis of the deduced amino acid sequence revealed that PePsbS1 was hydrophobic overall as observed from the hydropathy plot with 42.5% of the total amino acid residues having hy-drophobicity. The prokaryotic expression vector containing fragment of PePsbS1 gene encoding mature protein was constructed and expressed in Escherichia coli induced by IPTG. A purified protein with molecular weight about 28 kD was found through SDS-PAGE electrophoresis, which agreed with that of the predicted mature protein encoded by PePsbS1. This work is helpful for further study on the structure and function of PsbS in bamboo.%PsbS蛋白在植物非光化学淬灭(NPQ)中发挥着重要作用.采用同源比对方法从毛竹(Phyllostachys edulis)全长(e)DNA文库中得到1个PsbS同源基因序列(FP091683),命名为PePsbS1.该基因全长1069 bp,具有多种光应答元件和参与光应答的顺式作用元件.PePsbS1的开放阅读框为807 bp,编码一个268 aa的蛋白.蛋白结构分析表明,该蛋白由转导肽(53 aa)和成熟蛋白(215 aa)组成,成熟蛋白包含1个叶绿素a/b结合蛋白功能域、4个跨膜区;疏水性分析表明该蛋白组成氨基酸

  9. Proteolytic cleavage of pertussis toxin S1 subunit is not essential for its activity in mammalian cells

    Directory of Open Access Journals (Sweden)

    Plaut Roger D

    2005-02-01

    Full Text Available Abstract Background Pertussis toxin (PT is an exotoxin virulence factor produced by Bordetella pertussis, the causative agent of whooping cough. PT consists of an active subunit (S1 that ADP-ribosylates the alpha subunit of several mammalian G proteins, and a B oligomer (S2–S5 that binds glycoconjugate receptors on cells. PT appears to enter cells by endocytosis, and retrograde transport through the Golgi apparatus may be important for its cytotoxicity. A previous study demonstrated that proteolytic processing of S1 occurs after PT enters mammalian cells. We sought to determine whether this proteolytic processing of S1 is necessary for PT cytotoxicity. Results Protease inhibitor studies suggested that S1 processing may involve a metalloprotease, and processing does not involve furin, a mammalian cell protease that cleaves several other bacterial toxins. However, inhibitor studies showed a general lack of correlation of S1 processing with PT cellular activity. A combination of replacement, insertion and deletion mutations in the C-terminal region of S1, as well as mass spectrometry data, suggested that the cleavage site is located around residue 203–204, but that cleavage is not strongly sequence-dependent. Processing of S1 was abolished by each of 3 overlapping 8 residue deletions just downstream of the putative cleavage site, but not by smaller deletions in the same region. Processing of the various mutant forms of PT did not correlate with cellular activity of the toxin, nor with the ability of the bacteria producing them to infect the mouse respiratory tract. In addition, S1 processing was not detected in transfected cells expressing S1, even though S1 was fully active in these cells. Conclusions S1 processing is not essential for the cellular activity of PT. This distinguishes it from the processing of various other bacterial toxins, which has been shown to be important for their cytotoxicity. S1 processing may be mediated primarily by a

  10. Spatially frustrated S = 1 Heisenberg antiferromagnet with single ion anisotropy

    Science.gov (United States)

    Pires, A. S. T.

    2016-10-01

    Using the SU(3) Schwinger boson formalism, I study the S = 1 square lattice Heisenberg antiferromagnet, at zero temperature, with spatially anisotropic nearest-neighbor couplings frustrated by a next-nearest neighbor interaction and single ion anisotropy. The phase diagram at zero temperature is presented. My calculations show two magnetically ordered phases separated by a quantum-disordered region for all values of the anisotropy.

  11. The Global S_1 Tide in Earth's Nutation

    Science.gov (United States)

    Schindelegger, Michael; Einšpigel, David; Salstein, David; Böhm, Johannes

    2016-05-01

    Diurnal S_1 tidal oscillations in the coupled atmosphere-ocean system induce small perturbations of Earth's prograde annual nutation, but matching geophysical model estimates of this Sun-synchronous rotation signal with the observed effect in geodetic Very Long Baseline Interferometry (VLBI) data has thus far been elusive. The present study assesses the problem from a geophysical model perspective, using four modern-day atmospheric assimilation systems and a consistently forced barotropic ocean model that dissipates its energy excess in the global abyssal ocean through a parameterized tidal conversion scheme. The use of contemporary meteorological data does, however, not guarantee accurate nutation estimates per se; two of the probed datasets produce atmosphere-ocean-driven S_1 terms that deviate by more than 30 μ as (microarcseconds) from the VLBI-observed harmonic of -16.2+i113.4 μ as. Partial deficiencies of these models in the diurnal band are also borne out by a validation of the air pressure tide against barometric in situ estimates as well as comparisons of simulated sea surface elevations with a global network of S_1 tide gauge determinations. Credence is lent to the global S_1 tide derived from the Modern-Era Retrospective Analysis for Research and Applications (MERRA) and the operational model of the European Centre for Medium-Range Weather Forecasts (ECMWF). When averaged over a temporal range of 2004 to 2013, their nutation contributions are estimated to be -8.0+i106.0 μ as (MERRA) and -9.4+i121.8 μ as (ECMWF operational), thus being virtually equivalent with the VLBI estimate. This remarkably close agreement will likely aid forthcoming nutation theories in their unambiguous a priori account of Earth's prograde annual celestial motion.

  12. Osmo-, thermo- and ethanol- tolerances of Saccharomyces cerevisiae S1

    Directory of Open Access Journals (Sweden)

    Sandrasegarampillai Balakumar

    2012-03-01

    Full Text Available Saccharomyces cerevisiae S1, which is a locally isolated and improved strain showed viability at 40, 45 and 50ºC and produced ethanol at 40, 43 and 45ºC. When the cells were given heat shock at 45ºC for 30min and grown at 40ºC, 100% viability was observed for 60h, and addition of 200gl-1 ethanol has led to complete cell death at 30h. Heat shock given at 45ºC (for 30min has improved the tolerance to temperature induced ethanol shock leading to 37% viability at 30h. when the cells were subjected to ethanol (200gl-1 for 30 min and osmotic shock (sorbitol 300gl-1, trehalose contents in the cells were increased. The heat shocked cells showed better viability in presence of added ethanol. Soy flour supplementation has improved the viability of S. cerevisiae S1 to 80% in presence of 100gl-1 added ethanol and to 60% in presence of 300gl-1 sorbitol. In presence of sorbitol (200gl-1 and ethanol (50gl-1 at 40ºC, 46% viability was retained by S. cerevisiae S1 at 48h and it was improved to 80% by soy flour supplementation.

  13. Search for ammonia in comet C/2012 S1 (ISON)

    Science.gov (United States)

    Faggi, S.; Codella, C.; Tozzi, G. P.; Comoretto, G.; Crovisier, J.; Nesti, R.; Panella, D.; Boissier, J.; Brucato, J. R.; Bolli, P.; Massi, F.; Tofani, G.

    2015-12-01

    Comets are uniquely pristine bodies providing unique insights about the formation of our Solar System. In this work, we focus on a dynamically new comet as it enters the inner Solar System for the first time after residing for billion of years in the Oort Cloud. Such comets are particularly important because they are thought to be not differentiated by solar radiation and they are supposed to have a large quantity of organic matter close to the surface. Here we report the results of a search for NH3(1,1) emission at 23.7 GHz towards comet C/2012 S1 (ISON) using a new dual-feed K band receiver mounted on the Medicina 32-m antenna. We observed the comet close to its perihelion, from 25 to 29 November 2013, when its heliocentric distance changed from 0.25 AU to 0.03 AU. We derive an upper limit of Q(NH3) of about 2.5×1029 mol s-1 on 26 November, that is consistent with the last peak of water production rate of ∼2×1030 mol s-1 within the last few days before the perihelion.

  14. 白藜芦醇对戊四氮致痫大鼠脑脊液、血清S1OOB蛋白的影响%Effects of Resveratrol on the levels of S100B protein in cerebrospinal fluid and serum of pentylenetetrazole-kindled rats

    Institute of Scientific and Technical Information of China (English)

    孟喜君; 王峰; 李传坤

    2013-01-01

    Objective To study effects of resveratrol on S100B protein in cerebrospinal fluid and serum of pentylenetetrazole (PTZ) kindled rats.Mathods By injected intraperitoneally pentylenetetrazole chronic PTZ-kindling model was established.The resveratrol (Res) was applied intragastrically at a dose of 15 mg/kg once a day for 10 d.Enzyme-linked immmosorbent assay was used to evaluate the levels of S100B protein in cerebrospinal fluid and serum.Hippocampus specimen Nissl staining was used to evaluate the degenerating neurons.Results With a continuous dosing for 28 d,18 rats reached the Racine kindling standard.The seizures latent period in Res group was significantly prolonged,and its duration was significantly lower than those of the epilepsy model group and the dimethylsulfoxide (DMSO) group (P <0.05).Nissl staining indicated Res intervention protected against PTZ-induced death of neuronal cells in CA1 as well as CA3 regions (P <0.05),but not in dentate gyrus (P >0.05).The levels of S100B protein in cerebrospinal fluid and serum in Res intervention group were lower than those of epilepsy model group and DMSO group (P <0.05).Conclusion Res reduces the S100B protein level in cerebrospinal fluid and serum of PTZ-induced seizure rats,which might play a neuroprotective role by alleviating the seizure-induced brain injury.%目的 研究白藜芦醇(Res)对戊四氮致痫大鼠脑脊液、血清S100B蛋白的影响.方法 采用戊四氮(PTZ)腹腔注射建立慢性癫痫模型,造模成功后予以Res(15 mg/kg·d)灌胃干预10 d;采用酶联免疫吸附法测定脑脊液、血清S100B蛋白含量,海马标本行Nissl染色.结果 经28 d连续给药,18只大鼠符合Racine点燃标准,Res干预组大鼠痫性发作潜伏期明显延长,且发作时间明显低于癫痫模型组、二甲基亚砜组(P<0.05).海马Nissl染色提示Res干预对大鼠海马CA1、CA3区神经元有保护作用(P<0.05),而对齿状回保护作用不明显(P>0.05).Res干预

  15. S1P-Yap1 signaling regulates endoderm formation required for cardiac precursor cell migration in zebrafish.

    Science.gov (United States)

    Fukui, Hajime; Terai, Kenta; Nakajima, Hiroyuki; Chiba, Ayano; Fukuhara, Shigetomo; Mochizuki, Naoki

    2014-10-13

    To form the primary heart tube in zebrafish, bilateral cardiac precursor cells (CPCs) migrate toward the midline beneath the endoderm. Mutants lacking endoderm and fish with defective sphingosine 1-phosphate (S1P) signaling exhibit cardia bifida. Endoderm defects lead to the lack of foothold for the CPCs, whereas the cause of cardia bifida in S1P signaling mutants remains unclear. Here we show that S1P signaling regulates CPC migration through Yes-associated protein 1 (Yap1)-dependent endoderm survival. Cardia bifida seen in spns2 (S1P transporter) morphants and s1pr2 (S1P receptor-2) morphants could be rescued by endodermal expression of nuclear localized form of yap1. yap1 morphants had decreased expression of the Yap1/Tead target connective tissue growth factor a (Ctgfa) and consequently increased endodermal cell apoptosis. Consistently, ctgfa morphants showed defects of the endodermal sheet and cardia bifida. Collectively, we show that S1pr2/Yap1-regulated ctgfa expression is essential for the proper endoderm formation required for CPC migration.

  16. Anti-proliferative and apoptotic effects of S1, a tetrandrine derivative, in human gastric cancer BGC-823 cells.

    Science.gov (United States)

    Lei, Rong-Rong; Hu, Hai-Feng; Bai, Fan; Liu, Ying; Wu, Chun-Zhen; Huang, Xiao-Xing; Xie, Li-Ping; Hu, You-Jia

    2016-07-01

    The aim of the study was to investigate the anti-proliferation and apoptosis-inducing effects of S1, a novel tetrandrine derivative, in human gastric cancer BGC-823 cells and explore the possible mechanism of action. The anti-proliferative activity was determined by MTT assay; the induction of cell cycle arrest and apoptosis were detected by flow cytometry. Quantitative real time RT-PCR and Western blotting were used to evaluate the mRNA and protein expression levels in mitochondrial pathway. S1 significantly reduced cell viability and induced a G2/M phase arrest and apoptosis in dose- and time-dependent manner. Further studies showed that S1 increased mRNA and protein expression of Bax and the Bax/Bcl-2 ratio. Moreover, S1 decreased the protein expression of procaspase-9 and procaspase-3, suggesting that the induction of apoptosis may be related to the alteration of the ratio of Bax/Bcl-2 and the activation of caspases. These findings suggested that S1 merits further investigation as a novel therapeutic agent for the treatment of human gastric cancer.

  17. [A comparative study of S-1 plus cisplatin and S-1 plus weekly cisplatin for unresectable gastric cancer].

    Science.gov (United States)

    Kemmochi, Takeshi; Egawa, Tomohisa; Sato, Aya; Umakoshi, Tomoko; Ito, Yasuhiro; Nagashima, Atsushi; Makino, Hiroyuki; Yamamuro, Wataru

    2012-11-01

    Clinical efficacy and safety were analyzed in patients with unresectable gastric cancer receiving S-1 plus CDDP(CS) therapy or S-1 plus weekly CDDP (w-CS) therapy as first-line treatment between April 2007 and December 2010. Fifteen patients received CS therapy and 17 received w-CS therapy. CS therapy was used according to the SPIRITS regimen, and w-CS therapy of S-1 80 mg/(m2·day) was administered for 2 weeks followed by a 1-week rest, with CDDP 20 mg/m2 being injected intravenously on days 1 and 8. In the CS therapy group and w-CS therapy group, the overall response rates were 33.3% and 70.1%, the median overall survival periods were 135 and 174 days (p=0.113), and the median follow- up times were 196 and 352 days (p=0.196), respectively. The w-CS therapy group showed less adverse events than did the CS therapy group. This study suggested that the w-CS regimen is a useful treatment modality showing clinical efficacy and safety for unresectable gastric cancer.

  18. QCD corrections to inclusive $\\Delta S=1,2$ transitions

    OpenAIRE

    Jamin, Matthias

    1994-01-01

    The talk summarises a calculation of the two-point functions for $\\Delta S=1$ current-current and QCD-penguin operators, as well as for the $\\Delta S=2$ operator, at the next-to-leading order. The size of the gluonic corrections to current-current operators is large, providing a qualitative understanding of the observed enhancement in $\\Delta I=1/2$ transitions. In the $\\Delta S=2$ sector the QCD corrections are quite moderate ($\\approx -20\\%$). This work has been done in collaboration with A...

  19. Binding site of hepatitis B virus preS1 region to the asialoglycoprotein receptor of human liver

    Institute of Scientific and Technical Information of China (English)

    JIN Zhe-zhu; LI Mei-hua; WANG Yu-shu; CAI Ying-ji; JIN He-kui; ZHU Wei

    2002-01-01

    @@ The hepatitis B virus (HBV) is a major pathogen of chronic inflammatory liver disease and liver cirrhosis and is known to be infected to the hepatocytes via HBV specific receptors[1]. However, the specific receptor for HBV has not yet been identified. The HBV envelops consist of three related proteins, called major-(S region), middle-(S + preS2) and large protein (S + preS2 + preS1).

  20. The S1 ← S0 fluorescence excitation spectrum and structure of propanal in the S1 excited electronic state.

    Science.gov (United States)

    Godunov, I A; Yakovlev, N N; Terentiev, R V; Maslov, D V; Abramenkov, A V

    2016-06-01

    We have obtained and analyzed the S1 ← S0 fluorescence excitation spectra of jet-cooled propanal-h1 (CH3CH2CHO) and -d1 (CH3CH2CDO). Using the results of theoretical studies of the structure of propanal molecule in the S1 lowest excited singlet electronic state, we have assigned the bands of both spectra to the vibronic transitions of the cis conformer (in the S0 ground electronic state) to the 1 and 3 conformers (in the S1 state) differed by the angle of the C2H5 ethyl group rotation around the central C-C bond. The origins of the 1 ← cis and 3 ← cis electronic transitions have been observed at 29 997 and 30 075 cm(-1) for propanal-h1 and at 30 040 and 30 115 cm(-1) for propanal-d1, respectively. The high activity of torsional (C2H5 ethyl groups) and inversional (CCHO/CCDO carbonyl fragments) vibrations and the intensity distribution of the bands in torsional sequences (passing through maximum) are in agreement with the theoretical prediction that the S1 ← S0 electronic excitation of the cis conformer causes (after geometrical relaxation) the pyramidalization of carbonyl fragments and the rotation of ethyl groups around the central C-C bond. A number of energy levels have been found for torsional and inversional vibrations, and also fundamentals of ν10 (CCO bend) and ν13 (CCC bend) for the both 1 and 3 conformers of propanal-h1 and -d1 have been found. Then the "experimental" potential functions of inversion for the pair of the 1 and 3 conformers have been determined. The heights of potential barriers to inversion and the angle values corresponding to the minima of potential functions of inversion are 900 cm(-1) and 35° for propanal-h1 and 820 cm(-1) and 34° for propanal-d1, respectively.

  1. Mutational analysis of hepatitis B virus pre-S1 (9–24) fusogenic peptide

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Qiushi; Somiya, Masaharu [The Institute of Scientific and Industrial Research, Osaka University, Osaka 567-0047 (Japan); Shimada, Naohiko; Sakamoto, Wakako [Department of Biomolecular Engineering, Tokyo Institute of Technology, 4259 B-57, Nagatsuta, Midori, Yokohama 226-8501 (Japan); Yoshimoto, Nobuo; Iijima, Masumi; Tatematsu, Kenji; Nakai, Tadashi; Okajima, Toshihide [The Institute of Scientific and Industrial Research, Osaka University, Osaka 567-0047 (Japan); Maruyama, Atsushi [Department of Biomolecular Engineering, Tokyo Institute of Technology, 4259 B-57, Nagatsuta, Midori, Yokohama 226-8501 (Japan); Kuroda, Shuńichi, E-mail: skuroda@sanken.osaka-u.ac.jp [The Institute of Scientific and Industrial Research, Osaka University, Osaka 567-0047 (Japan)

    2016-05-27

    A hollow nanoparticle known as a bio-nanocapsule (BNC) consisting of hepatitis B virus (HBV) envelope L protein and liposome (LP) can encapsulate drugs and genes and thereby deliver them in vitro and in vivo to human hepatic tissues, specifically by utilizing the HBV-derived infection machinery. Recently, we identified a low pH-dependent fusogenic domain at the N-terminal part of the pre-S1 region of the HBV L protein (amino acid residues 9 to 24; NPLGFFPDHQLDPAFG), which shows membrane destabilizing activity (i.e., membrane fusion, membrane disruption, and payload release) upon interaction with target LPs. In this study, instead of BNC and HBV, we generated LPs displaying a mutated form of the pre-S1 (9–24) peptide, and performed a membrane disruption assay using target LPs containing pyranine (fluorophore) and p-xylene-bis (N-pyridinium bromide) (DPX) as a quencher. The membrane disruption activity was found to correlate with the hydrophobicity of the whole structure, while the peptide retained a random-coil structure even under low pH condition. One large hydrophobic cluster (I) and one small hydrophobic cluster (II) residing in the peptide would be connected by the protonation of residues D16 and D20, and thereby exhibit strong membrane disruption activity in a low pH-dependent manner. Furthermore, the introduction of a positively charged residue enhanced the activity significantly, suggesting that a sole positively charged residue (H17) may be important for the interaction with target LPs by electrostatic interaction. Collectively, these results suggest that the pre-S1 (9–24) peptide may be involved in the endosomal escape of the BNC's payloads, as well as in the HBV uncoating process. -- Highlights: •Low pH-dependent fusogenic domain of hepatitis B virus pre-S1 region is analyzed. •The domain resides in pre-S1 (9–24) region, exhibiting random-coil structure. •Membrane disruption activity of the domain is mainly driven by its hydrophobicity

  2. Sphingosine 1-phosphate (S1P)/S1P receptor 1 signaling regulates receptor activator of NF-{kappa}B ligand (RANKL) expression in rheumatoid arthritis

    Energy Technology Data Exchange (ETDEWEB)

    Takeshita, Harunori [Division of Rheumatology, Department of Internal Medicine, Hyogo College of Medicine, 1-1 Mukogawa-cho, Nishinomiya, Hyogo 663-8501 (Japan); Kitano, Masayasu, E-mail: mkitano6@hyo-med.ac.jp [Division of Rheumatology, Department of Internal Medicine, Hyogo College of Medicine, 1-1 Mukogawa-cho, Nishinomiya, Hyogo 663-8501 (Japan); Iwasaki, Tsuyoshi [Department of Pharmacy, Hyogo University of Health Sciences, 1-3-6 Minatojima Kobe, Hyogo 650-8530 (Japan); Kitano, Sachie; Tsunemi, Sachi; Sato, Chieri; Sekiguchi, Masahiro; Azuma, Naoto [Division of Rheumatology, Department of Internal Medicine, Hyogo College of Medicine, 1-1 Mukogawa-cho, Nishinomiya, Hyogo 663-8501 (Japan); Miyazawa, Keiji [Discovery Research III, Research and Development, Kissei Pharmaceutical Company, 4365-1 Hodakakashiwara, Azumino, Nagano 399-8304 (Japan); Hla, Timothy [Center for Vascular Biology, Department of Pathology and Laboratory Medicine, Weill Medical College of Cornell University, 1300 York Avenue, Box 69, NY 10065 (United States); Sano, Hajime [Division of Rheumatology, Department of Internal Medicine, Hyogo College of Medicine, 1-1 Mukogawa-cho, Nishinomiya, Hyogo 663-8501 (Japan)

    2012-03-09

    Highlights: Black-Right-Pointing-Pointer MH7A cells and CD4{sup +} T cells expressed S1P1 and RANKL. Black-Right-Pointing-Pointer S1P increased RANKL expression in MH7A cells and CD4{sup +} T cells. Black-Right-Pointing-Pointer The effect of S1P in MH7A cells was inhibited by specific Gi/Go inhibitors. -- Abstract: Sphingosine 1-phosphate (S1P)/S1P receptor 1 (S1P1) signaling plays an important role in synovial cell proliferation and inflammatory gene expression by rheumatoid arthritis (RA) synoviocytes. The purpose of this study is to clarify the role of S1P/S1P1 signaling in the expression of receptor activator of NF-{kappa}B ligand (RANKL) in RA synoviocytes and CD4{sup +} T cells. We demonstrated MH7A cells, a human RA synovial cell line, and CD4{sup +} T cells expressed S1P1 and RANKL. Surprisingly, S1P increased RANKL expression in MH7A cells and CD4{sup +} T cells in a dose-dependent manner. Moreover, S1P enhanced RANKL expression induced by stimulation with TNF-{alpha} in MH7A cells and CD4{sup +} T cells. These effects of S1P in MH7A cells were inhibited by pretreatment with PTX, a specific Gi/Go inhibitor. These findings suggest that S1P/S1P1 signaling may play an important role in RANKL expression by MH7A cells and CD4{sup +} T cells. S1P/S1P1 signaling of RA synoviocytes is closely connected with synovial hyperplasia, inflammation, and RANKL-induced osteoclastogenesis in RA. Thus, regulation of S1P/S1P1 signaling may become a novel therapeutic target for RA.

  3. Knock out of S1P3 receptor signaling attenuates inflammation and fibrosis in bleomycin-induced lung injury mice model.

    Directory of Open Access Journals (Sweden)

    Ken Murakami

    Full Text Available Sphingosine-1-phosphate (S1P is a bioactive sphingolipid metabolite involved in many critical cellular processes, including proliferation, migration, and angiogenesis, through interaction with a family of five G protein-coupled receptors (S1P1-5. Some reports have implicated S1P as an important inflammatory mediator of the pathogenesis of airway inflammation, but the role of S1P3 in the pathogenesis of lung diseases is not completely understood. We used S1P3-deficient (knockout (KO mice to clarify the role of S1P3 receptor signaling in the pathogenesis of pulmonary inflammation and fibrosis using a bleomycin-induced model of lung injury. On the seventh day after bleomycin administration, S1P3 KO mice exhibited significantly less body weight loss and pulmonary inflammation than wild-type (WT mice. On the 28th day, there was less pulmonary fibrosis in S1P3 KO mice than in WT mice. S1P3 KO mice demonstrated a 56% reduction in total cell count in bronchoalveolar lavage fluid (BALF collected on the seventh day compared with WT mice; however, the differential white blood cell profiles were similar. BALF analysis on the seventh day showed that connective tissue growth factor (CTGF levels were significantly decreased in S1P3 KO mice compared with WT mice, although no differences were observed in monocyte chemotactic protein-1 (MCP-1 or transforming growth factor β1 (TGF-β1 levels. Finally, S1P levels in BALF collected on the 7th day after treatment were not significantly different between WT and S1P3 KO mice. Our results indicate that S1P3 receptor signaling plays an important role in pulmonary inflammation and fibrosis and that this signaling occurs via CTGF expression. This suggests that this pathway might be a therapeutic target for pulmonary fibrosis.

  4. Knock out of S1P3 receptor signaling attenuates inflammation and fibrosis in bleomycin-induced lung injury mice model.

    Science.gov (United States)

    Murakami, Ken; Kohno, Masataka; Kadoya, Masatoshi; Nagahara, Hidetake; Fujii, Wataru; Seno, Takahiro; Yamamoto, Aihiro; Oda, Ryo; Fujiwara, Hiroyoshi; Kubo, Toshikazu; Morita, Satoshi; Nakada, Hiroshi; Hla, Timothy; Kawahito, Yutaka

    2014-01-01

    Sphingosine-1-phosphate (S1P) is a bioactive sphingolipid metabolite involved in many critical cellular processes, including proliferation, migration, and angiogenesis, through interaction with a family of five G protein-coupled receptors (S1P1-5). Some reports have implicated S1P as an important inflammatory mediator of the pathogenesis of airway inflammation, but the role of S1P3 in the pathogenesis of lung diseases is not completely understood. We used S1P3-deficient (knockout (KO)) mice to clarify the role of S1P3 receptor signaling in the pathogenesis of pulmonary inflammation and fibrosis using a bleomycin-induced model of lung injury. On the seventh day after bleomycin administration, S1P3 KO mice exhibited significantly less body weight loss and pulmonary inflammation than wild-type (WT) mice. On the 28th day, there was less pulmonary fibrosis in S1P3 KO mice than in WT mice. S1P3 KO mice demonstrated a 56% reduction in total cell count in bronchoalveolar lavage fluid (BALF) collected on the seventh day compared with WT mice; however, the differential white blood cell profiles were similar. BALF analysis on the seventh day showed that connective tissue growth factor (CTGF) levels were significantly decreased in S1P3 KO mice compared with WT mice, although no differences were observed in monocyte chemotactic protein-1 (MCP-1) or transforming growth factor β1 (TGF-β1) levels. Finally, S1P levels in BALF collected on the 7th day after treatment were not significantly different between WT and S1P3 KO mice. Our results indicate that S1P3 receptor signaling plays an important role in pulmonary inflammation and fibrosis and that this signaling occurs via CTGF expression. This suggests that this pathway might be a therapeutic target for pulmonary fibrosis.

  5. S1 gene sequence analysis of a nephropathogenic strain of avian infectious bronchitis virus in Egypt

    Directory of Open Access Journals (Sweden)

    Ladman Brian S

    2006-09-01

    Full Text Available Abstract Background Infectious bronchitis is highly contagious and constitutes one of the most common and difficult poultry diseases to control. IBV is endemic in probably all countries that raise chickens. It exists as dozens of serotypes/genotypes. Only a few amino acid differences in the S1 protein of vaccine and challenge strains of IBV may result in poor protection. Tropism of IBV includes the respiratory tract tissues, proventriculus and caecal tonsils of the alimentary tract, the oviduct and the kidney. Results Infectious bronchitis virus (IBV strain closely related to Massachusetts (Mass serotype was isolated from broiler chickens suffering from severe renal and respiratory distresses. The isolate was serologically identified by Dot-ELISA and further characterized by RT-PCR then genotyped using S1 gene sequence analysis. Alignment of the S1 sequence of the isolate with 16 IBV strains revealed high homology to isolates related to Mass serotype. Inoculation with the strain reproduced the disease in experimental 1-day-old chickens and resulted in 20% mortality, severe renal and moderate respiratory distresses. Marked histopathological changes in both kidney and trachea were observed in experimentally infected chickens. A protection study using the H120 live attenuated vaccine showed low protection rate in spite of high S1 sequence homology (97%. Protection based criteria were: virus re-isolation attempts from trachea, tracheal and renal histopathology as well as IBV antigens detection by immunofluorescent antibody technique in kidney sections. Conclusion Periodical evaluation of cross-protective capabilities of IBV vaccine(s versus recently recovered field isolates should be performed to ensure optimum control of IBV.

  6. Molecular analysis of the bovine coronavirus S1 gene by direct sequencing of diarrheic fecal specimens

    Directory of Open Access Journals (Sweden)

    E. Takiuchi

    2008-04-01

    Full Text Available Bovine coronavirus (BCoV causes severe diarrhea in newborn calves, is associated with winter dysentery in adult cattle and respiratory infections in calves and feedlot cattle. The BCoV S protein plays a fundamental role in viral attachment and entry into the host cell, and is cleaved into two subunits termed S1 (amino terminal and S2 (carboxy terminal. The present study describes a strategy for the sequencing of the BCoV S1 gene directly from fecal diarrheic specimens that were previously identified as BCoV positive by RT-PCR assay for N gene detection. A consensus sequence of 2681 nucleotides was obtained through direct sequencing of seven overlapping PCR fragments of the S gene. The samples did not undergo cell culture passage prior to PCR amplification and sequencing. The structural analysis was based on the genomic differences between Brazilian strains and other known BCoV from different geographical regions. The phylogenetic analysis of the entire S1 gene showed that the BCoV Brazilian strains were more distant from the Mebus strain (97.8% identity for nucleotides and 96.8% identity for amino acids and more similar to the BCoV-ENT strain (98.7% for nucleotides and 98.7% for amino acids. Based on the phylogenetic analysis of the hypervariable region of the S1 subunit, these strains clustered with the American (BCoV-ENT, 182NS and Canadian (BCQ20, BCQ2070, BCQ9, BCQ571, BCQ1523 calf diarrhea and the Canadian winter dysentery (BCQ7373, BCQ2590 strains, but clustered on a separate branch of the Korean and respiratory BCoV strains. The BCoV strains of the present study were not clustered in the same branch of previously published Brazilian strains (AY606193, AY606194. These data agree with the genealogical construction and suggest that at least two different BCoV strains are circulating in Brazil.

  7. Transitive Lie groups on S^1\\times S^{2m}

    Science.gov (United States)

    Gorbatsevich, Vladimir V.

    2007-10-01

    The structure of Lie groups acting transitively on the direct product of a circle and an even-dimensional sphere is described. For products of two spheres of dimension >1 a similar problem has already been solved by other authors. The minimal transitive Lie groups on S^1 and S^{2m} are also indicated. As an application of these results, the structure of the automorphism group of one class of geometric structures, generalized quadrangles (a special case of Tits buildings) is considered. A conjecture put forward by Kramer is proved: the automorphism group of a connected generalized quadrangle of type (1,2m) always contains a transitive subgroup that is the direct product of a compact simple Lie group and a one-dimensional Lie group. Bibliography: 16 titles.

  8. Dynamical instability in the S =1 Bose-Hubbard model

    Science.gov (United States)

    Asaoka, Rui; Tsuchiura, Hiroki; Yamashita, Makoto; Toga, Yuta

    2016-01-01

    We study the dynamical instabilities of superfluid flows in the S =1 Bose-Hubbard model. The time evolution of each spin component in a condensate is calculated based on the dynamical Gutzwiller approximation for a wide range of interactions, from a weakly correlated regime to a strongly correlated regime near the Mott-insulator transition. Owing to the spin-dependent interactions, the superfluid flow of the spin-1 condensate decays at a different critical momentum from a spinless case when the interaction strength is the same. We furthermore calculate the dynamical phase diagram of this model and clarify that the obtained phase boundary has very different features depending on whether the average number of particles per site is even or odd. Finally, we analyze the density and spin modulations that appear in association with the dynamical instability. We find that spin modulations are highly sensitive to the presence of a uniform magnetic field.

  9. Inverse Supersymmetry Breaking in S1 × R3

    Directory of Open Access Journals (Sweden)

    Vasilis Oikonomou

    2010-03-01

    Full Text Available In this paper, we study the influence of hard supersymmetry breaking terms in a N = 1, d = 4 supersymmetric model, in S1 × R3 spacetime topology. It is shown that when the radius of the compact dimension is large supersymmetry is unbroken, and dynamically breaks as the radius decreases. We point out that this resembles the inverse symmetry breaking of continuous symmetries at finite temperature (however, in the case of supersymmetry, the role of the temperature is played by the compact dimension’s radius. Furthermore, we also find a universality in the dependence of the critical length Lc as a function of a coupling g3, after comparing all cases.

  10. S-1 project. Volume I. Architecture. 1979 annual report

    Energy Technology Data Exchange (ETDEWEB)

    1979-01-01

    The US Navy is one of the world's largest users of digital computing equipment having a procurement cost of at least $50,000, and is the single largest such computer customer in the Department of Defense. Its projected acquisition plan for embedded computer systems during the first half of the 80s contemplates the installation of over 10,000 such systems at an estimated cost of several billions of dollars. This expenditure, though large, is dwarfed by the 85 billion dollars which DOD is projected to spend during the next half-decade on computer software, the near-majority of which will be spent by the Navy; the life-cycle costs of the 700,000+ lines of software for a single large Navy weapons systems application (e.g., AEGIS) have been conservatively estimated at most of a billion dollars. The S-1 Project is dedicated to realizing potentially large improvements in the efficiency with which such very large sums may be spent, so that greater military effectiveness may be secured earlier, and with smaller expenditures. The fundamental objectives of the S-1 Project's work are first to enable the Navy to be able to quickly, reliably and inexpensively evaluate at any time what is available from the state-of-the-art in digital processing systems and what the relevance of such systems may be to Navy data processing applications: and second to provide reference prototype systems to support possible competitive procurement action leading to deployment of such systems.

  11. Discovery of potent 3,5-diphenyl-1,2,4-oxadiazole sphingosine-1-phosphate-1 (S1P1) receptor agonists with exceptional selectivity against S1P2 and S1P3.

    Science.gov (United States)

    Li, Zhen; Chen, Weirong; Hale, Jeffrey J; Lynch, Christopher L; Mills, Sander G; Hajdu, Richard; Keohane, Carol Ann; Rosenbach, Mark J; Milligan, James A; Shei, Gan-Ju; Chrebet, Gary; Parent, Stephen A; Bergstrom, James; Card, Deborah; Forrest, Michael; Quackenbush, Elizabeth J; Wickham, L Alexandra; Vargas, Hugo; Evans, Rose M; Rosen, Hugh; Mandala, Suzanne

    2005-10-06

    A class of 3,5-diphenyl-1,2,4-oxadiazole based compounds have been identified as potent sphingosine-1-phosphate-1 (S1P1) receptor agonists with minimal affinity for the S1P2 and S1P3 receptor subtypes. Analogue 26 (S1P1 IC50 = 0.6 nM) has an excellent pharmacokinetics profile in the rat and dog and is efficacious in a rat skin transplant model, indicating that S1P3 receptor agonism is not a component of immunosuppressive efficacy.

  12. Experimental design and environmental parameters affect Rhodospirillum rubrum S1H response to space flight.

    Science.gov (United States)

    Mastroleo, Felice; Van Houdt, Rob; Leroy, Baptiste; Benotmane, M Abderrafi; Janssen, Ann; Mergeay, Max; Vanhavere, Filip; Hendrickx, Larissa; Wattiez, Ruddy; Leys, Natalie

    2009-12-01

    In view of long-haul space exploration missions, the European Space Agency initiated the Micro-Ecological Life Support System Alternative (MELiSSA) project targeting the total recycling of organic waste produced by the astronauts into oxygen, water and food using a loop of bacterial and higher plant bioreactors. In that purpose, the alpha-proteobacterium, Rhodospirillum rubrum S1H, was sent twice to the International Space Station and was analyzed post-flight using a newly developed R. rubrum whole genome oligonucleotide microarray and high throughput gel-free proteomics with Isotope-Coded Protein Label technology. Moreover, in an effort to identify a specific response of R. rubrum S1H to space flight, simulation of microgravity and space-ionizing radiation were performed on Earth under identical culture set-up and growth conditions as encountered during the actual space journeys. Transcriptomic and proteomic data were integrated and permitted to put forward the importance of medium composition and culture set-up on the response of the bacterium to space flight-related environmental conditions. In addition, we showed for the first time that a low dose of ionizing radiation (2 mGy) can induce a significant response at the transcriptomic level, although no change in cell viability and only a few significant differentially expressed proteins were observed. From the MELiSSA perspective, we could argue the effect of microgravity to be minimized, whereas R. rubrum S1H could be more sensitive to ionizing radiation during long-term space exploration mission.

  13. Regulation of human cerebro-microvascular endothelial baso-lateral adhesion and barrier function by S1P through dual involvement of S1P1 and S1P2 receptors.

    Science.gov (United States)

    Wiltshire, Rachael; Nelson, Vicky; Kho, Dan Ting; Angel, Catherine E; O'Carroll, Simon J; Graham, E Scott

    2016-01-27

    Herein we show that S1P rapidly and acutely reduces the focal adhesion strength and barrier tightness of brain endothelial cells. xCELLigence biosensor technology was used to measure focal adhesion, which was reduced by S1P acutely and this response was mediated through both S1P1 and S1P2 receptors. S1P increased secretion of several pro-inflammatory mediators from brain endothelial cells. However, the magnitude of this response was small in comparison to that mediated by TNFα or IL-1β. Furthermore, S1P did not significantly increase cell-surface expression of any key cell adhesion molecules involved in leukocyte recruitment, included ICAM-1 and VCAM-1. Finally, we reveal that S1P acutely and dynamically regulates microvascular endothelial barrier tightness in a manner consistent with regulated rapid opening followed by closing and strengthening of the barrier. We hypothesise that the role of the S1P receptors in this process is not to cause barrier dysfunction, but is related to controlled opening of the endothelial junctions. This was revealed using real-time measurement of barrier integrity using ECIS ZΘ TEER technology and endothelial viability using xCELLigence technology. Finally, we show that these responses do not occur simply though the pharmacology of a single S1P receptor but involves coordinated action of S1P1 and S1P2 receptors.

  14. Protein (Viridiplantae): 225433644 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ED: 30S ribosomal protein S1 homolog Vitis vinifera MIFSGASGSVTGLSILSKLFCWDSSSNTNSSASLLINPSKISSFYRRSPLRRSPFH...PSHSCKEPHKTIQEIAKGLIGSLISVKVILADEEKRKLIFSEKEAAWLKFSKQINIGDIFEAMVGSVEDYGAFVHLRFPDGLYHLTGLVHVSEVSWDLVQDVRDVLNE...GDEVRVKIVKVDRVKSRITLSIKQLEEDPLLETLDKVIPQDGSTGPDSLRTSDSYDIEPLPGLETIFEELLQEEGISDVRISRQGFEKRVVSQDLQLWLSNAPAVDKQFTLLARAGRQVQEIQLTTSLDQEGIKKALQRVLERVP ...

  15. Selecting against S1P3 enhances the acute cardiovascular tolerability of 3-(N-benzyl)aminopropylphosphonic acid S1P receptor agonists.

    Science.gov (United States)

    Hale, Jeffrey J; Doherty, George; Toth, Leslie; Mills, Sander G; Hajdu, Richard; Keohane, Carol Ann; Rosenbach, Mark; Milligan, James; Shei, Gan-Ju; Chrebet, Gary; Bergstrom, James; Card, Deborah; Forrest, Michael; Sun, Shu-Yu; West, Sarah; Xie, Huijuan; Nomura, Naomi; Rosen, Hugh; Mandala, Suzanne

    2004-07-01

    Structurally modified 3-(N-benzylamino)propylphosphonic acid S1P receptor agonists that maintain affinity for S1P1, and have decreased affinity for S1P3 are efficacious, but exhibit decreased acute cardiovascular toxicity in rodents than do nonselective agonists.

  16. Involvement of Sphingosine 1-Phosphate (S1P) Receptor Type 1 and Type 4 in Migratory Response of Mouse T Cells toward S1P

    Institute of Scientific and Technical Information of China (English)

    Hirofumi Matsuyuki; Yasuhiro Maeda; Kazuhiro Yano; Kunio Sugahara; Kenji Chiba; Takayuki Kohno; Yasuyuki Igarashi

    2006-01-01

    Sphingosine 1-phosphate (S1P), a pleiotropic lysophospholipid, regulates signal transduction pathway via Gprotein-coupled receptors termed S1P1-5 in several types of the cells including lymphocytes. Higher levels of S1P4 mRNA as well as S1P1 mRNA are expressed in lymphoid tissues such as the spleen, thymus, lymph nodes, and Payer's patches. In contrast to S1P1 that plays an essential role in lymphocyte egress, little is known about the role of S1P4 in immune system. In this study, we found that S1P at 10 to 100 nM significantly induced the cell migration and the significant levels of S1P1 and S1P4 mRNA were expressed in mouse CD4 T cells, D10.G4.1 mouse Th2 cells,and EL-4.IL-2 mouse thymoma cells. In D10.G4.1 and EL-4.IL-2 cells, S1P-induced migration was almost completely inhibited by pretreatment with pertussis toxin, Clostoridium difficile toxin B, and (S)-enantiomer of FTY720-phosphate, a potent agonist at S1P1 and S1P4. The members of the Rho family small GTPase, Cdc42 and Rac were activated by S1P stimulation in these cells. The transfection with dominant negative or constitutively active forms of Cdc42 and Rac revealed that the activation of both Cdc42 and Rac is essential for S1P-induced migration of these cells. The immunoprecipitation assays using CHO cells co-expressing both S1P4 and S1P1 receptors indicated that S1P4 and S1P1 are associated on the cell surface. These results suggest that the association of S1P4 and S1P1 plays an important role in migratory response of mouse T cells toward S1P.

  17. Effects of S1 Cleavage on the Structure, Surface Export, and Signaling Activity of Human Notch1 and Notch2

    Science.gov (United States)

    Gordon, Wendy R.; Vardar-Ulu, Didem; L'Heureux, Sarah; Ashworth, Todd; Malecki, Michael J.; Sanchez-Irizarry, Cheryll; McArthur, Debbie G.; Histen, Gavin; Mitchell, Jennifer L.; Aster, Jon C.; Blacklow, Stephen C.

    2009-01-01

    Background Notch receptors are normally cleaved during maturation by a furin-like protease at an extracellular site termed S1, creating a heterodimer of non-covalently associated subunits. The S1 site lies within a key negative regulatory region (NRR) of the receptor, which contains three highly conserved Lin12/Notch repeats and a heterodimerization domain (HD) that interact to prevent premature signaling in the absence of ligands. Because the role of S1 cleavage in Notch signaling remains unresolved, we investigated the effect of S1 cleavage on the structure, surface trafficking and ligand-mediated activation of human Notch1 and Notch2, as well as on ligand-independent activation of Notch1 by mutations found in human leukemia. Principal Findings The X-ray structure of the Notch1 NRR after furin cleavage shows little change when compared with that of an engineered Notch1 NRR lacking the S1-cleavage loop. Likewise, NMR studies of the Notch2 HD domain show that the loop containing the S1 site can be removed or cleaved without causing a substantial change in its structure. However, Notch1 and Notch2 receptors engineered to resist S1 cleavage exhibit unexpected differences in surface delivery and signaling competence: S1-resistant Notch1 receptors exhibit decreased, but detectable, surface expression and ligand-mediated receptor activation, whereas S1-resistant Notch2 receptors are fully competent for cell surface delivery and for activation by ligands. Variable dependence on S1 cleavage also extends to T-ALL-associated NRR mutations, as common class 1 mutations display variable decrements in ligand-independent activation when introduced into furin-resistant receptors, whereas a class 2 mutation exhibits increased signaling activity. Conclusions/Significance S1 cleavage has distinct effects on the surface expression of Notch1 and Notch2, but is not generally required for physiologic or pathophysiologic activation of Notch proteins. These findings are consistent with

  18. Effects of S1 cleavage on the structure, surface export, and signaling activity of human Notch1 and Notch2.

    Directory of Open Access Journals (Sweden)

    Wendy R Gordon

    Full Text Available Notch receptors are normally cleaved during maturation by a furin-like protease at an extracellular site termed S1, creating a heterodimer of non-covalently associated subunits. The S1 site lies within a key negative regulatory region (NRR of the receptor, which contains three highly conserved Lin12/Notch repeats and a heterodimerization domain (HD that interact to prevent premature signaling in the absence of ligands. Because the role of S1 cleavage in Notch signaling remains unresolved, we investigated the effect of S1 cleavage on the structure, surface trafficking and ligand-mediated activation of human Notch1 and Notch2, as well as on ligand-independent activation of Notch1 by mutations found in human leukemia.The X-ray structure of the Notch1 NRR after furin cleavage shows little change when compared with that of an engineered Notch1 NRR lacking the S1-cleavage loop. Likewise, NMR studies of the Notch2 HD domain show that the loop containing the S1 site can be removed or cleaved without causing a substantial change in its structure. However, Notch1 and Notch2 receptors engineered to resist S1 cleavage exhibit unexpected differences in surface delivery and signaling competence: S1-resistant Notch1 receptors exhibit decreased, but detectable, surface expression and ligand-mediated receptor activation, whereas S1-resistant Notch2 receptors are fully competent for cell surface delivery and for activation by ligands. Variable dependence on S1 cleavage also extends to T-ALL-associated NRR mutations, as common class 1 mutations display variable decrements in ligand-independent activation when introduced into furin-resistant receptors, whereas a class 2 mutation exhibits increased signaling activity.S1 cleavage has distinct effects on the surface expression of Notch1 and Notch2, but is not generally required for physiologic or pathophysiologic activation of Notch proteins. These findings are consistent with models for receptor activation in which

  19. Effects of S1 Cleavage on the Structure, Surface Export, and Signaling Activity of Human Notch1 and Notch2

    Energy Technology Data Exchange (ETDEWEB)

    Gordon, Wendy R.; Vardar-Ulu, Didem; L' Heureux, Sarah; Ashworth, Todd; Malecki, Michael J.; Sanchez-Irizarry, Cheryll; McArthur, Debbie G.; Histen, Gavin; Mitchell, Jennifer L.; Aster, Jon C.; Blacklow, Stephen C.; (BWH); (Wellesley)

    2009-09-25

    Notch receptors are normally cleaved during maturation by a furin-like protease at an extracellular site termed S1, creating a heterodimer of non-covalently associated subunits. The S1 site lies within a key negative regulatory region (NRR) of the receptor, which contains three highly conserved Lin12/Notch repeats and a heterodimerization domain (HD) that interact to prevent premature signaling in the absence of ligands. Because the role of S1 cleavage in Notch signaling remains unresolved, we investigated the effect of S1 cleavage on the structure, surface trafficking and ligand-mediated activation of human Notch1 and Notch2, as well as on ligand-independent activation of Notch1 by mutations found in human leukemia. The X-ray structure of the Notch1 NRR after furin cleavage shows little change when compared with that of an engineered Notch1 NRR lacking the S1-cleavage loop. Likewise, NMR studies of the Notch2 HD domain show that the loop containing the S1 site can be removed or cleaved without causing a substantial change in its structure. However, Notch1 and Notch2 receptors engineered to resist S1 cleavage exhibit unexpected differences in surface delivery and signaling competence: S1-resistant Notch1 receptors exhibit decreased, but detectable, surface expression and ligand-mediated receptor activation, whereas S1-resistant Notch2 receptors are fully competent for cell surface delivery and for activation by ligands. Variable dependence on S1 cleavage also extends to T-ALL-associated NRR mutations, as common class 1 mutations display variable decrements in ligand-independent activation when introduced into furin-resistant receptors, whereas a class 2 mutation exhibits increased signaling activity. S1 cleavage has distinct effects on the surface expression of Notch1 and Notch2, but is not generally required for physiologic or pathophysiologic activation of Notch proteins. These findings are consistent with models for receptor activation in which ligand-binding or

  20. Confinement on $R^{3}\\times S^{1}$: continuum and lattice

    CERN Document Server

    Ogilvie, Michael C

    2014-01-01

    There has been substantial progress in understanding confinement in a class of four-dimensional SU(N) gauge theories using semiclassical methods. These models have one or more compact directions, and much of the analysis is based on the physics of finite-temperature gauge theories. The topology $R^{3}\\times S^{1}$ has been most often studied, using a small compactification circumference $L$ such that the running coupling $g^{2}\\left(L\\right)$ is small. The gauge action is modified by a double-trace Polyakov loop deformation term, or by the addition of periodic adjoint fermions. The additional terms act to preserve $Z(N)$ symmetry and thus confinement. An area law for Wilson loops is induced by a monopole condensate. In the continuum, the string tension can be computed analytically from topological effects. Lattice models display similar behavior, but the theoretical analysis of topological effects is based on Abelian lattice duality rather than on semiclassical arguments. In both cases the key step is reducin...

  1. Will Comet ISON (C/2012 S1) Survive Perihelion?

    Science.gov (United States)

    Knight, Matthew M.; Walsh, Kevin J.

    2013-10-01

    On 2013 November 28 Comet ISON (C/2012 S1) will pass by the Sun with a perihelion distance of 2.7 solar radii. Understanding the possible outcomes for the comet's response to such a close passage by the Sun is important for planning observational campaigns and for inferring ISON's physical properties. We present new numerical simulations and interpret them in context with the historical track record of comet disruptions and of sungrazing comet behavior. Historical data suggest that sizes below ~200 m are susceptible to destruction by sublimation driven mass loss, while we find that for ISON's perihelion distance, densities lower than 0.1 g cm-3 are required to tidally disrupt a retrograde or non-spinning body. Such low densities are substantially below the range of the best-determined comet nucleus densities, though dynamically new comets such as ISON have few measurements of physical properties. Disruption may occur for prograde rotation at densities up to 0.7 g cm-3, with the chances of disruption increasing for lower density, faster prograde rotation, and increasing elongation of the nucleus. Given current constraints on ISON's nucleus properties and the typically determined values for these properties among all comets, we find tidal disruption to be unlikely unless other factors (e.g., spin-up via torquing) affect ISON substantially. Whether or not disruption occurs, the largest remnant must be big enough to survive subsequent mass loss due to sublimation in order for ISON to remain a viable comet well after perihelion.

  2. Will Comet ISON (C/2012 S1) Survive Perihelion?

    CERN Document Server

    Knight, Matthew M

    2013-01-01

    On 2013 November 28 Comet ISON (C/2012 S1) will pass by the Sun with a perihelion distance of 2.7 solar radii. Understanding the possible outcomes for the comet's response to such a close passage by the Sun is important for planning observational campaigns and for inferring ISON's physical properties. We present new numerical simulations and interpret them in context with the historical track record of comet disruptions and of sungrazing comet behavior. Historical data suggest that sizes below ~200 m are susceptible to destruction by sublimation driven mass loss, while we find that for ISON's perihelion distance, densities lower than 0.1 g cm^-3 are required to tidally disrupt a retrograde or non-spinning body. Such low densities are substantially below the range of the best-determined comet nucleus densities, though dynamically new comets such as ISON have few measurements of physical properties. Disruption may occur for prograde rotation at densities up to 0.7 g cm^-3, with the chances of disruption increas...

  3. Expression of αs1-casein in benign prostatic hyperplasias%乳蛋白αs1-Casein在良性前列腺增生患者中的表达

    Institute of Scientific and Technical Information of China (English)

    赵国栋; 王驭良; 张晓鹏; 许克新; 王晓峰

    2009-01-01

    目的 检测良性前列腺增生(BPH)患者组织中蛋白表达的特点,了解有无与BPH相关的特异性蛋白表达.方法 通过双向电泳方法 所发现的检测BPH组织特异性蛋白表达,αs1-Casein进行定量免疫组化研究来验证该蛋白表达的特异性.结果 通过对正常前列腺组织,BPH及前列腺癌组织进行免疫组织化学染色,发现αs1-Casein在90%(20/22)的BPH组织中呈弱到强表达,而在正常前列腺组织中未见表达(0/10),在前列腺癌组织中的表达也不足10%(3/30).结论 αs1-Casein可能是一种BPH诊断的生物标记物.%Objective To analyze the characteristic of protein profile of benign prostatic hyperplasia (BPH) tissue and to further find the special proteins associated with BPH. Methods Protein profiles of human expressed prostatic secretion (EPS) samples obtained from BPH patients and normal males were comparatively analyzed by two-dimensional gel electrophoresis. In the resulting electrophoretograms, several differentially expressed proteins were identified. In this study, a distinct expressed protein αs1-casein was validated in BPH. Results Immunohistochemistry analysis showed that αs1-casein was mainly distributed in the epithelium of hyperplastic prostate. The level of the exression of αs1-casein in the tissue of BPH was found to be higher than that in prostatic carcinoma; whereas no asl-casein was detected in normal tissue.Western blotting analysis was also revealed same expression pattern of asl-casein was detected in BPH-EPS and BPH-free EPS. Conclusion asl-casein might be associated with BPH development and be used as a potential biological marker for the diagnosis of BPH.

  4. The membrane-associated form of α(s1-casein interacts with cholesterol-rich detergent-resistant microdomains.

    Directory of Open Access Journals (Sweden)

    Annabelle Le Parc

    Full Text Available Caseins, the main milk proteins, interact with colloidal calcium phosphate to form the casein micelle. The mesostructure of this supramolecular assembly markedly influences its nutritional and technological functionalities. However, its detailed molecular organization and the cellular mechanisms involved in its biogenesis have been only partially established. There is a growing body of evidence to support the concept that α(s1-casein takes center stage in casein micelle building and transport in the secretory pathway of mammary epithelial cells. Here we have investigated the membrane-associated form of α(s1-casein in rat mammary epithelial cells. Using metabolic labelling we show that α(s1-casein becomes associated with membranes at the level of the endoplasmic reticulum, with no subsequent increase at the level of the Golgi apparatus. From morphological and biochemical data, it appears that caseins are in a tight relationship with membranes throughout the secretory pathway. On the other hand, we have observed that the membrane-associated form of α(s1-casein co-purified with detergent-resistant membranes. It was poorly solubilised by Tween 20, partially insoluble in Lubrol WX, and substantially insoluble in Triton X-100. Finally, we found that cholesterol depletion results in the release of the membrane-associated form of α(s1-casein. These experiments reveal that the insolubility of α(s1-casein reflects its partial association with a cholesterol-rich detergent-resistant microdomain. We propose that the membrane-associated form of α(s1-casein interacts with the lipid microdomain, or lipid raft, that forms within the membranes of the endoplasmic reticulum, for efficient forward transport and sorting in the secretory pathway of mammary epithelial cells.

  5. High density lipoprotein (HDL)-associated sphingosine 1-phosphate (S1P) inhibits macrophage apoptosis by stimulating STAT3 activity and survivin expression.

    Science.gov (United States)

    Feuerborn, Renata; Becker, Susen; Potì, Francesco; Nagel, Petra; Brodde, Martin; Schmidt, Harmut; Christoffersen, Christina; Ceglarek, Uta; Burkhardt, Ralph; Nofer, Jerzy-Roch

    2017-02-01

    Macrophage apoptosis is critically involved in atherosclerosis. We here examined the effect of anti-atherogenic high density lipoprotein (HDL) and its component sphingosine-1-phosphate (S1P) on apoptosis in RAW264.7 murine macrophages. Mitochondrial or endoplasmic reticulum-dependent apoptosis was induced by exposure of macrophages to etoposide or thapsigargin/fukoidan, respectively. Cell death induced by these compounds was inhibited by S1P as inferred from reduced annexin V binding, TUNEL staining, and caspase 3, 9 and 12 activities. S1P induced expression of the inhibitor of apoptosis protein (IAP) family proteins cIAP1, cIAP2 and survivin, but only the inhibitor of survivin expression YM155 and not the cIAP1/2 blocker GDC0152 reversed the inhibitory effect of S1P on apoptosis. Moreover, S1P activated signal transducer and activator of transcription 3 (STAT3) and Janus kinase 2 (JAK2) and the stimulatory effect of S1P on survivin expression and inhibitory effects on apoptosis were attenuated by STAT3 or JAK2 inhibitors, S3I-201 or AG490, respectively. The effects of S1P on STAT3 activation, survivin expression and macrophage apoptosis were emulated by HDL, HDL lipids, and apolipoprotein (apo) M-containing HDL, but not by apoA-I or HDL deprived of S1P or apoM. In addition, JTE013 and CAY10444, S1P receptor 2 and 3 antagonists, respectively, compromised the S1P and HDL capacities to stimulate STAT3 activation and survivin expression, and to inhibit apoptosis. HDL-associated S1P inhibits macrophage apoptosis by stimulating STAT3 activity and survivin expression. The suppression of macrophage apoptosis may represent a novel mechanism utilized by HDL to exert its anti-atherogenic effects. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  6. Involvement of Pacific oyster CgPGRP-S1S in bacterial recognition, agglutination and granulocyte degranulation.

    Science.gov (United States)

    Iizuka, Masao; Nagasaki, Toshihiro; Takahashi, Keisuke G; Osada, Makoto; Itoh, Naoki

    2014-03-01

    Peptidoglycan recognition protein (PGRP) recognizes invading bacteria through their peptidoglycans (PGN), a component of the bacterial cell wall. Insect PGRPs contribute to effective immune systems as inducers of other host defense responses, while this function has not been reported from PGRP of bivalves. In this study, recombinant CgPGRP-S1S (rCgPGRP-S1S), produced in the mantle and the gill, was synthesized and used to elucidate the immunological function of CgPGRP-S1S. rCgPGRP-S1S bound specifically to DAP-type PGN and to Escherichia coli cells, but not to other DAP-type PGN-containing bacterial species, Vibrio anguillarum, or Bacillus subtilis. Antibacterial activity was not detected, but E. coli cells were agglutinated. Moreover, in addition to these direct interactions with bacterial cells, rCgPGRP-S1S induced secretion of granular contents by hemocyte degranulation. Taken together, these results suggest for the first time that a PGRP of bivalves is, just as in insects, involved in host defense, not only by direct interaction with bacteria, but also by triggering other defense pathways.

  7. Complete genome sequence of Rhodospirillum rubrum type strain (S1T)

    Energy Technology Data Exchange (ETDEWEB)

    Munk, Christine [U.S. Department of Energy, Joint Genome Institute; Copeland, A [U.S. Department of Energy, Joint Genome Institute; Lucas, Susan [U.S. Department of Energy, Joint Genome Institute; Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Glavina Del Rio, Tijana [U.S. Department of Energy, Joint Genome Institute; Barry, Kerrie [U.S. Department of Energy, Joint Genome Institute; Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Hammon, Nancy [U.S. Department of Energy, Joint Genome Institute; Israni, Sanjay [U.S. Department of Energy, Joint Genome Institute; Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Brettin, Thomas S [ORNL; Bruce, David [Los Alamos National Laboratory (LANL); Han, Cliff [Los Alamos National Laboratory (LANL); Tapia, Roxanne [Los Alamos National Laboratory (LANL); Gilna, Paul [University of California, La Jolla; Schmutz, Jeremy [Stanford University; Larimer, Frank W [ORNL; Land, Miriam L [ORNL; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Richardson, P M [U.S. Department of Energy, Joint Genome Institute; Rohde, Manfred [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Zhang, Yaoping [University of Wisconsin, Madison; Roberts, Gary P. [University of Wisconsin, Madison; Reslewic, Susan [University of Wisconsin, Madison; Schwartz, David C. [University of Wisconsin, Madison

    2011-01-01

    Rhodospirillum rubrum (Esmarch 1887) Molisch 1907 is the type species of the genus Rho- dospirillum, which is the type genus of the family Rhodospirillaceae in the class Alphaproteo- bacteria. The species is of special interest because it is an anoxygenic phototroph that pro- duces extracellular elemental sulfur (instead of oxygen) while harvesting light. It contains one of the most simple photosynthetic systems currently known, lacking light harvesting complex 2. Strain S1T can grow on carbon monoxide as sole energy source. With currently over 1,750 PubMed entries, R. rubrum is one of the most intensively studied microbial species, in partic- ular for physiological and genetic studies. Next to R. centenum strain SW, the genome se- quence of strain S1T is only the second genome of a member of the genus Rhodospirillum to be published, but the first type strain genome from the genus. The 4,352,825 bp long chro- mosome and 53,732 bp plasmid with a total of 3,850 protein-coding and 83 RNA genes were sequenced as part of the DOE Joint Genome Institute Program DOEM 2002.

  8. Proteome from lemon fruit flavedo reveals that this tissue produces high amounts of the Cit s1 germin-like isoforms.

    Science.gov (United States)

    Pignataro, Vittorio; Canton, Cristina; Spadafora, Antonia; Mazzuca, Silvia

    2010-06-23

    A multistep procedure has been developed and applied to extract and purify proteins from lemon fruit flavedo. 2DE, LC-ESI-MS/MS, and bioinformatics were used to detect the high abundance of the germin-like glycoprotein Cit s1, a powerful allergen in humans. Peptide alignments against Citrus EST repositories gave the best scores with the C. sinensis cDNA (gi|188354270/EY710037), annotated as unknown sweet orange fruit protein; additional BLAST of peptides against NCBI databases gave high sequence identities with sequence of orange Cit s1 (gi|52782810/P84159), suggesting that the unknown sweet orange fruit protein is consistent with the Cit s1 protein. Peptides of Cit s1 were detected in 17 spots ranging from 120 to 20 kDa, pointing out that in the flavedo of lemon the Cit s1 may be expressed as several isoforms of which the 120 kDa isoform is the largest monomer and the 20 kDa is the smallest one. This finding adds information about the features of Cit s1, because it has been previously reported as a unique monomeric glycoprotein of 24 kDa.

  9. Legionella pneumophila S1P-lyase targets host sphingolipid metabolism and restrains autophagy.

    Science.gov (United States)

    Rolando, Monica; Escoll, Pedro; Nora, Tamara; Botti, Joëlle; Boitez, Valérie; Bedia, Carmen; Daniels, Craig; Abraham, Gilu; Stogios, Peter J; Skarina, Tatiana; Christophe, Charlotte; Dervins-Ravault, Delphine; Cazalet, Christel; Hilbi, Hubert; Rupasinghe, Thusitha W T; Tull, Dedreia; McConville, Malcolm J; Ong, Sze Ying; Hartland, Elizabeth L; Codogno, Patrice; Levade, Thierry; Naderer, Thomas; Savchenko, Alexei; Buchrieser, Carmen

    2016-02-16

    Autophagy is an essential component of innate immunity, enabling the detection and elimination of intracellular pathogens. Legionella pneumophila, an intracellular pathogen that can cause a severe pneumonia in humans, is able to modulate autophagy through the action of effector proteins that are translocated into the host cell by the pathogen's Dot/Icm type IV secretion system. Many of these effectors share structural and sequence similarity with eukaryotic proteins. Indeed, phylogenetic analyses have indicated their acquisition by horizontal gene transfer from a eukaryotic host. Here we report that L. pneumophila translocates the effector protein sphingosine-1 phosphate lyase (LpSpl) to target the host sphingosine biosynthesis and to curtail autophagy. Our structural characterization of LpSpl and its comparison with human SPL reveals high structural conservation, thus supporting prior phylogenetic analysis. We show that LpSpl possesses S1P lyase activity that was abrogated by mutation of the catalytic site residues. L. pneumophila triggers the reduction of several sphingolipids critical for macrophage function in an LpSpl-dependent and -independent manner. LpSpl activity alone was sufficient to prevent an increase in sphingosine levels in infected host cells and to inhibit autophagy during macrophage infection. LpSpl was required for efficient infection of A/J mice, highlighting an important virulence role for this effector. Thus, we have uncovered a previously unidentified mechanism used by intracellular pathogens to inhibit autophagy, namely the disruption of host sphingolipid biosynthesis.

  10. Adenylate cyclase toxin-mediated delivery of the S1 subunit of pertussis toxin into mammalian cells.

    Science.gov (United States)

    Iwaki, Masaaki; Konda, Toshifumi

    2016-02-01

    The adenylate cyclase toxin (ACT) of Bordetella pertussis internalizes its catalytic domain into target cells. ACT can function as a tool for delivering foreign protein antigen moieties into immune effector cells to induce a cytotoxic T lymphocyte response. In this study, we replaced the catalytic domain of ACT with an enzymatically active protein moiety, the S1 (ADP-ribosyltransferase) subunit of pertussis toxin (PT). The S1 moiety was successfully internalized independent of endocytosis into sheep erythrocytes. The introduced polypeptide exhibited ADP-ribosyltransferase activity in CHO cells and induced clustering typical to PT. The results indicate that ACT can act as a vehicle for not only epitopes but also enzymatically active peptides to mammalian cells.

  11. Ramsey Number of K2,s+1 vs. K1,n%关于K2,s+1 VS,K1,n的Ramsey数

    Institute of Scientific and Technical Information of China (English)

    秦大伟; 沈大鹏

    2007-01-01

    It is shown that the Ramsey number r(K2,s+1, K1,n) ≤ n + √sn+ (s + 3)/2 + o(1) for large n, and r(K2,s+1, K1,n)∈{(q-1)2/s+1,-(q-1)2/s+2},wheren: (q-1)2/s-q+2 and q is a prime power such that s|(q - 1).

  12. The SphKs/S1P/S1PR1 axis in immunity and cancer: more ore to be mined.

    Science.gov (United States)

    Jin, Lei; Liu, Wei-Ren; Tian, Meng-Xin; Fan, Jia; Shi, Ying-Hong

    2016-04-29

    Over the past two decades, huge amounts of research were launched to understand the functions of sphingosine. Many pathways were uncovered that convey the relative functions of biomacromolecules. In this review, we discuss the recent advances of the role of the SphKs/S1P/S1PR1 axis in immunity and cancer. Finally, we investigate the therapeutic potential of new drugs that target S1P signaling in cancer therapy.

  13. Hypothalamic S1P/S1PR1 axis controls energy homeostasis in Middle-Aged Rodents: the reversal effects of physical exercise

    Science.gov (United States)

    Silva, Vagner Ramon Rodrigues; Katashima, Carlos Kiyoshi; Bueno Silva, Carla G.; Lenhare, Luciene; Micheletti, Thayana Oliveira; Camargo, Rafael Ludemann; Ghezzi, Ana Carolina; Camargo, Juliana Alves; Assis, Alexandre Moura; Tobar, Natalia; Morari, Joseane; Razolli, Daniela S.; Moura, Leandro Pereira; Pauli, José Rodrigo; Cintra, Dennys Esper; Velloso, Lício Augusto; Saad, Mario J.A; Ropelle, Eduardo Rochete

    2017-01-01

    Recently, we demonstrated that the hypothalamic S1PR1/STAT3 axis plays a critical role in the control of food consumption and energy expenditure in rodents. Here, we found that reduction of hypothalamic S1PR1 expression occurs in an age-dependent manner, and was associated with defective thermogenic signaling and weight gain. To address the physiological relevance of these findings, we investigated the effects of chronic and acute exercise on the hypothalamic S1PR1/STAT3 axis. Chronic exercise increased S1PR1 expression and STAT3 phosphorylation in the hypothalamus, restoring the anorexigenic and thermogenic signals in middle-aged mice. Acutely, exercise increased sphingosine-1-phosphate (S1P) levels in the cerebrospinal fluid (CSF) of young rats, whereas the administration of CSF from exercised young rats into the hypothalamus of middle-aged rats at rest was sufficient to reduce the food intake. Finally, the intracerebroventricular (ICV) administration of S1PR1 activators, including the bioactive lipid molecule S1P, and pharmacological S1PR1 activator, SEW2871, induced a potent STAT3 phosphorylation and anorexigenic response in middle-aged rats. Overall, these results suggest that hypothalamic S1PR1 is important for the maintenance of energy balance and provide new insights into the mechanism by which exercise controls the anorexigenic and thermogenic signals in the central nervous system during the aging process. PMID:28039439

  14. S-1 induced secondary acute erythroid leukemia with a chromosome inv(12)(p13;q13)

    Institute of Scientific and Technical Information of China (English)

    Kensuke Matsumoto; Akira Kitanaka; Makiko Uemura; Fusako Waki; Tetsuya Fukumoto; Hiroaki Ohnishi; Yoshitsugu Kubota; Toshihiko Ishida

    2011-01-01

    Adjuvant chemotherapy by S-1 following gastrectomy is considered standard treatment in Japan. Analysis of follow-up data have proved the efficacy of S-1 administration,and that hematological adverse events were relatively rare. PPyrimidine anti-metabolites, including S-1, have shown relatively lower risks for secondary hematological malignancies in comparison to alkylating agents and topoisomerase-Ⅱ inhibitors. We here report a case of therapy-related leukemia after S-1 administration. A patient who had received S-1as the sole adjuvant chemotherapy was diagnosed with acute erythroid leukemia. To the best of our knowledge, our patient represents the first report of S-1 induced acute leukemia.

  15. S-1 monotherapy versus S-1 combination therapy in gemcitabine-refractory advanced pancreatic cancer: A meta-analysis (PRISMA) of randomized control trials.

    Science.gov (United States)

    Zhong, Sheng; Qie, Shuai; Yang, Liu; Yan, Qi; Ge, Linna; Wang, Zhongfeng

    2017-07-01

    Pancreatic cancer (PC) is one of the most lethal digestive system tumors. Most new cases are diagnosed based on metastasis or local aggression and are known as "advanced PC." Recently, studies investigating S-1 have indicated that it has a better clinical curative effect on PC. We conducted a meta-analysis to evaluate the efficacy and safety of S-1 monotherapy compared with S-1 combination regimens in patients with gemcitabine (GEM)-refractory PC. Trials published between 1978 and 2016 were identified by an electronic search of public databases (Medline, Embase, and the Cochrane Library). All prospective studies were independently identified by 2 authors for inclusion. The response rate (RR), progression-free and overall survival (PFS and OS, respectively), and the primary toxicities were extracted for the meta-analysis. Four randomized controlled trials consisting of 623 patients were included in the analysis, among which 315 patients underwent S-1 monotherapy and 308 patients underwent S-1 combination therapy. The pooled data showed a significantly higher response rate and longer PFS in the S-1 combination group than in the S-1 monotherapy group (RR, 1.75; 95% confidence interval [CI], 1.19-2.57; P = .005 and hazard ration [HR], 0.75; 95% CI, 0.62-0.91; P = .005). There were no significant differences in OS or adverse events. Compared with the S-1 monotherapy group, the S-1 combination group had a higher response rate and longer PFS. Both groups had few adverse events, which were balanced between the groups. The subgroup analysis suggested that S-1 combination regimens with leucovorin or irinotecan (CPT-11) provided promising efficacy. These promising combination regimens should be considered for patients with advanced PC who choose S-1 as their second-line therapy.

  16. A prokaryotic S1P lyase degrades extracellular S1P in vitro and in vivo: implication for treating hyperproliferative disorders.

    Directory of Open Access Journals (Sweden)

    Andrea Huwiler

    Full Text Available Sphingosine-1-phosphate (S1P regulates a broad spectrum of fundamental cellular processes like proliferation, death, migration and cytokine production. Therefore, elevated levels of S1P may be causal to various pathologic conditions including cancer, fibrosis, inflammation, autoimmune diseases and aberrant angiogenesis. Here we report that S1P lyase from the prokaryote Symbiobacterium thermophilum (StSPL degrades extracellular S1P in vitro and in blood. Moreover, we investigated its effect on cellular responses typical of fibrosis, cancer and aberrant angiogenesis using renal mesangial cells, endothelial cells, breast (MCF-7 and colon (HCT 116 carcinoma cells as disease models. In all cell types, wild-type StSPL, but not an inactive mutant, disrupted MAPK phosphorylation stimulated by exogenous S1P. Functionally, disruption of S1P receptor signaling by S1P depletion inhibited proliferation and expression of connective tissue growth factor in mesangial cells, proliferation, migration and VEGF expression in carcinoma cells, and proliferation and migration of endothelial cells. Upon intravenous injection of StSPL in mice, plasma S1P levels rapidly declined by 70% within 1 h and then recovered to normal 6 h after injection. Using the chicken chorioallantoic membrane model we further demonstrate that also under in vivo conditions StSPL, but not the inactive mutant, inhibited tumor cell-induced angiogenesis as an S1P-dependent process. Our data demonstrate that recombinant StSPL is active under extracellular conditions and holds promise as a new enzyme therapeutic for diseases associated with increased levels of S1P and S1P receptor signaling.

  17. HDL-associated ApoM is anti-apoptotic by delivering sphingosine 1-phosphate to S1P1 & S1P3 receptors on vascular endothelium.

    Science.gov (United States)

    Ruiz, Mario; Okada, Hiromi; Dahlbäck, Björn

    2017-02-08

    High-density Lipoprotein (HDL) attenuates endothelial cell apoptosis induced by different cell-death stimuli such as oxidation or growth factor deprivation. HDL is the main plasma carrier of the bioactive lipid sphingosine 1-phosphate (S1P), which it is a signaling molecule that promotes cell survival in response to several apoptotic stimuli. In HDL, S1P is bound to Apolipoprotein M (ApoM), a Lipocalin that is only present in around 5% of the HDL particles. The goal of this study is to characterize ApoM-bound S1P role in endothelial apoptosis protection and the signaling pathways involved. Human umbilical vein endothelial cells (HUVEC) cultures were switched to serum/grow factor deprivation medium to induce apoptosis and the effect caused by the addition of ApoM and S1P analyzed. The addition of HDL(+ApoM) or recombinant ApoM-bound S1P promoted cell viability and blocked apoptosis, whereas HDL(-ApoM) had no protective effect. Remarkably, S1P exerted a more potent anti-apoptotic effect when carried by ApoM as compared to albumin, or when added as free molecule. Mechanistically, cooperation between S1P1 and S1P3 was required for the HDL/ApoM/S1P-mediated anti-apoptotic ability. Furthermore, AKT and ERK phosphorylation was also necessary to achieve the anti-apoptotic effect of the HDL/ApoM/S1P complex. Altogether, our results indicate that ApoM and S1P are key elements of the anti-apoptotic activity of HDL and promote optimal endothelial function.

  18. Mechanism of Folding and Activation of Subtilisin Kexin Isozyme-1 (SKI-1)/Site-1 Protease (S1P).

    Science.gov (United States)

    da Palma, Joel Ramos; Cendron, Laura; Seidah, Nabil Georges; Pasquato, Antonella; Kunz, Stefan

    2016-01-29

    The proprotein convertase subtilisin kexin isozyme-1 (SKI-1)/site-1 protease (S1P) is implicated in lipid homeostasis, the unfolded protein response, and lysosome biogenesis. The protease is further hijacked by highly pathogenic emerging viruses for the processing of their envelope glycoproteins. Zymogen activation of SKI-1/S1P requires removal of an N-terminal prodomain, by a multistep process, generating the mature enzyme. Here, we uncover a modular structure of the human SKI-1/S1P prodomain and define its function in folding and activation. We provide evidence that the N-terminal AB fragment of the prodomain represents an autonomous structural and functional unit that is necessary and sufficient for folding and partial activation. In contrast, the C-terminal BC fragment lacks a defined structure but is crucial for autoprocessing and full catalytic activity. Phylogenetic analysis revealed that the sequence of the AB domain is highly conserved, whereas the BC fragment shows considerable variation and seems even absent in some species. Notably, SKI-1/S1P of arthropods, like the fruit fly Drosophila melanogaster, contains a shorter prodomain comprised of full-length AB and truncated BC regions. Swapping the prodomain fragments between fly and human resulted in a fully mature and active SKI-1/S1P chimera. Our study suggests that primordial SKI-1/S1P likely contained a simpler prodomain consisting of the highly conserved AB fragment that represents an independent folding unit. The BC region appears as a later evolutionary acquisition, possibly allowing more subtle fine-tuning of the maturation process.

  19. Chemical and Biological Properties of S-1-Propenyl-ʟ-Cysteine in Aged Garlic Extract

    Directory of Open Access Journals (Sweden)

    Yukihioro Kodera

    2017-03-01

    Full Text Available S-1-Propenyl-ʟ-cysteine (S1PC is a stereoisomer of S-1-Propenyl-ʟ-cysteine (SAC, an important sulfur-containing amino acid that plays a role for the beneficial pharmacological effects of aged garlic extract (AGE. The existence of S1PC in garlic preparations has been known since the 1960’s. However, there was no report regarding the biological and/or pharmacological activity of S1PC until 2016. Recently, we performed a series of studies to examine the chemical, biological, pharmacological and pharmacokinetic properties of S1PC, and obtained some interesting results. S1PC existed only in trace amounts in raw garlic, but its concentration increased almost up to the level similar of SAC through aging process of AGE. S1PC showed immunomodulatory effects in vitro and in vivo, and reduced blood pressure in a hypertensive animal model. A pharmacokinetic study revealed that S1PC was readily absorbed after oral administration in rats and dogs with bioavailability of 88–100%. Additionally, S1PC had little inhibitory influence on human cytochrome P450 activities, even at a concentration of 1 mM. Based on these findings, S1PC was suggested to be another important, pharmacologically active and safe component of AGE similar to SAC. In this review, we highlight some results from recent studies on S1PC and discuss the potential medicinal value of S1PC.

  20. Chemical and Biological Properties of S-1-Propenyl-l-Cysteine in Aged Garlic Extract.

    Science.gov (United States)

    Kodera, Yukihioro; Ushijima, Mitsuyasu; Amano, Hirotaka; Suzuki, Jun-Ichiro; Matsutomo, Toshiaki

    2017-03-31

    S-1-Propenyl-l-cysteine (S1PC) is a stereoisomer of S-1-Propenyl-l-cysteine (SAC), an important sulfur-containing amino acid that plays a role for the beneficial pharmacological effects of aged garlic extract (AGE). The existence of S1PC in garlic preparations has been known since the 1960's. However, there was no report regarding the biological and/or pharmacological activity of S1PC until 2016. Recently, we performed a series of studies to examine the chemical, biological, pharmacological and pharmacokinetic properties of S1PC, and obtained some interesting results. S1PC existed only in trace amounts in raw garlic, but its concentration increased almost up to the level similar of SAC through aging process of AGE. S1PC showed immunomodulatory effects in vitro and in vivo, and reduced blood pressure in a hypertensive animal model. A pharmacokinetic study revealed that S1PC was readily absorbed after oral administration in rats and dogs with bioavailability of 88-100%. Additionally, S1PC had little inhibitory influence on human cytochrome P450 activities, even at a concentration of 1 mM. Based on these findings, S1PC was suggested to be another important, pharmacologically active and safe component of AGE similar to SAC. In this review, we highlight some results from recent studies on S1PC and discuss the potential medicinal value of S1PC.

  1. The phylogeny of C/S1 bZIP transcription factors reveals a shared algal ancestry and the pre-angiosperm translational regulation of S1 transcripts

    NARCIS (Netherlands)

    Peviani, Alessia; Lastdrager, Jeroen; Hanson, Johannes; Snel, Berend

    2016-01-01

    Basic leucine zippers (bZIPs) form a large plant transcription factor family. C and S1 bZIP groups can heterodimerize, fulfilling crucial roles in seed development and stress response. S1 sequences also harbor a unique regulatory mechanism, termed Sucrose-Induced Repression of Translation (SIRT). Th

  2. Effect of S1P5 on proliferation and migration of human esophageal cancer cells

    OpenAIRE

    Hu, Wei-Min; Li, Li; Jing, Bao-Qian; Zhao, Yong-Sheng; Wang, Chao-Li; Feng, Li; Xie, Yong-En

    2010-01-01

    AIM: To investigate the sphingosine 1-phosphate (S1P) receptor expression profile in human esophageal cancer cells and the effects of S1P5 on proliferation and migration of human esophageal cancer cells.

  3. Moesin controls clathrin-mediated S1PR1 internalization in T cells.

    Directory of Open Access Journals (Sweden)

    Akira Nomachi

    Full Text Available The lipid mediator sphingosine 1-phosphate (S1P regulates a wide range of cellular activities, including vascular maturation, angiogenesis, and immune-cell trafficking. Among the five known receptors for S1P (S1PR1-S1PR5, S1PR1 is a critical regulator of lymphocyte trafficking: its signaling is required for lymphocyte egress from lymphoid organs, while its down-modulation by agonist-induced internalization is a prerequisite for lymphocyte entry into lymphoid organs from the bloodstream. Despite the importance of S1PR1 down-regulation in determining lymphocyte behavior, the molecular mechanism of its internalization in lymphocytes has not been defined. Here we show that agonist-induced S1PR1 internalization in T cells occurs via clathrin-mediated endocytosis and is regulated by moesin, an ezrin-radixin-moesin (ERM family member. In S1P-stimulated T cells, S1PR1 relocalized within clathrin-coated vesicles (CCVs and early endosomes, and S1PR1 internalization was blocked when clathrin was pharmacologically inhibited. Stimulating moesin-deficient T cells with S1P failed to induce S1PR1 internalization and CCV formation. Furthermore, treating moesin-deficient mice with FTY720, an S1P receptor agonist known to internalize S1PR1, caused delayed lymphopenia, and lymphocytes isolated from FTY720-treated moesin-deficient mice still responded to S1P ex vivo in chemotaxis assays. These results reveal a novel role for moesin in regulating clathrin-dependent S1PR1 internalization through CCV formation.

  4. HDL-S1P: cardiovascular functions, disease-associated alterations, and therapeutic applications.

    Science.gov (United States)

    Levkau, Bodo

    2015-01-01

    Sphingosine-1-phosphate (S1P) is a bioactive sphingolipid contained in High-density lipoproteins (HDL) and has drawn considerable attention in the lipoprotein field as numerous studies have demonstrated its contribution to several functions inherent to HDL. Some of them are partly and some entirely due to the S1P contained in HDL (HDL-S1P). Despite the presence of over 1000 different lipids in HDL, S1P stands out as it possesses its own cell surface receptors through which it exercises key physiological functions. Most of the S1P in human plasma is associated with HDL, and the amount of HDL-S1P influences the quality and quantity of HDL-dependent functions. The main binding partner of S1P in HDL is apolipoprotein M but others may also exist particularly under conditions of acute S1P elevations. HDL not only exercise functions through their S1P content but have also an impact on genuine S1P signaling by influencing S1P bioactivity and receptor presentation. HDL-S1P content is altered in human diseases such as atherosclerosis, coronary artery disease, myocardial infarction, renal insufficiency and diabetes mellitus. Low HDL-S1P has also been linked to impaired HDL functions associated with these disorders. Although the pathophysiological and molecular reasons for such disease-associated shifts in HDL-S1P are little understood, there have been successful approaches to circumvent their adverse implications by pharmacologically increasing HDL-S1P as means to improve HDL function. This mini-review will cover the current understanding of the contribution of HDL-S1P to physiological HDL function, its alteration in disease and ways for its restoration to correct HDL dysfunction.

  5. HDL-S1P: cardiovascular functions, disease-associated alterations, and therapeutic applications

    Science.gov (United States)

    Levkau, Bodo

    2015-01-01

    Sphingosine-1-phosphate (S1P) is a bioactive sphingolipid contained in High-density lipoproteins (HDL) and has drawn considerable attention in the lipoprotein field as numerous studies have demonstrated its contribution to several functions inherent to HDL. Some of them are partly and some entirely due to the S1P contained in HDL (HDL-S1P). Despite the presence of over 1000 different lipids in HDL, S1P stands out as it possesses its own cell surface receptors through which it exercises key physiological functions. Most of the S1P in human plasma is associated with HDL, and the amount of HDL-S1P influences the quality and quantity of HDL-dependent functions. The main binding partner of S1P in HDL is apolipoprotein M but others may also exist particularly under conditions of acute S1P elevations. HDL not only exercise functions through their S1P content but have also an impact on genuine S1P signaling by influencing S1P bioactivity and receptor presentation. HDL-S1P content is altered in human diseases such as atherosclerosis, coronary artery disease, myocardial infarction, renal insufficiency and diabetes mellitus. Low HDL-S1P has also been linked to impaired HDL functions associated with these disorders. Although the pathophysiological and molecular reasons for such disease-associated shifts in HDL-S1P are little understood, there have been successful approaches to circumvent their adverse implications by pharmacologically increasing HDL-S1P as means to improve HDL function. This mini-review will cover the current understanding of the contribution of HDL-S1P to physiological HDL function, its alteration in disease and ways for its restoration to correct HDL dysfunction. PMID:26539121

  6. Estudo do polimorfismo genético da α S1-caseína em cabras, no Estado de Pernambuco, Brasil = Study of the genetic polymorphism of the α S1-casein in goats of Pernambuco State, Brazil

    Directory of Open Access Journals (Sweden)

    Ariosto Afonso da Silva

    2007-07-01

    Full Text Available O Estado de Pernambuco tem uma vocação pecuária, especialmente, para aexploração de caprinos. Dentre as proteínas, chamadas de caseínas, a αS1-caseína foi a primeira proteína comprovada com base no polimorfismo genético. Objetivando realizar a genotipagem de cabras criadas no sertão, agreste e zona da mata do Estado de Pernambuco, por meio da técnica de PCR-RFLP, estudou-se o polimorfismo do gene da aS1-caseína. Utilizaram-se 60 animais, divididos em três grupos de 20 animais, das raças Moxotó, Alpina Americana e SRD (Sem Raça Definida. A extração do DNA foi realizada com a utilização do protocolo fenol-clorofórmio, e o gene da aS1-caseína foi amplificado por meio da PCR (reação da polimerase em cadeia. Em seguida, foi utilizada a enzima de restrição XmnI para obter a freqüência alélica das raças estudadas. Encontrou-se, nos caprinos, os alelos da aS1-caseína B e D que foram predominantes para a raça nativa Moxotó e animais SRD (100%, e os alelos C e D, para a raça Alpina Americana(100%, concluindo-se que existem variações genéticas para o gene da aS1-caseína do leite das raças caprinas estudadas, embora se evidencie a proximidade genética entre a Moxotó e SRD.The Pernambuco State, has been a livestock area, mainly for thecaprine exploration. Among the proteins, called caseins, the αS1-casein was the first proved protein with base in the genetic polymorphism. To genotype goats of the “sertão”, “agreste” and “zona da mata” regions of the Brazilian State of Pernambuco, through the PCR-RFLP technique, we studied the polymorphism of the αS1-casein gene. Sixty animals were used, divided in three groups of twenty animals of the races Moxotó, American Alpine and UB (Undefined Breed. The DNA extraction was done by the phenol-chloroform protocol and the αS1-casein gene was amplified through the PCR (Polymerase Chain Reaction. Then, the restriction enzyme XmnI was used to obtain the allele

  7. The activation of RhoC in vascular endothelial cells is required for the S1P receptor type 2-induced inhibition of angiogenesis.

    Science.gov (United States)

    Del Galdo, Sabrina; Vettel, Christiane; Heringdorf, Dagmar Meyer Zu; Wieland, Thomas

    2013-12-01

    Sphingosine-1-phosphate (S1P) is a multifunctional phospholipid inducing a variety of cellular responses in endothelial cells (EC). S1P responses are mediated by five G protein coupled receptors of which three types (S1P1R-S1P3R) have been described to be of importance in vascular endothelial cells (EC). Whereas the S1P1R regulates endothelial barrier function by coupling to Gαi and the monomeric GTPase Rac1, the signaling pathways involved in the S1P-induced regulation of angiogenesis are ill defined. We therefore studied the sprouting of human umbilical vein EC (HUVEC) in vitro and analyzed the activation of the RhoGTPases RhoA and RhoC. Physiological relevant concentrations of S1P (100-300nM) induce a moderate activation of RhoA and RhoC. Inhibition or siRNA-mediated depletion of the S1P2R preferentially decreased the activation of RhoC. Both manipulations caused an increase of sprouting in a spheroid based in vitro sprouting assay. Interestingly, a similar increase in sprouting was detected after effective siRNA-mediated knockdown of RhoC. In contrast, the depletion of RhoA had no influence on sprouting. Furthermore, suppression of the activity of G proteins of the Gα12/13 subfamily by adenoviral overexpression of the regulator of G protein signaling domain of LSC as well as siRNA-mediated knockdown of the Rho specific guanine nucleotide exchange factor leukemia associated RhoGEF (LARG) inhibited the S1P-induced activation of RhoC and concomitantly increased sprouting of HUVEC with similar efficacy. We conclude that the angiogenic sprouting of EC is suppressed via the S1P2R subtype. Thus, the increase in basal sprouting can be attributed to blocking of the inhibitory action of autocrine S1P stimulating the S1P2R. This inhibitory pathway involves the activation of RhoC via Gα12/13 and LARG, while the simultaneously occurring activation of RhoA is apparently dispensable here.

  8. Therapeutic use of a selective S1P1 receptor modulator ponesimod in autoimmune diabetes.

    Directory of Open Access Journals (Sweden)

    Sylvaine You

    Full Text Available In the present study, we investigated the therapeutic potential of a selective S1P1 receptor modulator, ponesimod, to protect and reverse autoimmune diabetes in non-obese diabetic (NOD mice. Ponesimod was administered orally to NOD mice starting at 6, 10, 13 and 16 weeks of age up to 35 weeks of age or to NOD mice showing recent onset diabetes. Peripheral blood and spleen B and T cell counts were significantly reduced after ponesimod administration. In pancreatic lymph nodes, B lymphocytes were increased and expressed a transitional 1-like phenotype. Chronic oral ponesimod treatment efficiently prevented autoimmune diabetes in 6, 10 and 16 week-old pre-diabetic NOD mice. Treatment withdrawal led to synchronized disease relapse. Ponesimod did not inhibit the differentiation of autoreactive T cells as assessed by adoptive transfer of lymphocytes from treated disease-free NOD mice. In addition, it did not affect the migration, proliferation and activation of transgenic BDC2.5 cells into the target tissue. However, ponesimod inhibited spreading of the T cell responses to islet-specific glucose-6-phosphatase catalytic subunit-related protein (IGRP. Treatment of diabetic NOD mice with ponesimod induced disease remission. However, here again, upon treatment cessation, the disease rapidly recurred. This recurrence was effectively prevented by combination treatment with a CD3 antibody leading to the restoration of self-tolerance. In conclusion, treatment with a selective S1P1 modulator in combination with CD3 antibody represents a promising therapeutic approach for the treatment of autoimmune diabetes.

  9. Phylogenetic analysis of S1 gene of infectious bronchitis virus isolates from China.

    Science.gov (United States)

    Yan, Fang; Zhao, Yujun; Yue, Wenbin; Yao, J; Lihua, Lv; Ji, Wenhui; Li, Xuying; Liu, Fengbo; Wu, Qian

    2011-09-01

    Between 2006 and 2009, seven strains of infectious bronchitis (IB) virus (IBV) were isolated from vaccinated chicken flocks on different chicken farms in China. The pathogenic characters of seven IBV strains were assessed. Each of the seven strains was infective to the test chickens and could induce an immune response. The results from chicken embryo cross-neutralization assays showed that these strains were antigenically distinct from classic IBV strains of H120, M41, Conn, and Gray. Compared to H120 vaccine strain, point mutation, short insertion, and deletion occurred at many positions in the S1 protein of the seven strains. Five of the seven strains had the motif (HRRRR), which was identical to that of the epidemic IBV strains in China. Two new motifs (HRLRR and RRIRR) emerged in the isolated strains. The homology of the nucleotide and amino acid sequences of the S1 gene among the seven isolates was 81.7%-99.7% and 79.0%-99.4%, respectively. These seven strains were also genetically different from the vaccine strains and non-China IBV strains but closely related to large numbers of Chinese strains. The seven isolates and 36 reference IBV strains were clustered into six distinct groups (I-VI). The seven strains were categorized into groups I, II, and III, forming a big phylogenetic branch, which is closely related to Chinese IBVs, whereas the vaccine strains belonging to group VI are genetically distant from groups I, II, and III. The results from this study indicate that different IBV strains cocirculate in the chicken population in China.

  10. The clinically-tested S1P receptor agonists, FTY720 and BAF312, demonstrate subtype-specific bradycardia (S1P₁ and hypertension (S1P₃ in rat.

    Directory of Open Access Journals (Sweden)

    Ryan M Fryer

    Full Text Available Sphingosine-1-phospate (S1P and S1P receptor agonists elicit mechanism-based effects on cardiovascular function in vivo. Indeed, FTY720 (non-selective S1P(X receptor agonist produces modest hypertension in patients (2-3 mmHg in 1-yr trial as well as acute bradycardia independent of changes in blood pressure. However, the precise receptor subtypes responsible is controversial, likely dependent upon the cardiovascular response in question (e.g. bradycardia, hypertension, and perhaps even species-dependent since functional differences in rodent, rabbit, and human have been suggested. Thus, we characterized the S1P receptor subtype specificity for each compound in vitro and, in vivo, the cardiovascular effects of FTY720 and the more selective S1P₁,₅ agonist, BAF312, were tested during acute i.v. infusion in anesthetized rats and after oral administration for 10 days in telemetry-instrumented conscious rats. Acute i.v. infusion of FTY720 (0.1, 0.3, 1.0 mg/kg/20 min or BAF312 (0.5, 1.5, 5.0 mg/kg/20 min elicited acute bradycardia in anesthetized rats demonstrating an S1P₁ mediated mechanism-of-action. However, while FTY720 (0.5, 1.5, 5.0 mg/kg/d elicited dose-dependent hypertension after multiple days of oral administration in rat at clinically relevant plasma concentrations (24-hr mean blood pressure = 8.4, 12.8, 16.2 mmHg above baseline vs. 3 mmHg in vehicle controls, BAF312 (0.3, 3.0, 30.0 mg/kg/d had no significant effect on blood pressure at any dose tested suggesting that hypertension produced by FTY720 is mediated S1P₃ receptors. In summary, in vitro selectivity results in combination with studies performed in anesthetized and conscious rats administered two clinically tested S1P agonists, FTY720 or BAF312, suggest that S1P₁ receptors mediate bradycardia while hypertension is mediated by S1P₃ receptor activation.

  11. Identification of the peptide derived from S1 domain that inhibits type I and type II feline infectious peritonitis virus infection.

    Science.gov (United States)

    Doki, Tomoyoshi; Takano, Tomomi; Koyama, Yusuke; Hohdatsu, Tsutomu

    2015-06-02

    Feline infectious peritonitis virus (FIPV) can cause a lethal disease in cats, feline infectious peritonitis (FIP). A therapeutic drug that is effective against FIP has not yet been developed. Peptides based on viral protein amino acid sequences have recently been attracting attention as new antiviral drugs. In the present study, we synthesized 30 overlapping peptides based on the amino acid sequence of the S1 domain of the type I FIPV strain KU-2 S protein, and investigated their inhibitory effects on FIPV infection. To evaluate the inhibitory effects on type I FIPV infection of these peptides, we investigated a method to increase the infection efficiency of poorly replicative type I FIPV. The efficiency of type I FIPV infection was increased by diluting the virus with medium containing a polycation. Of the 30 peptides, I-S1-8 (S461-S480), I-S1-9 (S471-S490), I-S1-10 (S481-S500), I-S1-16 (S541-S560), and I-S1-22 (S601-S620) significantly decreased the infectivity of FIPV strain KU-2 while I-S1-9 and I-S1-16 exhibited marked inhibitory effects on FIPV infection. The inhibitory effects on FIPV infection of these 2 peptides on other type I and type II FIPV strains, feline herpesvirus (FHV), and feline calicivirus (FCV) were also examined. These 2 peptides specifically inhibited type I and type II FIPV, but did FHV or FCV infection. In conclusion, the possibility of peptides derived from the S protein of type I FIPV strain KU-2 as anti-FIPV agents effective not only for type I, but also type II FIPV was demonstrated in vitro.

  12. αS1-casein in goat milk: identification of genetic variants by Capillary Zone Electrophoresis compared to Isoelectric Focusing

    Directory of Open Access Journals (Sweden)

    G. Enne

    2011-03-01

    Full Text Available AlphaS1 casein fraction in caprine milk is characterized by an important polymorphism due to substitution, deletion of amino acids and post trascriptional modifications (Grosclaude et al., 1994; Ferranti et al., 1997. This structural polymorphism is associated to a quantitative variability in protein expression related to different milk quality and dairy properties (Pierre et al., 1998; Remeuf, 1993; Vassal et al., 1994. Classical electrophoretic methods were applied to characterize the phenotypic variants at αS1-casein fraction (Addeo et al., 1988; Russo et al., 1986. During the last ten years capillary electrophoresis became an analytical technique for rapid and automated analysis requiring small sample volume and small solvent waste. These characteristics, together with the high resolution and the chance to give quantitative results, made this technique a useful tool........

  13. Cooperative regulation of myosin-S1 binding to actin filaments by a continuous flexible Tm-Tn chain.

    Science.gov (United States)

    Mijailovich, Srboljub M; Kayser-Herold, Oliver; Li, Xiaochuan; Griffiths, Hugh; Geeves, Michael A

    2012-12-01

    The regulation of striated muscle contraction involves cooperative interactions between actin filaments, myosin-S1 (S1), tropomyosin (Tm), troponin (Tn), and calcium. These interactions are modeled by treating overlapping tropomyosins as a continuous flexible chain (CFC), weakly confined by electrostatic interactions with actin. The CFC is displaced locally in opposite directions on the actin surface by the binding of either S1 or Troponin I (TnI) to actin. The apparent rate constants for myosin and TnI binding to and detachment from actin are then intrinsically coupled via the CFC model to the presence of neighboring bound S1s and TnIs. Monte Carlo simulations at prescribed values of the CFC stiffness, the CFC's degree of azimuthal confinement, and the angular displacements caused by the bound proteins were able to predict the stopped-flow transients of S1 binding to regulated F-actin. The transients collected over a large range of calcium concentrations could be well described by adjusting a single calcium-dependent parameter, the rate constant of TnI detachment from actin, k(-I). The resulting equilibrium constant K(B) ≡ 1/K(I) varied sigmoidally with the free calcium, increasing from 0.12 at low calcium (pCa >7) to 12 at high calcium (pCa Hill coefficient of ~2.15. The similarity of the curves for excess-actin and excess-myosin data confirms their allosteric relationship. The spatially explicit calculations confirmed variable sizes for the cooperative units and clustering of bound myosins at low calcium concentrations. Moreover, inclusion of negative cooperativity between myosin units predicted the observed slowing of myosin binding at excess-myosin concentrations.

  14. Cost-effectiveness analysis of gemcitabine, S-1 and gemcitabine plus S-1 for treatment of advanced pancreatic cancer based on GEST study.

    Science.gov (United States)

    Zhou, Jing; Zhao, Rongce; Wen, Feng; Zhang, Pengfei; Tang, Ruilei; Du, Zedong; He, Xiaofeng; Zhang, Jian; Li, Qiu

    2015-04-01

    Gemcitabine (GEM) alone, S-1 alone and gemcitabine plus S-1 (GS) have shown a marginal clinical benefit for the treatment of advanced pancreatic cancer. However, there is no clearly defined optimal cost-effectiveness treatment. The objective of this study was to assess the cost-effectiveness of GEM alone, S-1 alone and GS for the treatment of advanced pancreatic cancer based on GEST study for public payers. A decision model compared GEM alone, S-1 alone and GS. Primary base case data were identified using the GEST study and the literatures. Costs were estimated from West China Hospital, Sichuan University, China, and incremental cost-effectiveness ratios (ICERs) were calculated. Survival benefits were reported in quality-adjusted life-months (QALMs). Sensitive analyses were performed by varying potentially modifiable parameters of the model. The base case analysis showed that the GEM cost $21,912 and yielded survival of 6.93 QALMs, S-1 cost $19,371 and yielded survival of 7.90 QALMs and GS cost $22,943 and yielded survival of 7.46 QALMs in the entire treatment. The one-way sensitivity analyses showed that the ICER of S-1 was driven mostly by the S-1 group utility score of stable state compared with GEM, and the GEM group utility score of progressed state played a key role on the ICER of GS compared with GEM. S-1 represents an attractive cost-effective treatment for advanced pancreatic cancer, given the favorable cost per QALM and improvement in clinical efficacy, especially the limited available treatment options.

  15. Helicobacter pylori vacA s1a and s1b alleles from clinical isolates from different regions of Chile show a distinct geographic distribution

    Institute of Scientific and Technical Information of China (English)

    MI Díaz; A Kirberg; E Hebel; J Fierro; R Bravo; F Siegel; G Leon; G Klapp; A Venegas; A Valdivia; P Martínez; JL Palacios; P Harris; J Novales; E Garrido; D Valderrama; C Shilling

    2005-01-01

    AIM: To establish the most common vacA alleles in Helicobacter pylori(H pylori) strains isolated from Chilean patients and its relationship with gastritis and gastroduodenal ulcers.METHODS: Two hundred and forty five H pylori clinical isolates were obtained from 79 biopsies from Chilean infected patients suffering from gastrointestinal diseases. An average of 2-3 strains per patient was isolated and the vacA genotype was analyzed by PCR and 3% agarose electrophoresis. Some genotypes were checked by DNA sequencing.RESULTS: The most prevalent vacA genotype inChilean patients was s1b m1 (76%), followed by s1a m1 (21%). In contrast, the s2 m2 genotype was scarcely represented (3%).The s1b m1 genotype was found most frequently linked to gastropathies (P<0.05) rather than ulcers. Ulcers were found more commonly in male and older patients. Curiously, patients living in cities located North and far South of Santiago, the capital and largest Chilean city, carried almost exclusively strains with the s1b m1 genotype. In contrast, patients from Santiago and cities located South of Santiago carried strains with either one or both s1a m1 and s1b m1 genotypes.Regarding the s2 m2 genotype, comparison with GenBank sequences revealed that Chilean s2 sequence was identical to those of Australian, American, and Colombian strains but quite different from those of Alaska and India.CONCLUSION: Differences in geographic distribution of the s and m vaccA alleles in Chile and a relationship of s1b m1 genotype with gastritis were found. Sequence data in part support a hispanic origin for the vacA genotype.Asymmetric distribution of genotypes s1b m1 and s2 m2recedes H Pyloristrain distribution in Spain and Portugal.

  16. Post-marketing Safety Evaluation of S-1 in Patients with Inoperable or Recurrent Breast Cancer: Especially in Patients Treated with S-1 + Trastuzumab

    OpenAIRE

    Saito, Yuki; Oshitanai, Risa; Terao, Mayako; Terada, Mizuho; Tsuda, Banri; Okamura, Takuho; Suzuki, Yasuhiro; Tokuda, Yutaka

    2011-01-01

    Objective The purpose of this study was to assess the safety of S-1 in Japanese in inoperable or recurrent breast cancer patients. Methods A prospective post-marketing surveillance was performed at 313 sites in Japan in patients with inoperable or recurrent breast cancer treated with S-1. We examined 1361 patients between January 2006 and December 2007 with regard to the incidence of adverse drug reactions graded by the Common Terminology Criteria for Adverse Events (CTCAE), version 3.0. Resu...

  17. Post-marketing safety evaluation of S-1 in patients with inoperable or recurrent breast cancer: especially in patients treated with S-1 + trastuzumab.

    Science.gov (United States)

    Saito, Yuki; Oshitanai, Risa; Terao, Mayako; Terada, Mizuho; Tsuda, Banri; Okamura, Takuho; Suzuki, Yasuhiro; Tokuda, Yutaka

    2011-09-01

    The purpose of this study was to assess the safety of S-1 in Japanese in inoperable or recurrent breast cancer patients. A prospective post-marketing surveillance was performed at 313 sites in Japan in patients with inoperable or recurrent breast cancer treated with S-1. We examined 1361 patients between January 2006 and December 2007 with regard to the incidence of adverse drug reactions graded by the Common Terminology Criteria for Adverse Events (CTCAE), version 3.0. At least one adverse drug reaction was encountered by 858 patients, with an overall incidence of 63.0% (858/1361). The incidence of Grade 3 or higher adverse drug reactions in a descending order was 14.7% (200/1361). In this study, the most common combination drug was trastuzumab. The overall incidence of adverse drug reactions was 63.5% (431/679 patients) in patients treated with S-1 alone, and 55.9% (66/118 patients) in patients treated with S-1 + trastuzumab. Monotherapy with S-1 or combination therapy with S-1 + trastuzumab was well tolerated for inoperable or recurrent breast cancer patients.

  18. A preparation of cow's late colostrum fraction containing αs1-casein promoted the proliferation of cultured rat intestinal IEC-6 epithelial cells.

    Science.gov (United States)

    Cairangzhuoma; Yamamoto, Mayumi; Xijier; Inagaki, Mizuho; Uchida, Kenji; Yamashita, Kousaku; Saito, Shouichiro; Yabe, Tomio; Kanamaru, Yoshihiro

    2013-01-01

    Colostrum is a complex mixture of bioactives that promotes neonate growth. Recently, we have found by in vivo study that skimmed, sterilized, and concentrated bovine late colostrum (SCBLC), obtained from a Holstein herd on days 6-7 after parturition, had an ability to maintain intestinal integrity. In the present study we investigated effects of SCBLC on rat intestinal IEC-6 cell proliferation in vitro. A fraction containing αs1-casein was found to have a robust stimulation effect as compared to other protein fractions from SCBLC and even the αs1-casein fraction from milk from other Holstein herds. Furthermore, the SCBLC αs1-casein molecule demonstrated not only slightly slower mobility on both SDS- and native-PAGE than other bovine milk αs1-caseins, but also a peculiar conformation reminiscent of moltenglobule in the circular dichroism spectrum. These findings may be of relevant to the competence of SCBLC to preserve intestinal integrity.

  19. Chisholm-Caianiello-Fubini Identities for S=1 Barut-Muzinich-Williams Matrices

    CERN Document Server

    Cabral, M de G Caldera

    2013-01-01

    The formulae of the relativistic products are found S=1 Barut-Muzinich-Williams matrices. They are analogs of the well-known Chisholm-Caianiello-Fubini identities. The obtained results can be useful in the higher-order calculations of the high-energy processes with S=1 particles in the framework of the 2(2S+1) Weinberg formalism, which recently attracted attention again. PACS numbers: 02.90.+p, 11.90.+t, 12.20.Ds

  20. Discovery of a novel series of potent S1P1 agonists.

    Science.gov (United States)

    Crosignani, Stefano; Bombrun, Agnes; Covini, David; Maio, Maurizio; Marin, Delphine; Quattropani, Anna; Swinnen, Dominique; Simpson, Don; Sauer, Wolfgang; Françon, Bernard; Martin, Thierry; Cambet, Yves; Nichols, Anthony; Martinou, Isabelle; Burgat-Charvillon, Fabienne; Rivron, Delphine; Donini, Cristina; Schott, Olivier; Eligert, Valerie; Novo-Perez, Laurence; Vitte, Pierre-Alain; Arrighi, Jean-François

    2010-03-01

    The discovery of a novel series of S1P1 agonists is described. Starting from a micromolar HTS positive, iterative optimization gave rise to several single-digit nanomolar S1P1 agonists. The compounds were able to induce internalization of the S1P1 receptor, and a selected compound was shown to be able to induce lymphopenia in mice after oral dosing.

  1. Orally administered S-1 suppresses circulating endothelial cell counts in metastatic breast cancer patients.

    OpenAIRE

    2013-01-01

    [Background]S-1 is an oral cytotoxic preparation that contains tegafur. Gamma-butyrolactone (GBL) is a metabolite of tegafur that is known to suppress vascular endothelial growth factor (VEGF)-mediated angiogenic activity. The aim of this study was to determine the change in circulating endothelial cell (CEC) counts, GBL levels, and angiogenesis-related factors during S-1 administration in metastatic breast cancer (MBC) patients. [Methods]Patients with HER2-negative MBC were eligible. S-1 was...

  2. S1←S0 vibronic spectra and structure of cyclopropanecarboxaldehyde molecule in the S1 lowest excited singlet electronic state

    Science.gov (United States)

    Godunov, I. A.; Yakovlev, N. N.; Terentiev, R. V.; Maslov, D. V.; Bataev, V. A.; Abramenkov, A. V.

    2016-11-01

    The S1←S0 vibronic spectra of gas-phase absorption at room temperature and fluorescence excitation of jet-cooled cyclopropanecarboxaldehyde (CPCA, c-C3H5CHO)were obtained and analyzed. In addition, the quantum chemical calculation (CASPT2/cc-pVTZ)was carried out for CPCA in the ground (S0) and lowest excited singlet (S1) electronic states. As a result, it was proved that the S1←S0 electronic excitation of the CPCA conformers (syn and anti) causes (after geometrical relaxation) significant structural changes, namely, the carbonyl fragments become non-planar and the cyclopropyl groups rotate around the central C-C bond. As a consequence, the potential energy surface of CPCA in the S1 state has six minima, 1ab, 2ab, and 3ab, corresponding to three pairs of mirror symmetry conformers: a and b. It was shown that vibronic bands of experimental spectra can be assigned to the 2(S1)←syn(S0) electronic transition with the origin at 30,481 cm-1. A number of fundamental vibrational frequencies for the 2 conformer of CPCA were assigned. In addition, several inversional energy levels for the 2 conformer were found and the 2a↔2b potential function of inversion was determined. The experimental barrier to inversion and the equilibrium angle between the CH bond and the CCO plane were calculated as 570 cm-1 and 28°, respectively.

  3. Benzyl butyl phthalate promotes breast cancer stem cell expansion via SPHK1/S1P/S1PR3 signaling

    Science.gov (United States)

    Chuang, Hsiao-Li; Chang, Yi-Chih; Chen, Hung-Sheng; Lee, Jau-Nan; Tsai, Eing-Mei

    2016-01-01

    Understanding the regulatory mechanisms unique to breast cancer stem cells (BCSCs) is required to control breast cancer metastasis. We found that phthalates promote BCSCs in human breast cancer cell cultures and xenograft tumors. A toxic phthalate, benzyl butyl phthalate (BBP), activated aryl hydrocarbon receptor in breast cancer cells to stimulate sphingosine kinase 1 (SPHK1)/sphingosine 1-phosphate (S1P)/sphingosine-1-phosphate receptor 3 (S1PR3) signaling and enhance formation of metastasis-initiating BCSCs. BBP induced histone modifications in S1PR3 in side population (SP) cells, but not in non-SP cells. SPHK1 or S1PR3 knockdown in breast cancer cells effectively reduced tumor growth and lung metastasis in vivo. Our findings suggest S1PR3 is a determinant of phthalate-driven breast cancer metastasis and a possible therapeutic target for regulating BCSC populations. Furthermore, the association between breast carcinogenesis and environmental pollutants has important implications for public health. PMID:27129165

  4. Effect of S1P5 on proliferation and migration of human esophageal cancer cells

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    AIM:To investigate the sphingosine 1phosphate (S1P) receptor expression profile in human esophageal cancer cells and the effects of S1P5 on proliferation and migration of human esophageal cancer cells. METHODS: S1P receptor expression profile in human esophageal squamous cell carcinoma cell line Eca109 was detected by semiquantitative reverse trans cription polymerase chain reaction. Eca109 cells were stably transfected with S1P5EGFP or controlEGFP constructs. The relation between the responses of cell prol...

  5. Intersystem crossing rates of S1 state keto-amino cytosine at low excess energy

    Science.gov (United States)

    Lobsiger, Simon; Etinski, Mihajlo; Blaser, Susan; Frey, Hans-Martin; Marian, Christel; Leutwyler, Samuel

    2015-12-01

    The amino-keto tautomer of supersonic jet-cooled cytosine undergoes intersystem crossing (ISC) from the v = 0 and low-lying vibronic levels of its S1(1ππ∗) state. We investigate these ISC rates experimentally and theoretically as a function of S1 state vibrational excess energy Eexc. The S1 vibronic levels are pumped with a ˜5 ns UV laser, the S1 and triplet state ion signals are separated by prompt or delayed ionization with a second UV laser pulse. After correcting the raw ISC yields for the relative S1 and T1 ionization cross sections, we obtain energy dependent ISC quantum yields QISC corr = 1 % -5%. These are combined with previously measured vibronic state-specific decay rates, giving ISC rates kISC = 0.4-1.5 ṡ 109 s-1, the corresponding S1⇝S0 internal conversion (IC) rates are 30-100 times larger. Theoretical ISC rates are computed using SCS-CC2 methods, which predict rapid ISC from the S1; v = 0 state with kISC = 3 ṡ 109 s-1 to the T1(3ππ∗) triplet state. The surprisingly high rate of this El Sayed-forbidden transition is caused by a substantial admixture of 1nOπ∗ character into the S1(1ππ∗) wave function at its non-planar minimum geometry. The combination of experiment and theory implies that (1) below Eexc = 550 cm-1 in the S1 state, S1⇝S0 internal conversion dominates the nonradiative decay with kIC ≥ 2 ṡ 1010 s-1, (2) the calculated S1⇝T1 (1ππ∗⇝3ππ∗) ISC rate is in good agreement with experiment, (3) being El-Sayed forbidden, the S1⇝T1 ISC is moderately fast (kISC = 3 ṡ 109 s-1), and not ultrafast, as claimed by other calculations, and (4) at Eexc ˜ 550 cm-1 the IC rate increases by ˜50 times, probably by accessing the lowest conical intersection (the C5-twist CI) and thereby effectively switching off the ISC decay channels.

  6. Lymphatic endothelial S1P promotes mitochondrial function and survival in naive T cells.

    Science.gov (United States)

    Mendoza, Alejandra; Fang, Victoria; Chen, Cynthia; Serasinghe, Madhavika; Verma, Akanksha; Muller, James; Chaluvadi, V Sai; Dustin, Michael L; Hla, Timothy; Elemento, Olivier; Chipuk, Jerry E; Schwab, Susan R

    2017-06-01

    Effective adaptive immune responses require a large repertoire of naive T cells that migrate throughout the body, rapidly identifying almost any foreign peptide. Because the production of T cells declines with age, naive T cells must be long-lived. However, it remains unclear how naive T cells survive for years while constantly travelling. The chemoattractant sphingosine 1-phosphate (S1P) guides T cell circulation among secondary lymphoid organs, including spleen, lymph nodes and Peyer's patches, where T cells search for antigens. The concentration of S1P is higher in circulatory fluids than in lymphoid organs, and the S1P1 receptor (S1P1R) directs the exit of T cells from the spleen into blood, and from lymph nodes and Peyer's patches into lymph. Here we show that S1P is essential not only for the circulation of naive T cells, but also for their survival. Using transgenic mouse models, we demonstrate that lymphatic endothelial cells support the survival of T cells by secreting S1P via the transporter SPNS2, that this S1P signals through S1P1R on T cells, and that the requirement for S1P1R is independent of the established role of the receptor in guiding exit from lymph nodes. S1P signalling maintains the mitochondrial content of naive T cells, providing cells with the energy to continue their constant migration. The S1P signalling pathway is being targeted therapeutically to inhibit autoreactive T cell trafficking, and these findings suggest that it may be possible simultaneously to target autoreactive or malignant cell survival.

  7. Pan-STARRS 1 observations of the unusual active Centaur P/2011 S1(Gibbs)

    CERN Document Server

    Lin, H W; Lacerda, P; Ip, W H; Holman, M; Protopapas, P; Chen, W P; Burgett, W S; Chambers, K C; Flewelling, H; Huber, M E; Jedicke, R; Kaiser, N; Magnier, E A; Metcalfe, N; Price, P A

    2014-01-01

    P/2011 S1 (Gibbs) is an outer solar system comet or active Centaur with a similar orbit to that of the famous 29P/Schwassmann-Wachmann 1. P/2011 S1 (Gibbs) has been observed by the Pan-STARRS 1 (PS1) sky survey from 2010 to 2012. The resulting data allow us to perform multi-color studies of the nucleus and coma of the comet. Analysis of PS1 images reveals that P/2011 S1 (Gibbs) has a small nucleus $< 4$ km radius, with colors $g_{P1}-r_{P1} = 0.5 \\pm 0.02$, $r_{P1}-i_{P1} = 0.12 \\pm 0.02$ and $i_{P1}-z_{P1} = 0.46 \\pm 0.03$. The comet remained active from 2010 to 2012, with a model-dependent mass-loss rate of $\\sim100$ kg s$^{-1}$. The mass-loss rate per unit surface area of P/2011 S1 (Gibbs) is as high as that of 29P/Schwassmann-Wachmann 1, making it one of the most active Centaurs. The mass-loss rate also varies with time from $\\sim 40$ kg s$^{-1}$ to 150 kg s$^{-1}$. Due to its rather circular orbit, we propose that P/2011 S1 (Gibbs) has 29P/Schwassmann-Wachmann 1-like outbursts that control the outgass...

  8. Evoked heart rate and blood pressure in an S1-S2 paradigm

    NARCIS (Netherlands)

    Koers, G; Gaillard, A.W K; Mulder, G.

    1997-01-01

    Phasic changes in heart rate (HR) and blood pressure (BP) in an S1-S2 paradigm were studied in three experiments. In each experiment, a memory search task was performed at S1. The outcome of this task indicated whether a fast or a delayed response had to be given after S2. Besides this response

  9. To stay or to leave: Stem cells and progenitor cells navigating the S1P gradient

    Institute of Scientific and Technical Information of China (English)

    Andrew; Hsu; Jen-Fu; Lee; Daniel; E; Cramer; Menq-Jer; Lee

    2011-01-01

    Most hematopoietic stem progenitor cells (HSPCs) reside in bone marrow (BM), but a small amount of HSPCs have been found to circulate between BM and tissues through blood and lymph. Several lines of evidence suggest that sphingosine-1-phosphate (S1P) gradient triggers HSPC egression to blood circulation after mobilization from BM stem cell niches. Stem cells also visit certain tissues. After a temporary 36 h short stay in local tissues, HSPCs go to lymph in response to S1P gradient between lymph and tissue and eventually enter the blood circulation. S1P also has a role in the guidance of the primitive HSPCs homing to BM in vivo, as S1P analogue FTY720 treatment can improve HSPC BM homing and engraftment. In stress conditions, various stem cells or progenitor cells can be attracted to local injured tissues and participate in local tissue cell differentiation and tissue rebuilding through modulation the expression level of S1P1, S1P2 or S1P3 receptors. Hence, S1P is important for stem cells circulation in blood system to accomplish its role in body surveillance and injury recovery.

  10. S1xS2-INDEX THEORY ON PRODUCT SPACE

    Institute of Scientific and Technical Information of China (English)

    ZHONGCHENGKUI; ZHAOPEIHAO; SHIKE

    1999-01-01

    A new index is constructed by use of the canonical representation of S1 x S1 group over a product space. This index satisfies the general properties of the usual index but does not satifsy the dimension property. As an application, two abstract critical point theorems are given.

  11. Experimental Conditions: SE18_S1_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available liver and brain by Orbitrap MS and automated search engine Lipid Search SE18_S1 Mouse liver SE18_S1_M1 34.1...phy. SE18_MS1 Preparation of lipid extract and ESI negative detection by LC-MS analysis SE18_DS1 Identification of phospholipids with Lipid Search default ...

  12. Proteogenomic analysis of NCC-S1M, a gastric cancer stem cell-like cell line that responds to anti-PD-1.

    Science.gov (United States)

    Park, Jun Won; Um, Hyejin; Yang, Hanna; Ko, Woori; Kim, Dae-Yong; Kim, Hark Kyun

    2017-03-11

    To elucidate signaling pathways that regulate gastric cancer stem cell (CSC) phenotypes and immune checkpoint, we performed a proteogenomic analysis of NCC-S1M, which is a gastric cancer cell line with CSC-like characteristics and is the only syngeneic gastric tumor cell line transplant model created in the scientific community. We found that the NCC-S1M allograft was responsive to anti-PD-1 treatment, and overexpressed Cd274 encoding PD-L1. PD-L1 was transcriptionally activated by loss of the TGF-β signaling. Il1rl1 protein was overexpressed in NCC-S1M cells compared with NCC-S1 cells that are less tumorigenic and less chemoresistant. Il1rl1 knockdown in NCC-S1M cells reduced tumorigenic potential and in vivo chemoresistance. Our proteogenomic analysis demonstrates a role of Smad4 loss in the PD-L1 immune evasion, as well as Il1rl1's role in CSC-like properties of NCC-S1M. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. Vacuum Structure of Twisted Scalar Field Theories on $M^{D-1} \\otimes S^{1}$

    CERN Document Server

    Hatanaka, H; Ohnishi, K; Sakamoto, M

    2001-01-01

    We study scalar field theories on M^{D-1} \\otimes S^1, which allow to impose twisted boundary conditions for the S^1 direction, in detail and report several interesting properties overlooked so far. One of characteristic features is the appearance of critical radii of the circle S^1. A phase transition can occur at the classical level or can be caused by quantum effects. Radiative corrections can restore broken symmetries or can break symmetries for small radius. A surprising feature is that the translational invariance for the S^1 direction can spontaneously be broken. A particular class of coordinate-dependent vacuum configurations is clarified and the O(N) \\phi^4 model on M^{D-1}\\otimes S^1 is extensively studied, as an illustrative example.

  14. Biosynthesis of reovirus-specified polypeptides: the reovirus s1 mRNA encodes two primary translation products

    Energy Technology Data Exchange (ETDEWEB)

    Jacobs, B.L.; Samuel, C.E.

    1985-05-01

    Reovirus serotypes 1 (Lang strain) and 3 (Dearing strain) code for a hitherto unrecognized low-molecular-weight polypeptide of Mr approximately 12,000. This polypeptide (p12) was synthesized in vitro in L-cell-free protein synthesizing systems programmed with either reovirus serotype 1 mRNA, reovirus serotype 3 mRNA, or with denatured reovirus genome double-stranded RNA, and in vivo in L-cell cultures infected with either reovirus serotype. Pulse-chase experiments in vivo, and the relative kinetics of synthesis of p12 in vitro, indicate that it is a primary translation product. Fractionation of reovirus mRNAs by velocity sedimentation and translation of separated mRNAs in vitro suggests that p12 is coded for by the s1 mRNA, which also codes for the previously recognized sigma 1 polypeptide. Synthesis of both p12 and sigma 1 in vitro in L-cell-free protein synthesizing systems programmed with denatured reovirus genome double-stranded RNA also suggests that these two polypeptides can be coded by the same mRNA species. It is proposed that the Mr approximately 12,000 polypeptide encoded by the S1 genome segment be designated sigma 1bNS, and that the polypeptide previously designated sigma 1 be renamed sigma 1a.

  15. S1P and LPA trigger Schwann cell actin changes and migration.

    Science.gov (United States)

    Barber, Siân C; Mellor, Harry; Gampel, Alex; Scolding, Neil J

    2004-06-01

    The processes by which a Schwann cell (SC) migrates towards, wraps around and, in some cases, myelinates an axon are incompletely understood. The complex morphological rearrangements involved in these events require fundamental changes in the actin cytoskeleton. Sphingosine 1-phosphate (S1P) and lysophosphatidic acid (LPA) are two modulators of the actin cytoskeleton, and receptors for these signalling lipids are expressed on SCs at the time of differentiation. Previous work has revealed a role for LPA in SC survival, morphology and differentiation, but the effects of S1P have received less attention. Here we show that S1P and LPA both cause major rearrangements to the actin cytoskeleton in primary rat SCs and the SCL4.1/F7 rat SC line. S1P and LPA caused formation of lamellipodia and a circular geodesic actin network. We also show that S1P and LPA increased cell migration. The small GTPases RhoA and Rac1 were both activated by S1P/LPA treatment, but the actin rearrangements were dependent on Rac1 and not RhoA. These effects of S1P/LPA could be mimicked by SCL4.1/F7 cell-conditioned medium, which was found to contain S1P. Reduction in cellular synthesis of S1P by adding the sphingosine kinase inhibitor dimethyl sphingosine during medium conditioning reduced the ability of conditioned medium to cause actin rearrangements. These results support a role for S1P as an autocrine signal regulating the actin cytoskeleton during Schwann cell development.

  16. An anatomical update on the morphologic variations of S1 and S2.

    Science.gov (United States)

    Karachalios, Theofilos; Zibis, Aristides H; Zintzaras, Elias; Bargiotas, Konstantinos; Karantanas, Apostolos H; Malizos, Konstantinos N

    2010-10-11

    Although percutaneous fixation with iliosacral screws has been shown to be a safe and reproducible method for sacroiliac dislocation and sacral fractures, it is a technically demanding technique, and one of its contraindications is sacral anatomical variations and dysmorphism. The incidence and pattern of S1 and S2 anatomical variations were evaluated in 61 patients (35 women and 26 men) using magnetic resonance imaging of the sacrum in an attempt to explore the possible existence of groups of individuals in whom percutaneous sacroiliac fixation is difficult due to local anatomy. S1 and S2 dimensions in both the transverse and coronal planes were recorded and evaluated. In each individual, S1 and S2 dimensions both in the coronal and transverse planes were proportional, with S2 dimensions being 80% of those of S1 on average. Patients were separated into 4 groups based on the S1 and S2 body size and the asymmetry of dimensions in the transverse and coronal planes. In 48 patients (78.6%), dimensions in both planes were symmetrical despite the varying size of the S1 and S2 body. In 2 patients (3.3%) there was a combination of large transverse plane and small coronal plane dimensions, with large S1 and S2 body size. In 9 patients (14.8%), coronal plane dimensions were disproportionately smaller compared to those of the transverse plane, with a varying size of S1 and S2 body making effective sacroiliac screw insertion a difficult task. Thus, a preoperative imaging study, preferably computed tomography scan, of S1 and S2 body size and coronal plane dimensions and an intraoperative fluoroscopic control of S1 and S2 dimensions on the coronal plane are suggested for safe sacroiliac screw fixation.

  17. Human subtilase SKI-1/S1P is a master regulator of the HCV Lifecycle and a potential host cell target for developing indirect-acting antiviral agents.

    Science.gov (United States)

    Olmstead, Andrea D; Knecht, Wolfgang; Lazarov, Ina; Dixit, Surjit B; Jean, François

    2012-01-01

    HCV infection is a major risk factor for liver cancer and liver transplantation worldwide. Overstimulation of host lipid metabolism in the liver by HCV-encoded proteins during viral infection creates a favorable environment for virus propagation and pathogenesis. In this study, we hypothesize that targeting cellular enzymes acting as master regulators of lipid homeostasis could represent a powerful approach to developing a novel class of broad-spectrum antivirals against infection associated with human Flaviviridae viruses such as hepatitis C virus (HCV), whose assembly and pathogenesis depend on interaction with lipid droplets (LDs). One such master regulator of cholesterol metabolic pathways is the host subtilisin/kexin-isozyme-1 (SKI-1)--or site-1 protease (S1P). SKI-1/S1P plays a critical role in the proteolytic activation of sterol regulatory element binding proteins (SREBPs), which control expression of the key enzymes of cholesterol and fatty-acid biosynthesis. Here we report the development of a SKI-1/S1P-specific protein-based inhibitor and its application to blocking the SREBP signaling cascade. We demonstrate that SKI-1/S1P inhibition effectively blocks HCV from establishing infection in hepatoma cells. The inhibitory mechanism is associated with a dramatic reduction in the abundance of neutral lipids, LDs, and the LD marker: adipose differentiation-related protein (ADRP)/perilipin 2. Reduction of LD formation inhibits virus assembly from infected cells. Importantly, we confirm that SKI-1/S1P is a key host factor for HCV infection by using a specific active, site-directed, small-molecule inhibitor of SKI-1/S1P: PF-429242. Our studies identify SKI-1/S1P as both a novel regulator of the HCV lifecycle and as a potential host-directed therapeutic target against HCV infection and liver steatosis. With identification of an increasing number of human viruses that use host LDs for infection, our results suggest that SKI-1/S1P inhibitors may allow development of

  18. Human subtilase SKI-1/S1P is a master regulator of the HCV Lifecycle and a potential host cell target for developing indirect-acting antiviral agents.

    Directory of Open Access Journals (Sweden)

    Andrea D Olmstead

    2012-01-01

    Full Text Available HCV infection is a major risk factor for liver cancer and liver transplantation worldwide. Overstimulation of host lipid metabolism in the liver by HCV-encoded proteins during viral infection creates a favorable environment for virus propagation and pathogenesis. In this study, we hypothesize that targeting cellular enzymes acting as master regulators of lipid homeostasis could represent a powerful approach to developing a novel class of broad-spectrum antivirals against infection associated with human Flaviviridae viruses such as hepatitis C virus (HCV, whose assembly and pathogenesis depend on interaction with lipid droplets (LDs. One such master regulator of cholesterol metabolic pathways is the host subtilisin/kexin-isozyme-1 (SKI-1--or site-1 protease (S1P. SKI-1/S1P plays a critical role in the proteolytic activation of sterol regulatory element binding proteins (SREBPs, which control expression of the key enzymes of cholesterol and fatty-acid biosynthesis. Here we report the development of a SKI-1/S1P-specific protein-based inhibitor and its application to blocking the SREBP signaling cascade. We demonstrate that SKI-1/S1P inhibition effectively blocks HCV from establishing infection in hepatoma cells. The inhibitory mechanism is associated with a dramatic reduction in the abundance of neutral lipids, LDs, and the LD marker: adipose differentiation-related protein (ADRP/perilipin 2. Reduction of LD formation inhibits virus assembly from infected cells. Importantly, we confirm that SKI-1/S1P is a key host factor for HCV infection by using a specific active, site-directed, small-molecule inhibitor of SKI-1/S1P: PF-429242. Our studies identify SKI-1/S1P as both a novel regulator of the HCV lifecycle and as a potential host-directed therapeutic target against HCV infection and liver steatosis. With identification of an increasing number of human viruses that use host LDs for infection, our results suggest that SKI-1/S1P inhibitors may allow

  19. Combined S1-TC-RRS with consideration of cms and dihaploids in maize

    Directory of Open Access Journals (Sweden)

    Vančetović Jelena

    2012-01-01

    Full Text Available Herein, we present the combined S1-HS-RRS method using inbred testers (S1-TC-RRS as a long-term maize breeding program, which increases the frequency of favorable alleles and maintains genetic variability in two genetically opposite populations. The method improves two different genetic sources simultaneously, where S1 families, developed by selfing phenotypically superior plants from both breeding populations are crossed with opposite inbred testers for specific combining ability selection, accompanied by selection of S1 families per se. A certain percentage of the evaluated S1 families is used for the next TC-RRS selection cycle. Maternal haploids from the selected S1 lines of each cycle of S1-TC-RRS can serve to produce elite 100% homozygous inbred lines (dihaploids in a short time, which decreases the time and expenses of the selection cycle and influence the efficiency of seed production, as well as, variety protection rights. This elite lines than can be converted to CMS versions (paternal haploids, for the seed production, which lowers the costs of it.

  20. Decorin in human oral cancer: A promising predictive biomarker of S-1 neoadjuvant chemosensitivity

    Energy Technology Data Exchange (ETDEWEB)

    Kasamatsu, Atsushi, E-mail: kasamatsua@faculty.chiba-u.jp [Department of Oral Science, Graduate School of Medicine, Chiba University, Chiba 260-8670 (Japan); Department of Dentistry and Oral–Maxillofacial Surgery, Chiba University Hospital, Chiba 260-8670 (Japan); Uzawa, Katsuhiro, E-mail: uzawak@faculty.chiba-u.jp [Department of Oral Science, Graduate School of Medicine, Chiba University, Chiba 260-8670 (Japan); Department of Dentistry and Oral–Maxillofacial Surgery, Chiba University Hospital, Chiba 260-8670 (Japan); Minakawa, Yasuyuki; Ishige, Shunsaku; Kasama, Hiroki [Department of Oral Science, Graduate School of Medicine, Chiba University, Chiba 260-8670 (Japan); Endo-Sakamoto, Yosuke; Ogawara, Katsunori [Department of Dentistry and Oral–Maxillofacial Surgery, Chiba University Hospital, Chiba 260-8670 (Japan); Shiiba, Masashi; Takiguchi, Yuichi [Medical Oncology, Graduate School of Medicine, Chiba University, Chiba 260-8670 (Japan); Tanzawa, Hideki [Department of Oral Science, Graduate School of Medicine, Chiba University, Chiba 260-8670 (Japan); Department of Dentistry and Oral–Maxillofacial Surgery, Chiba University Hospital, Chiba 260-8670 (Japan)

    2015-01-30

    Highlights: • DCN is significantly up-regulated in chemoresistant cancer cell lines. • DCN is a key regulator for chemoresistant mechanisms in vitro and in vivo. • DCN predicts the clinical responses to S-1 NAC for patients with oral cancer. - Abstract: We reported previously that decorin (DCN) is significantly up-regulated in chemoresistant cancer cell lines. DCN is a small leucine-rich proteoglycan that exists and functions in stromal and epithelial cells. Accumulating evidence suggests that DCN affects the biology of several types of cancer by directly/indirectly targeting the signaling molecules involved in cell growth, survival, metastasis, and angiogenesis, however, the molecular mechanisms of DCN in chemoresistance and its clinical relevance are still unknown. Here we assumed that DCN silencing cells increase chemosusceptibility to S-1, consisted of tegafur, prodrug of 5-fluorouracil. We first established DCN knockdown transfectants derived from oral cancer cells for following experiments including chemosusceptibility assay to S-1. In addition to the in vitro data, DCN knockdown zenografting tumors in nude mice demonstrate decreasing cell proliferation and increasing apoptosis with dephosphorylation of AKT after S-1 chemotherapy. We also investigated whether DCN expression predicts the clinical responses of neoadjuvant chemotherapy (NAC) using S-1 (S-1 NAC) for oral cancer patients. Immunohistochemistry data in the preoperative biopsy samples was analyzed to determine the cut-off point for status of DCN expression by receiver operating curve analysis. Interestingly, low DCN expression was observed in five (83%) of six cases with complete responses to S-1 NAC, and in one (10%) case of 10 cases with stable/progressive disease, indicating that S-1 chemosensitivity is dramatically effective in oral cancer patients with low DCN expression compared with high DCN expression. Our findings suggest that DCN is a key regulator for chemoresistant mechanisms, and

  1. Complete Response of Liver Metastasis of Gastric Cancer Treated by S-1 Chemoradiotherapy: A Case Report

    Directory of Open Access Journals (Sweden)

    Tomonori Miyazawa

    2012-01-01

    Full Text Available This paper presents a case of suspected liver metastasis of gastric cancer and a virtual complete response to S-1 chemoradiotherapy. A 69-year-old man underwent distal gastrectomy for gastric cancer in 2008. Multiple liver metastases occurred in 2009. He underwent 15 courses of S-1 therapy and radiation therapy (37.5 Gy. Abdominal computed tomography showed virtual complete disappearance of liver metastasis after chemoradiotherapy. Hence, this case was interpreted as a complete response. No sign of recurrence was noted 18 months after complete response was confirmed. S-1 chemoradiotherapy is likely to be effective in treating patients with liver metastases of gastric cancer.

  2. Complete response of liver metastasis of gastric cancer treated by s-1 chemoradiotherapy: a case report.

    Science.gov (United States)

    Miyazawa, Tomonori; Ebe, Kazuyu; Koide, Norihiko; Fujita, Nobuhiro

    2012-01-01

    This paper presents a case of suspected liver metastasis of gastric cancer and a virtual complete response to S-1 chemoradiotherapy. A 69-year-old man underwent distal gastrectomy for gastric cancer in 2008. Multiple liver metastases occurred in 2009. He underwent 15 courses of S-1 therapy and radiation therapy (37.5 Gy). Abdominal computed tomography showed virtual complete disappearance of liver metastasis after chemoradiotherapy. Hence, this case was interpreted as a complete response. No sign of recurrence was noted 18 months after complete response was confirmed. S-1 chemoradiotherapy is likely to be effective in treating patients with liver metastases of gastric cancer.

  3. Experience with S-1 in older Caucasian patients with metastatic colorectal cancer (mCRC)

    DEFF Research Database (Denmark)

    Winther, Stine Braendegaard; Zubcevic, Kanita; Qvortrup, Camilla;

    2016-01-01

    of adverse events than capecitabine and may therefore be a suitable drug for elderly. However, data on the use of S-1 in Caucasian mCRC patients are lacking/scarce. MATERIAL AND METHODS: In the present study we evaluated safety and the efficacy of S-1 alone or in combination with oxaliplatin (SOx....... In general, therapy was well tolerated; main non-hematological toxicities were fatigue and diarrhea. CONCLUSION: S-1 monotherapy, SOx and IRIS were well tolerated for older patients with mCRC and could become alternative regimens in older mCRC patients. These regimens are now further evaluated...

  4. Relation among brain-derived neurotrophic factor, neuron specific enolase, S100B protein and postoperative delirium in elderly patients with hip joint operation%脑源性神经营养因子和神经元特异性烯醇化酶及S1OOB蛋白与老年髋关节手术患者术后谵妄关系的研究

    Institute of Scientific and Technical Information of China (English)

    林佳鹤; 周国庆; 岳云; 吴安石

    2016-01-01

    Objective To investigate relation among brain-derived neurotrophic factor (BDNF),neuron specific enolase (NSE),S100B protein and postoperative delirium in elderly patients with hip joint operation.Methods Totally 97 patients over 65 years old had unilateral hip joint operation from March 2014 to March 2015 in Beijing Pinggu Hospital were retrospectively analyzed and divided into 2 groups according to the occurrence of postoperative delirium:delirium group(20 cases) and non-delirium group(77 cases).Serum levels of BDNF,NSE and S100B protein were measured before and 24 h after operation.Relation among serum BDNF,NSE,S100B protein and postoperative delirium was analyzed.Results Postoperative serum levels of BDNF were significantly higher than those before operation in both groups [non-delirium group:(2 031 ± 660) ng/L vs (1 393 ± 622) ng/L,P < 0.05;delirium group:(2 146 ± 462) ng/L vs (1 709 ± 674) ng/L,P < 0.05].The preoperative serum level of BDNF in delirium group was significantly higher than that in non-delirium group(P < 0.05).Serum levels of NES[preoperative:(12.1 ± 2.3) μg/L vs (12.5 ± 2.7) μg/L;postoperative:(12.2 ± 2.7) μg/L vs (12.0 ± 2.2) μg/L],S100B protein [preoperative:(1 235 ± 286) ng/L vs (1 241 ± 257) ng/L;postoperative:(l233±273) ng/L vs (1179 ± 247)ng/L] and the postoperative serum level of BDNF had no significant differences between groups (P > 0.05).Binomial logistic regression analysis showed that elevated preoperative BDNF had correlation with postoperative delirium (Odds Ratio:3.417,95 % Confidence Interval:1.130-10.333,P =0.030).Conclusion Elevated preoperative BDNF is correlated with the occurance of postoperative delirium in elderly people with hip joint operation.%目的 探讨脑源性神经营养因子(BDNF)、神经元特异性烯醇化酶(NSE)及S100B蛋白与老年髋关节手术患者术后谵妄的关系.方法 回顾性分析2014年3月至2015年3月于北京市平谷区医院因单侧髋关

  5. Randomized study comparing full dose monotherapy (S-1 followed by irinotecan) and reduced dose combination therapy (S-1/oxaliplatin followed by S-1/irinotecan) as initial therapy for older patients with metastatic colorectal cancer: NORDIC 9.

    Science.gov (United States)

    Winther, Stine Braendegaard; Österlund, Pia; Berglund, Åke; Glimelius, Bengt; Qvortrup, Camilla; Sorbye, Halfdan; Pfeiffer, Per

    2017-08-16

    Metastatic colorectal cancer (mCRC) is a disease of older age, but there is a relative lack of knowledge about effects of chemotherapy in older patients as they are under-represented in clinical trials. Little data can guide whether the strategy in older mCRC patients should be a sequential full-dose monotherapy chemotherapy approach or a dose-reduced combination chemotherapy approach. The oral 5FU prodrug S-1 seems to have less side effects than capecitabine and should be an optimal drug for older patients, but few data are available. Improved geriatric assessments are needed to select which older patients should receive therapy. The NORDIC 9 trial is a Nordic multicenter randomized phase II study comparing full dose monotherapy (S-1 30 mg/m(2) twice daily days 1-14 every 3 weeks, followed by second line irinotecan 250-350 mg/m(2) iv day 1 every 3 weeks or 180-250 mg/m(2) iv day 1 every 2 weeks) with reduced dose combination therapy (S-1 20 mg/m(2) days 1-14 + oxaliplatin 100 mg/m(2) iv day 1 every 3 weeks, followed by second line S-1 20 mg/m(2) days 1-14 + irinotecan 180 mg/m(2) day 1 every 3 week) for older patients (≥70 years) with mCRC who are not candidates for full-dose standard combination therapy. Additional bevacizumab (7.5 mg/kg) is optional in first-line. Blood samples and tumor tissue will be collected to investigate predictive markers. Geriatric screening tools (G-8, VES-13, Timed-Up-and-Go and Handgrip strength), Charlson Comorbidty Index and quality of life (EORTC QLQ-C30) will be evaluated as predictors of efficacy and toxicity. The target sample size is 150 patients. The primary endpoint is progression-free survival and secondary endpoints are time-to-failure of strategy, overall survival, response rate, toxicity, and correlations between biomarkers, pre-treatment characteristics and geriatric assessments. The study will add knowledge on how to treat older mCRC patients who are not candidates for standard combination therapy

  6. Deconfinement on $\\mathbb R^2\\times S^1_L\\times S^1_{\\beta}$ for all gauge groups and duality to double Coulomb Gas

    CERN Document Server

    Teeple, Brett

    2015-01-01

    I study finite-temperature $\\mathcal N=1$ super Yang-Mills for any gauge group $G=A_N, B_N, C_N, D_N, E_{6,7,8},F_4,G_2$, compactified from four dimensions on a torus, $\\mathbb R^2\\times S^1_L\\times S^1_{\\beta}$. I examine in particular the low temperature regime $L\\ll\\beta=1/T$, where $L$ is the length of the spatial circle with periodic boundary conditions and with anti-periodic boundary conditions for the adjoint gauginos along the thermal cycle $S^1_{\\beta}$. For small such $L$ we are in a regime were semiclassical calculations can be performed and a transition occurs at $T_c$ much smaller than $1/NL$. The transition is mediated by the competition between non-perturbative objects including 'exotic' topological molecules: neutral and magnetic bions composed of BPS and KK monopole constituents, with $r=rank(G)$ different charges in the co-root lattice of the gauge group $G$, and the perturbative electrically charged W-bosons (along with their wino superpartners). I determine a duality to a double Coulomb ga...

  7. Determination of the hyperfine coupling constant of cesium 7S1/2 state

    CERN Document Server

    Yang, Guang; Yang, Baodong; Wang, Junmin

    2016-01-01

    We report the hyperfine splitting (HFS) measurement of cesium (Cs) 7S1/2 state by optical-optical double-resonance spectroscopy in the 6S1/2-6P3/2-7S1/2 (852 nm + 1470 nm) ladder-type system. The HFS frequency calibration is performed by employing a phase-type waveguide electro-optic modulator together with a stable confocal Fabry-Perot cavity. From the measured HFS between F"= 3 and F"= 4 manifolds of Cs 7S1/2 state [HFS = 2183.273(37) MHz], we have determined the magnetic dipole hyperfine coupling constant [A = 545.818(09) MHz], which is in good agreement with the previous work but much more accurate.

  8. Neel order in the two-dimensional S=1/2 Heisenberg Model

    OpenAIRE

    Löw, Ute

    2007-01-01

    The existence of Neel order in the S=1/2 Heisenberg model on the square lattice at T=0 is shown using inequalities set up by Kennedy, Lieb and Shastry in combination with high precision Quantum Monte Carlo data.

  9. Experimental Conditions: SE24_S1_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available rometry with 13C‑Labeling for Chemical Assignment of Sulfur-Containing Metabolites ...SE24_S1_M1_D1 SE24 Combination of Liquid Chromatography-Fourier Transform Ion Cyclotron Resonance-Mass Spect

  10. Genome Sequence of Aggregatibacter actinomycetemcomitans Serotype c Strain D11S-1

    OpenAIRE

    Chen, Casey; Kittichotirat, Weerayuth; Si, Yan; Bumgarner, Roger

    2009-01-01

    Aggregatibacter actinomycetemcomitans is a major etiological agent of periodontitis. Here we report the complete genome sequence of serotype c strain D11S-1, which was recovered from the subgingival plaque of a patient diagnosed with generalized aggressive periodontitis.

  11. Heart Disease Could Cost U.S. $1 Trillion Per Year by 2035: Report

    Science.gov (United States)

    ... page: https://medlineplus.gov/news/fullstory_163587.html Heart Disease Could Cost U.S. $1 Trillion Per Year By ... estimates that nearly half of Americans will have heart disease in less than 20 years To use the ...

  12. Preparation of (S-1-Halo-2-octanols Using Ionic Liquids and Biocatalysts

    Directory of Open Access Journals (Sweden)

    Ramon Canela

    2009-10-01

    Full Text Available Preparation of (S-1-chloro-2-octanol and (S-1-bromo-2-octanol was carried out by the enzymatic hydrolysis of halohydrin palmitates using biocatalysts. Halohydrin palmitates were prepared by various methods from palmitic acid and 1,2-octanediol. A tandem hydrolysis was carried out using lipases from Candida antarctica (Novozym® 435, Rhizomucor miehei (Lipozyme IM, and “resting cells” from a Rhizopus oryzae strain that was not mycotoxigenic. The influence of the enzyme and the reaction medium on the selective hydrolysis of isomeric mixtures of halohydrin esters is described. Novozym® 435 allowed preparation of (S-1-chloro-2-octanol and (S-1-bromo-2-octanol after 1–3 h of reaction at 40 °C in [BMIM][PF6].

  13. Large EPR g-shifts for S= {1}/{2} molecules doped into the nickelocene lattice

    Science.gov (United States)

    Hulliger, J.; Baltzer, P.

    1986-10-01

    Large anisotropic g-shifts for bis-(benzene)-vanadium or cyclopentadienyl-cycloheptatrienyl-vanadium (both S= {1}/{2}) doped into nickelocene ( S=1) have been observed by X-band EPR at 3 K. It is shown by a molecular field analysis that nickelocene is a weakly ferromagnetically coupled Van Vleck paramagnet. Estimated ferro- and antiferromagnetic doublet-triplet molecular field sums are of the order of wavenumbers.

  14. Characterization of the L4-L5-S1 motion segment using the stepwise reduction method.

    Science.gov (United States)

    Jaramillo, Héctor Enrique; Puttlitz, Christian M; McGilvray, Kirk; García, José J

    2016-05-03

    The two aims of this study were to generate data for a more accurate calibration of finite element models including the L5-S1 segment, and to find mechanical differences between the L4-L5 and L5-S1 segments. Then, the range of motion (ROM) and facet forces for the L4-S1 segment were measured using the stepwise reduction method. This consists of sequentially testing and reducing each segment in nine stages by cutting the ligaments, facet capsules, and removing the nucleus. Five L4-S1 human segments (median: 65 years, range: 53-84 years, SD=11.0 years) were loaded under a maximum pure moment of 8Nm. The ROM was measured using stereo-photogrammetry via tracking of three markers and the facet contact forces (CF) were measured using a Tekscan system. The ROM for the L4-L5 segment and all stages showed good agreement with published data. The major differences in ROM between the L4-L5 and L5-S1 segments were found for lateral bending and all stages, for which the L4-L5 ROM was about 1.5-3 times higher than that of the L5-S1 segment, consistent with L5-S1 facet CF about 1.3 to 4 times higher than those measured for the L4-L5 segment. For the other movements and few stages, the L4-L5 ROM was significantly lower that of the L5-S1 segment. ROM and CF provide important baseline data for more accurate calibration of FE models and to understand the role that their structures play in lower lumbar spine mechanics.

  15. THE COEXPRESSION OF THE preS1 (1- 42) AND THE CORE (1- 144)ANTIGEN OF HBV IN E.coli

    Institute of Scientific and Technical Information of China (English)

    赵阳青; 詹美云

    2002-01-01

    Objective.To study the therapeutic T cell vaccine for the treatment of chronic hepatitis B by improving the cellular immunization of HBsAg vaccine with the coexpression of the preS1 (1- 42) and the Core (1- 144) antigen of HBV in E.coli.Methods.The genes of HBcAg (1- 144) and preS1 (1- 42) were amplified and fused by PCR.This fused gene was inserted in the prokaryotic expression vector pET 11d and expressed in E.coli.Results.It was showed by SDS PAGE that the protein molecular weight of the coexpression product was about 20 kD,20% of all bacteria protein.The monoclonal antibodies against core and preS1 antibody could react with this fused protein by Western blot technique respectively.The fused gene was verified by sequencing.Under the immune electron microscopy,this fused protein is typical particles of HBcAg but in an aggregated form.Conclusion.The results might aid for studying T cell immunotherapeutic vaccine for chronic hepatitis B.

  16. Lumbosacral transitional vertebra and S1 radiculopathy: the value of coronal MR imaging

    Energy Technology Data Exchange (ETDEWEB)

    Bezuidenhout, Abraham Fourie; Lotz, Jan Willem [Stellenbosch University, Division of Radiodiagnosis, Department of Medical Imaging and Clinical Oncology, Faculty of Medicine and Health Sciences, Tygerberg (South Africa)

    2014-06-15

    The association of a lumbosacral transitional vertebra with accelerated degeneration of the disc above has been described. Lumbosacral transitional vertebrae have also been reported as a cause of extraforaminal entrapment of the L5 nerve root between the transverse segment of the transitional vertebra and the sacral ala optimally demonstrated by coronal MRI. The association of the lumbosacral transitional vertebra pseudoarthroses and S1 nerve root entrapment due to degenerative stenosis of the nerve root canal has never been described. We present 12 patients with lumbosacral transitional vertebrae that were referred for symptoms and signs of S1 nerve root radiculopathy in which the sagittal and axial MRI sequences failed to identify a plausible cause for the patients' S1 nerve root symptoms. A coronal T1-weighted imaging (T1WI) MRI sequence was consequently added to the investigation. The coronal T1WI MRI sequence demonstrated hypertrophic degenerative stenosis of the S1 nerve root canal at the level of the lumbosacral transitional vertebra pseudoarthrosis, with entrapment of the respective S1 nerve root in all patients. We emphasize the value of coronal T1WI MRI of the lumbosacral junction and sacrum if the cause for S1 radicular symptoms was not identified on conventional sagittal and axial MRI sequences in patients with lumbosacral transitional vertebrae. (orig.)

  17. Clinical Study of S-1 Plus Oxaliplatin Versus S-1 Plus Cisplatin as First-Line Treatment for Elderly Patients with Advanced Gastric Cancer

    Directory of Open Access Journals (Sweden)

    Deng-feng BO

    2015-12-01

    Full Text Available Abstract Objective: To explore the efficacy and safety of S-1 plus oxaliplatin versus S-1 plus cisplatin as the first-line treatment for elderly patients with advanced gastric cancer. Methods: A total of 60 patients with advanced gastric cancer admitted in Xi’an Yanliang Railway Hospital from Jan., 2011 to Oct., 2013 were selected as study objects and randomly divided into 2 groups: S1 plus oxaliplatin group (SOX group, 30 cases and S1 plus cisplatin group (SP group, 30 cases. SOX group were given intravenous drip of 130 mg/m2 oxaliplatin for 2 h on d1. And S-1 was also given according to body surface area: body surface area <1.25 m2, 40 mg once; 1.25-1.5 m2, 60 mg once; >1.5, 28 d as 1 cycle. SP group was administered with intravenous drip of 25 mg/m2 cisplatin during d1-d3. Treatment was discontinued until the occurrence of disease progression or patients’ intolerance to chemotherapy. Results: SOX group was non-inferior to SP group in overall response rate (ORR (53.3% vs. 43.3%, disease control rate (DCR (83.3% vs. 80.0%, median progression-free survival (PFS (7.0 vs. 6.0 months and median overall survival (OS (11.0 vs. 10.5 months. However, the difference was statistical significant in the rate of increased KPS score (86.7% vs. 46.7%, χ2=10.800, P=0.001 and the rate of increased FACT-G score (73.3% vs. 36.7%, χ2=8.148, P=0.004. The main toxic and side effects of two groups was hematological toxicity. There was no degree III-IV toxic and side effects occurring in non hematological toxicity in two groups. The main toxic effect was peripheral neuritis in SOX group, and nausea and vomiting and renal dysfunction in SP group, and there were statistical differences in the above toxic and side effects between two groups (P<0.05. Conclusion: SOX regimen is as safe and effective as SP regimen for elderly patients with advanced gastric cancer, with better quality of life and less toxic and side effects.

  18. Separation and characterization of mares' milk alpha(s1)-, beta-, kappa-caseins, gamma-casein-like, and proteose peptone component 5-like peptides.

    Science.gov (United States)

    Egito, A S; Miclo, L; López, C; Adam, A; Girardet, J M; Gaillard, J L

    2002-04-01

    The equine alpha(s1)- and beta-caseins (CN) were purified by chromatography on DEAE-cellulose and by reversed-phase HPLC. The alpha(s1)-, beta-, and kappa-CN were characterized either by monodimensional urea-PAGE or sodium dodecylsulfate (SDS)-PAGE or by bidimensional electrophoresis. Kappa-casein was characterized after electrophoresis by glycoprotein-specific staining. To identify alpha(s1)-CN without ambiguity, internal sequences were determined after trypsin or chymosin digestion of purified alpha(s1)-CN. These sequences, that could be estimated to correspond to 62% of the full protein, presented strong identities with regions of alpha(s1)-CN primary structures of other species. In particular, 51, 48, 43, and 40% identities were obtained with corresponding regions of sow, dromedary, cow, and human alpha(s1)-CN, respectively. On the other hand, trace amounts of equine gamma-CN-like and proteose peptone component 5-like peptides were found in the whole CN. They were identified by microsequencing and corresponded to beta-CN peptides generated by plasmin action on the whole CN. The equine alpha(s1), beta-, and kappa-CN were separated by bidimensional electrophoresis in numerous isoelectric variants with apparent isoelectric points distributed between pH 4.4 to 6.3, 4.4 to 5.9, and 3.5 to 5.5, respectively. The beta- and kappa-CN displayed a more acidic character in the mare than in the cow.

  19. 青海牛乳中αs1-酪蛋白的电泳研究%Investigation on αs1-Casein in Milk of Cattle in Qinghai Province by Electrophoresis

    Institute of Scientific and Technical Information of China (English)

    张才骏; 张海峰; 邓生栋; 才仁三德布

    2000-01-01

    对青海省4个品种560头牛乳中的αs1-酪蛋白进行了电泳研究.结果发现:(1)青海牛乳中αs1-酪蛋白基因座受αs1-CNR,αs1-CNC,αs1-CND和αs1-CNE4个等位基因的控制,有αs1-CN BB,αs1-CN BC,αs1-CN BD,αs1-CN BE,αs1-CN CC和αs1-CN CD 6种基因型;(2)在青海东部黄牛中发现一种新等位基因αs1-CNE和一种罕见等位基因αs1-CND;(3)在αs1-CN基因座上,柴达木黄牛与青海东部黄牛之间有最近的亲缘关系,而杂种牛与黑白花牛的亲缘关系较近.

  20. Frequency and Pathological Phenotype of Bovine Astrovirus CH13/NeuroS1 Infection in Neurologically-Diseased Cattle: Towards Assessment of Causality

    Directory of Open Access Journals (Sweden)

    Senija Selimovic-Hamza

    2017-01-01

    Full Text Available Next-generation sequencing (NGS has opened up the possibility of detecting new viruses in unresolved diseases. Recently, astrovirus brain infections have been identified in neurologically diseased humans and animals by NGS, among them bovine astrovirus (BoAstV CH13/NeuroS1, which has been found in brain tissues of cattle with non-suppurative encephalitis. Only a few studies are available on neurotropic astroviruses and a causal relationship between BoAstV CH13/NeuroS1 infections and neurological disease has been postulated, but remains unproven. Aiming at making a step forward towards assessing the causality, we collected brain samples of 97 cases of cattle diagnosed with unresolved non-suppurative encephalitis, and analyzed them by in situ hybridization and immunohistochemistry, to determine the frequency and neuropathological distribution of the BoAstV CH13/NeuroS1 and its topographical correlation to the pathology. We detected BoAstV CH13/NeuroS1 RNA or proteins in neurons throughout all parts of the central nervous system (CNS in 34% of all cases, but none were detected in cattle of the control group. In general, brain lesions had a high correlation with the presence of the virus. These findings show that a substantial proportion of cattle with non-suppurative encephalitis are infected with BoAstV CH13/NeuroS1 and further substantiate the causal relationship between neurological disease and astrovirus infections.

  1. Frequency and Pathological Phenotype of Bovine Astrovirus CH13/NeuroS1 Infection in Neurologically-Diseased Cattle: Towards Assessment of Causality

    Science.gov (United States)

    Selimovic-Hamza, Senija; Boujon, Céline L.; Hilbe, Monika; Oevermann, Anna; Seuberlich, Torsten

    2017-01-01

    Next-generation sequencing (NGS) has opened up the possibility of detecting new viruses in unresolved diseases. Recently, astrovirus brain infections have been identified in neurologically diseased humans and animals by NGS, among them bovine astrovirus (BoAstV) CH13/NeuroS1, which has been found in brain tissues of cattle with non-suppurative encephalitis. Only a few studies are available on neurotropic astroviruses and a causal relationship between BoAstV CH13/NeuroS1 infections and neurological disease has been postulated, but remains unproven. Aiming at making a step forward towards assessing the causality, we collected brain samples of 97 cases of cattle diagnosed with unresolved non-suppurative encephalitis, and analyzed them by in situ hybridization and immunohistochemistry, to determine the frequency and neuropathological distribution of the BoAstV CH13/NeuroS1 and its topographical correlation to the pathology. We detected BoAstV CH13/NeuroS1 RNA or proteins in neurons throughout all parts of the central nervous system (CNS) in 34% of all cases, but none were detected in cattle of the control group. In general, brain lesions had a high correlation with the presence of the virus. These findings show that a substantial proportion of cattle with non-suppurative encephalitis are infected with BoAstV CH13/NeuroS1 and further substantiate the causal relationship between neurological disease and astrovirus infections. PMID:28106800

  2. Antitumor activity of a combination of trastuzumab (Herceptin) and oral fluoropyrimidine S-1 on human epidermal growth factor receptor 2-overexpressing pancreatic cancer.

    Science.gov (United States)

    Saeki, Hiroyuki; Yanoma, Shunsuke; Takemiya, Shouji; Sugimasa, Yukio; Akaike, Makoto; Yukawa, Norio; Rino, Yasushi; Imada, Toshio

    2007-08-01

    The cytotoxic effect of trastuzumab in combination with oral fluoropyrimidine S-1 on human epidermal growth factor receptor 2 (HER2)-overexpressing human pancreatic cancer cell line TRG in vitro and in vivo was investigated. HER2 expression in TRG was analyzed by RT-PCR and flow cytometry. For in vitro experiments, 5-fluorouracil (5-FU) was used instead of S-1. In vivo studies were conducted with TRG xenografts in athymic mice. Trastuzumab (10 mg/kg) was administered intraperitoneally once a week for 4 weeks. S-1 (10 mg/kg) was administered orally 5 days a week for 4 weeks. The results showed that TRG cells were positive for HER2 mRNA and overexpressed HER2 protein. Either trastuzumab or 5-FU concentration-dependently inhibited the growth of TRG cells. The combination of trastuzumab and 5-FU resulted in a significant inhibition of growth of TRG cells compared to either agent alone (P<0.001). Incubation of TRG cells with peripheral blood mononuclear cells after treatment with trastuzumab enhanced the antiproliferative effect of trastuzumab, which could be the result of antibody-dependent cellular cytotoxicity. The combination of trastuzumab and S-1 resulted in a significant reduction in xenograft volume compared to each agent alone (P<0.0001). In conclusion, this study showed that combination therapy with trastuzumab and S-1 may be effective for HER2-overexpressing pancreatic cancer patients.

  3. Modelled microgravity cultivation modulates N-acylhomoserine lactone production in Rhodospirillum rubrum S1H independently of cell density.

    Science.gov (United States)

    Mastroleo, Felice; Van Houdt, Rob; Atkinson, Steve; Mergeay, Max; Hendrickx, Larissa; Wattiez, Ruddy; Leys, Natalie

    2013-12-01

    The photosynthetic alphaproteobacterium Rhodospirillum rubrum S1H is part of the Micro-Ecological Life Support System Alternative (MELiSSA) project that is aiming to develop a closed life support system for oxygen, water and food production to support human life in space in forthcoming long-term space exploration missions. In the present study, R. rubrum S1H was cultured in a rotating wall vessel (RWV), simulating partial microgravity conditions on Earth. The bacterium showed a significant response to cultivation in simulated microgravity at the transcriptomic, proteomic and metabolic levels. In simulated microgravity conditions three N-acyl-l-homoserine lactones (C10-HSL, C12-HSL and 3-OH-C14-HSL) were detected in concentrations that were twice those detected under normal gravity, while no differences in cell density was detected. In addition, R. rubrum cultivated in modelled microgravity showed higher pigmentation than the normal gravity control, without change in culture oxygenation. When compared to randomized microgravity cultivation using a random positioning machine, significant overlap for the top differentially expressed genes and proteins was observed. Cultivation in this new artificial environment of simulated microgravity showed new properties of this well-known bacterium, including its first, to our knowledge, complete quorum-sensing-related N-acylhomoserine lactone profile.

  4. Suppressive Effects of the Site 1 Protease (S1P) Inhibitor, PF-429242, on Dengue Virus Propagation.

    Science.gov (United States)

    Uchida, Leo; Urata, Shuzo; Ulanday, Gianne Eduard L; Takamatsu, Yuki; Yasuda, Jiro; Morita, Kouichi; Hayasaka, Daisuke

    2016-02-10

    Dengue virus (DENV) infection causes one of the most widespread mosquito-borne diseases in the world. Despite the great need, effective vaccines and practical antiviral therapies are still under development. Intracellular lipid levels are regulated by sterol regulatory elements-binding proteins (SREBPs), which are activated by serine protease, site 1 protease (S1P). Small compound PF-429242 is known as a S1P inhibitor and the antivirus effects have been reported in some viruses. In this study, we examined the anti-DENV effects of PF-429242 using all four serotypes of DENV by several primate-derived cell lines. Moreover, emergence of drug-resistant DENV mutants was assessed by sequential passages with the drug. DENV dependency on intracellular lipids during their infection was also evaluated by adding extracellular lipids. The addition of PF-429242 showed suppression of viral propagation in all DENV serotypes. We showed that drug-resistant DENV mutants are unlikely to emerge after five times sequential passages through treatment with PF-429242. Although the levels of intracellular cholesterol and lipid droplets were reduced by PF-429242, viral propagations were not recovered by addition of exogenous cholesterol or fatty acids, indicating that the reduction of LD and cholesterol caused by PF-429242 treatment is not related to its mechanism of action against DENV propagation. Our results suggest that PF-429242 is a promising candidate for an anti-DENV agent.

  5. SIRT1 mediates Sphk1/S1P-induced proliferation and migration of endothelial cells.

    Science.gov (United States)

    Gao, Zhan; Wang, Hua; Xiao, Feng-Jun; Shi, Xue-Feng; Zhang, Yi-Kun; Xu, Qin Qin; Zhang, Xiao-Yan; Ha, Xiao-Qin; Wang, Li-Sheng

    2016-05-01

    Angiogenesis is one of the most important components of embryonic organ formation and vessel growth after birth. Sphingosine kinase 1 (Sphk1) and S1P has been confirmed to participate in various cell signaling pathways and physiological processes including neovascularisation. However, the mechanisms that Sphk1/S1P regulates neovascularisation remain unclear. In this study, we elucidated that Sphk1/S1P upregulates sirtuin 1 (SIRT1), a NAD+ dependent deacetylases protease which exerts multiple cellular functions, to regulate the proliferation and migration of endothelial cells. By using CCK8 and Transwell assays, we demonstrated that Sphk1 and SIRT1 knockdown could significantly decrease proliferation and migration of HUVEC cells. Sphk1 inhibition results in SIRT1 downregulation which could be reversed by exogenous S1P in HUVEC cells. Treatment of HUVECs with S1P reverses the impaired proliferation and migration caused by SIRT1 knockdown. Furthermore, Sphk1 knockdown inhibits the phosphorylation of P38 MAPK, ERK and AKT. Treatment of HUVECs with PD98059, SB203580 and Wortmannin, which are the inhibitors of ERK, P38 MAPK and AKT respectively, resulted in decreased SIRT1 expression and reduced migration of HUVEC cells. Thus, we conclude that Sphk1/S1P induces SIRT1 upregulation through multiple pathways including P38 MAPK, ERK and AKT signals. This is the first report to disclose the existence and roles of Sphk1/S1P/SIRT1 axis in regulation of endothelial cell proliferation and migration, which may provide a theoretical basis for angiogenesis.

  6. Randomized study comparing full dose monotherapy (S-1 followed by irinotecan) and reduced dose combination therapy (S-1/oxaliplatin followed by S-1/irinotecan) as initial therapy for older patients with metastatic colorectal cancer

    DEFF Research Database (Denmark)

    Winther, Stine Braendegaard; Österlund, Pia; Berglund, Åke

    2017-01-01

    be a sequential full-dose monotherapy chemotherapy approach or a dose-reduced combination chemotherapy approach. The oral 5FU prodrug S-1 seems to have less side effects than capecitabine and should be an optimal drug for older patients, but few data are available. Improved geriatric assessments are needed......-dose standard combination therapy. Additional bevacizumab (7.5 mg/kg) is optional in first-line. Blood samples and tumor tissue will be collected to investigate predictive markers. Geriatric screening tools (G-8, VES-13, Timed-Up-and-Go and Handgrip strength), Charlson Comorbidty Index and quality of life......-treatment characteristics and geriatric assessments. Discussion: The study will add knowledge on how to treat older mCRC patients who are not candidates for standard combination therapy. Furthermore it may provide understanding of efficacy and tolerability of chemotherapy in older cancer patients and thus offer a better...

  7. Coherent quantum control of internal conversion: {S}_{2}\\;\\leftrightarrow \\;{S}_{1} in pyrazine via {S}_{0}\\;\\to \\;{S}_{2}/{S}_{1} weak field excitation

    Science.gov (United States)

    Grinev, Timur; Shapiro, Moshe; Brumer, Paul

    2015-09-01

    Coherent control of internal conversion (IC) between the first (S1) and second (S2) singlet excited electronic states in pyrazine, where the S2 state is populated from the ground singlet electronic state S0 by weak field excitation, is examined. Control is implemented by shaping the laser which excites S2. Excitation and IC are considered simultaneously, using the recently introduced resonance-based control approach. Highly successful control is achieved by optimizing both the amplitude and phase profiles of the laser spectrum. The dependence of control on the properties of resonances in S2 is demonstrated.

  8. Acylguanidine inhibitors of beta-secretase: optimization of the pyrrole ring substituents extending into the S1' substrate binding pocket.

    Science.gov (United States)

    Jennings, Lee D; Cole, Derek C; Stock, Joseph R; Sukhdeo, Mohani N; Ellingboe, John W; Cowling, Rebecca; Jin, Guixian; Manas, Eric S; Fan, Kristi Y; Malamas, Michael S; Harrison, Boyd L; Jacobsen, Steve; Chopra, Rajiv; Lohse, Peter A; Moore, William J; O'Donnell, Mary-Margaret; Hu, Yun; Robichaud, Albert J; Turner, M James; Wagner, Erik; Bard, Jonathan

    2008-01-15

    The proteolytic enzyme beta-secretase (BACE-1) produces amyloid beta (Abeta) peptide, the primary constituent of neurofibrillary plaques, implicated in Alzheimer's disease, by cleavage of the amyloid precursor protein. A small molecule inhibitor of BACE-1, (diaminomethylene)-2,5-diphenyl-1H-pyrrole-1-acetamide (1, BACE-1 IC(50)=3.7 microM), was recently described, representing a new small molecule lead. Initial SAR investigation demonstrated the potential of accessing the nearby S(3) and S(1)(') substrate binding pockets of the BACE-1 enzyme by building substituents off one of the phenyl substituents and guanidinyl functional group. We report here the optimization of guanidinyl functional group substituents on 1, leading to potent submicromolar BACE-1 inhibitors.

  9. Arthrodesis to L5 versus S1 in long instrumentation and fusion for degenerative lumbar scoliosis.

    Science.gov (United States)

    Cho, Kyu-Jung; Suk, Se-Il; Park, Seung-Rim; Kim, Jin-Hyok; Choi, Sung-Wook; Yoon, Young-Hyun; Won, Man-Hee

    2009-04-01

    There is a debate regarding the distal fusion level for degenerative lumbar scoliosis. Whether a healthy L5-S1 motion segment should be included or not in the fusion remains controversial. The purpose of this study was to determine the optimal indication for the fusion to the sacrum, and to compare the results of distal fusion to L5 versus the sacrum in the long instrumented fusion for degenerative lumbar scoliosis. A total of 45 patients who had undergone long instrumentation and fusion for degenerative lumbar scoliosis were evaluated with a minimum 2 year follow-up. Twenty-four patients (mean age 63.6) underwent fusion to L5 and 21 patients (mean age 65.6) underwent fusion to the sacrum. Supplemental interbody fusion was performed in 12 patients in the L5 group and eleven patients in the sacrum group. The number of levels fused was 6.08 segments (range 4-8) in the L5 group and 6.09 (range 4-9) in the sacrum group. Intraoperative blood loss (2,754 ml versus 2,938 ml) and operative time (220 min versus 229 min) were similar in both groups. The Cobb angle changed from 24.7 degrees before surgery to 6.8 degrees after surgery in the L5 group, and from 22.8 degrees to 7.7 degrees in the sacrum group without statistical difference. Correction of lumbar lordosis was statistically better in the sacrum group (P = 0.03). Less correction of lumbar lordosis in the L5 group seemed to be associated with subsequent advanced L5-S1 disc degeneration. The change of coronal and sagittal imbalance was not different in both groups. Subsequent advanced L5-S1 disc degeneration occurred in 58% of the patients in the L5 group. Symptomatic adjacent segment disease at L5-S1 developed in five patients. Interestingly, the development of adjacent segment disease was not related to the preoperative grade of disc degeneration, which proved minimal degeneration in the five patients. In the L5 group, there were nine patients of complications at L5-S1 segment, including adjacent segment disease at

  10. Far-ultraviolet Observations of Comet C/2012 S1 (ISON) from FORTIS

    CERN Document Server

    McCandliss, Stephan R; Weaver, Harold; Fleming, Brian; Redwine, Keith; Li, Mary J; Kutyrev, Alexander; Moseley, S Harvey

    2016-01-01

    We have used the unique far-UV imaging capability offered by a sounding rocket borne instrument to acquire observations of C/2012 S1 (ISON) when its angular separation with respect to the sun was 26.3deg, on 2013 November 20.49. At the time of observation the comet's heliocentric distance and velocity relative to the sun were rh = 0.43 AU and rh_dot = -62.7 km s^-1. Images dominated by C I 1657 A and H I 1216 A were acquired over a 1e6 x 1e6 km^2 region. The water production rate implied by the Lyman alpha observations is constrained to be Q_H2O approximately 8e29 s^-1 while the neutral carbon production rate was Q_C approximately 4e28 s^-1. The radial profile of C I was consistent with it being a dissociation product of a parent molecule with a lifetime approximately 5e4 seconds, favoring a parent other than CO. We constrain the Q_CO production rate to 5(+1.5, -7.5)e28 s^-1 with 1sigma errors derived from photon statistics. The upper limit on the Q_CO/Q_H2O < 6%.

  11. Far-ultraviolet Observations of Comet C/2012 S1 (ISON) from FORTIS

    Science.gov (United States)

    McCandliss, Stephan R.; Feldman, Paul D.; Weaver, Harold; Fleming, Brian; Redwine, Keith; Li, Mary J.; Kutyrev, Alexander; Moseley, S. Harvey

    2016-09-01

    We have used the unique far-UV imaging capability offered by a sounding-rocket-borne instrument to acquire observations of C/2012 S1 (ISON) when its angular separation with respect to the Sun was 26.°3 on 2013 November 20.49. At the time of observation, the comet’s heliocentric distance and velocity relative to the Sun were r h = 0.43 au and {\\dot{r}}h = -62.7 km s-1. Images dominated by C i λ1657 and H i λ1216 were acquired over a 106 × 106 km2 region. The water production rate implied by the Lyα observations is constrained to be {Q}{{{H}}2{{O}}}≈ 8 × 1029 s-1 while the neutral carbon production rate was {Q}C ≈ 4 ×1028 s-1. The radial profile of C i was consistent with it being a dissociation product of a parent molecule with a lifetime τ ˜ 5 × 104 s, favoring a parent other than CO. We constrain the Q CO production rate to {5}-7.5+1.5 × 1028 s-1 with 1σ errors derived from photon statistics. The upper limit on the Q CO/{Q}{{{H}}2{{O}}} is ≲6%.

  12. Novel S1P1 receptor agonists - Part 5: From amino-to alkoxy-pyridines.

    Science.gov (United States)

    Bolli, Martin H; Lescop, Cyrille; Birker, Magdalena; de Kanter, Ruben; Hess, Patrick; Kohl, Christopher; Nayler, Oliver; Rey, Markus; Sieber, Patrick; Velker, Jörg; Weller, Thomas; Steiner, Beat

    2016-06-10

    In a previous communication we reported on the discovery of aminopyridine 1 as a potent, selective and orally active S1P1 receptor agonist. More detailed studies revealed that this compound is phototoxic in vitro. As a result of efforts aiming at eliminating this undesired property, a series of alkoxy substituted pyridine derivatives was discovered. The photo irritancy factor (PIF) of these alkoxy pyridines was significantly lower than the one of aminopyridine 1 and most compounds were not phototoxic. Focused SAR studies showed, that 2-, 3-, and 4-pyridine derivatives delivered highly potent S1P1 receptor agonists. While the 2-pyridines were clearly more selective against S1PR3, the corresponding 3- or 4-pyridine analogues showed significantly longer oral half-lives and as a consequence longer pharmacological duration of action after oral administration. One of the best compounds, cyclopentoxy-pyridine 45b lacked phototoxicity, showed EC50 values of 0.7 and 140 nM on S1PR1 and S1PR3, respectively, and maximally reduced the blood lymphocyte count for at least 24 h after oral administration of 10 mg/kg to Wistar rats.

  13. Additive effects of oral fluoropyrimidine derivative S-1 and radiation on human hypopharyngeal cancer xenografts.

    Science.gov (United States)

    Nakagawa, Takahiro; Otsuki, Naoki; Masai, Yohko; Sasaki, Ryohei; Tsukuda, Mamoru; Nibu, Ken-Ichi

    2008-08-01

    The results presented here provide evidence of the enhancing effect of oral fluoropyrimidine derivative S-1 in concomitant chemoradiotherapy for head and neck cancer and further insights into its biological mechanism. To investigate the additive effect of S-1 and radiation for human hypopharyngeal cancer. Nude mice bearing hypopharyngeal cancer cells (H891) were used for an in vivo model. S-1 was administered at a volume of 0.01 mg/g body weight per mouse for 14 days, and tumors were irradiated with 2.0 Gy on days 1 and 8. Mice treated with either radiation or S-1 alone were used as controls. The growth of tumors in each group was measured and, after completion of the treatment, a focused DNA array was used to determine mRNA expression levels in the tumors of 132 genes related to 5-fluorouracil (5-FU), radiation or carcinogenesis. The additive antitumor effect of S-1 and radiation was statistically confirmed on day 14 (p=0.01). DNA array assay showed significant changes in expression of several genes, including DNA repair gene POLD, angiogenesis-related genes bFGF and TP, DNA topoisomerase TOP2A, and nucleoside transporter gene ENT1.

  14. Combined gemcitabine and S-1 chemotherapy for treating unresectable hilar cholangiocarcinoma: a randomized open-label clinical trial.

    Science.gov (United States)

    Li, Hao; Zhang, Zheng-Yun; Zhou, Zun-Qiang; Guan, Jiao; Tong, Da-Nian; Zhou, Guang-Wen

    2016-05-03

    Although the combination of cisplatin and gemcitabine (GEM) is considered the standard first-line chemotherapy against unresectable hilar cholangiocarcinoma (HC), its efficacy is discouraging. The present randomized open-label clinical trial aimed to evaluate the efficacy and safety of the GEM plus S-1 (GEM-S-1) combination against unresectable HC. Twenty-five patients per group were randomly assigned to receive GEM, S-1 or GEM-S-1. Neutropenia (56%) and leukopenia (40%) were the most common chemotherapy-related toxicities in the GEM-S-1 group. Median overall survival (OS) in the GEM-S-1, GEM and S-1 groups was 11, 10 and 6 months, respectively. GEM plus S-1 significantly improved OS compared to S-1 monotherapy (OR=0.68; 95%CI, 0.50-0.90; P=0.008). Median progression-free survival (PFS) times in the GEM-S-1, GEM and S-1 groups were 4.90, 3.70 and 1.60 months, respectively. GEM plus S-1 significantly improved PFS compared to S-1 monotherapy (OR=0.50; 95%CI, 0.27-0.91; P=0.024). Response rates were 36%, 24% and 8% in the GEM-S-1, GEM and S-1 groups, respectively. A statistically significant difference was found in response rates between the gemcitabine-S-1 and S-1 groups (36% vs 8%, P=0.017). Patients with CA19-9S-1 provides a better OS, PFS and response rate than S-1 monotherapy, but it did not significantly differ from GEM monotherapy. (ChiCTR-TRC-14004733).

  15. Observation of the decay D s1 (2536) → D∗ OK +

    Science.gov (United States)

    Albrecht, H.; Ehrlichmann, H.; Hamacher, T.; Hofmann, R. P.; Kirchhoff, T.; Nau, A.; Nowak, S.; Schröder, H.; Schulz, H. D.; Walter, M.; Wurth, R.; Appuhn, R. D.; Hast, C.; Kolanoski, H.; Lange, A.; Linder, A.; Mankel, R.; Schieber, M.; Siegmund, T.; Spaan, B.; Thurn, H.; Töpfer, D.; Walther, A.; Wegener, D.; Paulini, M.; Reim, K.; Wegener, H.; Mundt, R.; Oest, T.; Reiner, R.; Schmidt-Parzefall, W.; Funk, W.; Stiewe, J.; Werner, S.; Ehret, K.; Hofmann, W.; Hüpper, A.; Khan, S.; Knöpfle, K. T.; Spengler, J.; Britton, D. I.; Charlesworth, C. E. K.; Edwards, K. W.; Hyatt, E. R. F.; Kapitza, H.; Krieger, P.; Macfarlane, D. B.; Patel, P. M.; Prentice, J. D.; Saull, P. R. B.; Tzamariudaki, K.; van de Water, R. G.; Yoon, T.-S.; Reβing, D.; Schmidtler, M.; Schneider, M.; Schubert, K. R.; Strahl, K.; Waldi, R.; Weseler, S.; Kernel, G.; Križan, P.; Križnič, E.; Podobnik, T.; Živko, T.; Cronström, H. I.; Jönsson, L.; Balagura, V.; Belyaev, I.; Danilov, M.; Droutskoy, A.; Golutvin, A.; Gorelov, I.; Kostina, G.; Lubinov, V.; Murat, P.; Pakhlov, P.; Ratnikov, F.; Semenov, S.; Shibaev, V.; Soloshenko, V.; Tichomirov, I.; Zaitsev, Yu.; Argus Collaboration

    1992-12-01

    Using the ARGUS detector at the e+e- storage ring using DORIS II at DESY, we have observed a new decay channel for the excited charm-strange meson D s1(2536) +→D∗ OK +. The production cross section for the Ds1 (2536) + decaying via this channel is measured to be σ ( D s1(2536) +)· BR(D sl(2536) +→D∗ 0K +)= 18±4±3 pb at ECM = 10.4 GeV. The mass of the Ds1 (2536) + is found to be 2535.2 ± 0.5±1.5 MeV/ c2 in agreement with the value obtained from an analysis of the D s1(2536) +→D∗ +K 0s decay channel. The natural width is determined to be less than 3.9 MeV/ c2 at 90%CL.

  16. The acrylamide (S)-1 differentially affects Kv7 (KCNQ) potassium channels

    DEFF Research Database (Denmark)

    Bentzen, Bo Hjorth; Schmitt, Nicole; Calloe, Kirstine;

    2006-01-01

    .g., retigabine) for treatment of epilepsy and neuropathic pain. We investigated the effect of a Bristol-Myers Squibb compound (S)-N-[1-(3-morpholin-4-yl-phenyl)-ethyl]-3-phenyl-acrylamide [(S)-1] on cloned human Kv7.1-5 potassium channels expressed in Xenopus laevis oocytes. Using two-electrode voltage......-clamp recordings we found that (S)-1 blocks Kv7.1 and Kv7.1/KCNE1 currents. In contrast, (S)-1 produced a hyperpolarizing shift of the activation curve for Kv7.2, Kv7.2/Kv7.3, Kv7.4 and Kv7.5. Further, the compound enhanced the maximal current amplitude at all potentials for Kv7.4 and Kv7.5 whereas the combined...

  17. A precision measurement of the D_s1(2536) meson mass and decay width

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Ford, K E; Hart, A J; Harrison, T J; Hawkes, C M; Morgan, S E; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, Y K; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; LoSecco, J M; Allmendinger, T; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Mihályi, A; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H; al, et

    2006-01-01

    The decay width and the mass of the D_s1(2536) have been measured via the decay channel D_s1 -> D*+K_S using 232 fb^-1 of data collected with the BABAR detector at the PEP-II asymmetric-energy e+e- storage ring. The result for the decay width is (1.03 +- 0.05 +- 0.12) MeV/c^2, with the first error denoting the statistical uncertainty and the second one the systematic uncertainty. For the mass, a value of (2534.85 +- 0.02 +- 0.40) MeV/c^2 has been obtained. The systematic error is dominated by the uncertainty on the D*+ mass. The mass difference between the D_s1 and D*+ has been measured to be (524.85 +- 0.02 +- 0.04) MeV/c^2.

  18. Impact of intratumoral expression levels of fluoropyrimidine-metabolizing enzymes on treatment outcomes of adjuvant S-1 therapy in gastric cancer.

    Science.gov (United States)

    Kim, Ji-Yeon; Shin, Eun; Kim, Jin Won; Lee, Hye Seung; Lee, Dae-Won; Kim, Se-Hyun; Lee, Jeong-Ok; Kim, Yu Jung; Kim, Jee Hyun; Bang, Soo-Mee; Ahn, Sang-Hoon; Park, Do Joong; Lee, Jong Seok; Lee, Ju-Seog; Kim, Hyung-Ho; Lee, Keun-Wook

    2015-01-01

    We analyzed the expression levels of fluoropyrimidine-metabolizing enzymes (thymidylate synthase [TS], dihydropyrimidine dehydrogenase [DPD], thymidine phosphorylase [TP] and orotate phosphoribosyltransferase [OPRT]) to identify potential biomarkers related to treatment outcomes in gastric cancer (GC) patients receiving adjuvant S-1 chemotherapy. In this study, 184 patients who received curative gastrectomy (D2 lymph node dissection) and adjuvant S-1 were included. Immunohistochemistry and quantitative reverse transcription polymerase chain reaction were performed to measure the protein and mRNA levels of TS, DPD, TP, and OPRT in tumor tissue. In univariate analysis, low intratumoral DPD protein expression was related to poorer 5-year disease-free survival (DFS; 78% vs. 88%; P = 0.068). Low intratumoral DPD mRNA expression (1st [lowest] quartile) was also related to poorer DFS (69% vs. 90%; P DPD expression (2nd to 4th quartiles). In multivariate analyses, low intratumoral DPD protein or mRNA expression was related to worse DFS (P DPD mRNA expression (29% vs. 16%; P = 0.068). In conclusion, GC patients with high intratumoral DPD expression did not have inferior outcome following adjuvant S-1 therapy compared with those with low DPD expression. Instead, low intratumoral DPD expression was related to poor DFS.

  19. Regulation of Differentiation of Nitrogen-Fixing Bacteria by Microsymbiont Targeting of Plant Thioredoxin s1.

    Science.gov (United States)

    Ribeiro, Carolina Werner; Baldacci-Cresp, Fabien; Pierre, Olivier; Larousse, Marie; Benyamina, Sofiane; Lambert, Annie; Hopkins, Julie; Castella, Claude; Cazareth, Julie; Alloing, Geneviève; Boncompagni, Eric; Couturier, Jérémy; Mergaert, Peter; Gamas, Pascal; Rouhier, Nicolas; Montrichard, Françoise; Frendo, Pierre

    2017-01-23

    Legumes associate with rhizobia to form nitrogen (N2)-fixing nodules, which is important for plant fitness [1, 2]. Medicago truncatula controls the terminal differentiation of Sinorhizobium meliloti into N2-fixing bacteroids by producing defensin-like nodule-specific cysteine-rich peptides (NCRs) [3, 4]. The redox state of NCRs influences some biological activities in free-living bacteria, but the relevance of redox regulation of NCRs in planta is unknown [5, 6], although redox regulation plays a crucial role in symbiotic nitrogen fixation [7, 8]. Two thioredoxins (Trx), Trx s1 and s2, define a new type of Trx and are expressed principally in nodules [9]. Here, we show that there are four Trx s genes, two of which, Trx s1 and s3, are induced in the nodule infection zone where bacterial differentiation occurs. Trx s1 is targeted to the symbiosomes, the N2-fixing organelles. Trx s1 interacted with NCR247 and NCR335 and increased the cytotoxic effect of NCR335 in S. meliloti. We show that Trx s silencing impairs bacteroid growth and endoreduplication, two features of terminal bacteroid differentiation, and that the ectopic expression of Trx s1 in S. meliloti partially complements the silencing phenotype. Thus, our findings show that Trx s1 is targeted to the bacterial endosymbiont, where it controls NCR activity and bacteroid terminal differentiation. Similarly, Trxs are critical for the activation of defensins produced against infectious microbes in mammalian hosts. Therefore, our results suggest the Trx-mediated regulation of host peptides as a conserved mechanism among symbiotic and pathogenic interactions. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Pharmacokinetic evaluation of novel oral fluorouracil antitumor drug S-1 in Chinese cancer patients

    Institute of Scientific and Technical Information of China (English)

    Zhi-xiang ZHUANG; Hong ZHU; Ji WANG; Min-gao ZHU; Hui WANG; Wang-yang PU; Hua-hui BIAN

    2013-01-01

    Aim:S-1 is an oral anticancer fluoropyrimidine formulation consisting of tegafur,5-chloro-2,4-dihydroxypyridine and potassium oxonate.The aim of this study was to evaluate the pharmacokinetics and bioequivalence of a newly developed generic formulation of S-1 in Chinese cancer patients in comparison with the branded reference formulation of S-1.Methods:A single-dose,randomized-sequence,open-label,two-way self-crossover study was conducted in 30 Chinese cancer patients.The subjects alternatively received the two formulations (40 mg/m2,po) with a 7-d interval.Plasma concentrations of FT,CDHP,Oxo,and 5-Fu were determined using LC-MS/MS.Pharmacokinetic parameters,including C Tmax,t1/2,AUC0-t,and AUC0-∞ were determined using non-compartmental models with DAS2.0 software.Bioequivalence of the two formulations were to be evaluated according to 90% Cls for the log-transformed ratios of AUC and Cmax of S-1.Adverse events were evaluated through monitoring the symptom,physical and laboratory examinations,ECGs and subject interviews.Results:The mean values of Cmax,AUC0-t,and AUC0-∞ of FT,5-Fu,CDHP,and Oxo for the two formulations had no significant differences.The 90% Cls for natural log-transformed ratios of C AUC0-t,and AUC0-∞ were within the predetermined bioequivalence acceptance limits.A total of 11 mild adverse events,including fatigue,nausea and vomiting,anorexia,diarrhea and myelosuppression,were observed,and no serious and special adverse events were found.Conclusion:The newly developed generic formulation and reference formulation of S-1 have similar pharmacokinetics with one dose (40 mg/m2) in Chinese cancer patients.Both the formulations of S-1 are well tolerated.

  1. 11-cis retinal torsion: A QTAIM and stress tensor analysis of the S1 excited state

    Science.gov (United States)

    Maza, Julio R.; Jenkins, Samantha; Kirk, Steven R.

    2016-05-01

    We investigate torsion about the C11-C12 bond mid-point for the S1 state of 11-cis retinal, using a QTAIM and stress tensor analysis. The QTAIM and stress tensor responses to a torsion ±α increase at a faster rate for the preferred direction of torsion though the CI seam. A QTAIM and stress tensor vector-based analysis provides an alternative way of characterising the asymmetry of the S1 potential energy surface. In the vicinity of the CI seam the ellipticity ε attained minimum values. The application of this analysis to molecular rotary motors is briefly discussed.

  2. Multispot array combined with S1 nuclease-mediated elimination of unpaired nucleotides

    DEFF Research Database (Denmark)

    Yoo, Seung Min; Kim, Dong Min; Lee, Sang Yup

    2015-01-01

    The accurate detection of mismatched base pairs is critical to many DNA hybridization-based applications in basic research and diagnostics. We herein demonstrate that mismatched DNAs on a multispot array can be accurately detected in a multiplexed way by employing the S1 nuclease-based mismatched......-target duplex. This technique of performing S1 nuclease-mediated cleavage on a multispot array offers high specificity and high-throughput detection of mismatched DNAs. It is expected that this assay system will prove useful for single-assay genotyping and/or the diagnosis of various diseases and pathogens....

  3. Ground State and Elementary Excitations of the S=1 Kagome Heisenberg Antiferromagnet

    OpenAIRE

    Hida, Kazuo

    2000-01-01

    Low energy spectrum of the S=1 kagom\\'e Heisenberg antiferromagnet (KHAF) is studied by means of exact diagonalization and the cluster expansion. The magnitude of the energy gap of the magnetic excitation is consistent with the recent experimental observation for \\mpynn. In contrast to the $S=1/2$ KHAF, the non-magnetic excitations have finite energy gap comparable to the magnetic excitation. As a physical picture of the ground state, the hexagon singlet solid state is proposed and verified b...

  4. $C^1$-actions of Baumslag-Solitar groups on $S^1$

    CERN Document Server

    Guelman, Nancy

    2010-01-01

    Let $BS(1, n)=$ be the solvable Baumslag-Solitar group, where $ n\\geq 2$. It is known that B(1, n) is isomorphic to the group generated by the two affine maps of the line : $f_0(x) = x + 1$ and $h_0(x) = nx $. The action on $S^1 = \\RR \\cup {\\infty}$ generated by these two affine maps $f_0$ and $h_0 $ is called the standard affine one. We prove that any representation of BS(1,n) into $Diff^1(S^1)$ is (up to a finite index subgroup) semiconjugated to the standard affine action.

  5. Genetic evidence for involvement of neuronally expressed S1P₁ receptor in nociceptor sensitization and inflammatory pain.

    Directory of Open Access Journals (Sweden)

    Norbert Mair

    Full Text Available Sphingosine-1-phosphate (S1P is a key regulator of immune response. Immune cells, epithelia and blood cells generate high levels of S1P in inflamed tissue. However, it is not known if S1P acts on the endings of nociceptive neurons, thereby contributing to the generation of inflammatory pain. We found that the S1P₁ receptor for S1P is expressed in subpopulations of sensory neurons including nociceptors. Both S1P and agonists at the S1P₁ receptor induced hypersensitivity to noxious thermal stimulation in vitro and in vivo. S1P-induced hypersensitivity was strongly attenuated in mice lacking TRPV1 channels. S1P and inflammation-induced hypersensitivity was significantly reduced in mice with a conditional nociceptor-specific deletion of the S1P₁ receptor. Our data show that neuronally expressed S1P₁ receptors play a significant role in regulating nociceptor function and that S1P/S1P₁ signaling may be a key player in the onset of thermal hypersensitivity and hyperalgesia associated with inflammation.

  6. Odd Graceful Labeling of Graph Pr,(2s-1)%关于Pr,(2s-1)的奇优美标号

    Institute of Scientific and Technical Information of China (English)

    李武装; 严谦泰

    2011-01-01

    Let G = <V, E< be a simple graph. If there exist a mapping / : V(G) → {0,1,2, ? ? ? , 2 ∣E∣-l} satisfied 1) (A)u, v ∈= V, if u ≠ v,then /(u) ≠(v), 2) max{f(v) ∣v ∈ V } = 2 ∣E∣ - 1; 3) (A)e1, e2 ∈ E, if e1 ≠ e2, then g(e1) ≠g(e2), where S(e) = |f(u) + f(v)\\, e = uv; 4) {g{e) |e ∈ E} = {1, 3, 5, ? ? ? , 2 |E| - 1}, then G is called odd graceful graph, / is called oddgraceful labeling of G. Mr. Gnanajoethiproposed a conjecture that every tree is odd graceful. In this paper, we proved that graph Pr,(2s-1) are odd graceful graphs.%对于简单图G=(V,E),如果存在一个映射f∶V(G)→{0,1,2,…,2|E|-1}满足1)对任意的u,v∈V,若u≠v,则(u)≠f(v);2)max{f(v)|v∈V}=2 |E| -1;3)对任意的e1,e2∈E,若e1≠e2,则g(e1)≠g(e2),此处g(e)=|f(u)+f(v)|,e=vv;4){g(e)|e∈E}={1,3,5,…,2|E| -1},则称G是奇优美图,f称为G的奇优美标号.Gnanajoethi提出了一个猜想:每棵树都是奇优美的.证明了图Pr,(2s-1)是奇优美图.

  7. How Nothing Boosts Affinity: Hydrophobic Ligand Binding to the Virtually Vacated S1' Pocket of Thermolysin.

    Science.gov (United States)

    Krimmer, Stefan G; Cramer, Jonathan; Schiebel, Johannes; Heine, Andreas; Klebe, Gerhard

    2017-08-02

    We investigated the hydration state of the deep, well-accessible hydrophobic S1' specificity pocket of the metalloprotease thermolysin with purposefully designed ligands using high-resolution crystallography and isothermal titration calorimetry. The S1' pocket is known to recognize selectively a very stringent set of aliphatic side chains such as valine, leucine, and isoleucine of putative substrates. We engineered a weak-binding ligand covering the active site of the protease without addressing the S1' pocket, thus transforming it into an enclosed cavity. Its sustained accessibility could be proved by accommodating noble gas atoms into the pocket in the crystalline state. The topology and electron content of the enclosed pocket with a volume of 141 Å(3) were analyzed using an experimental MAD-phased electron density map that was calibrated to an absolute electron number scale, enabling access to the total electron content within the cavity. Our analysis indicates that the S1' pocket is virtually vacated, thus free of any water molecules. The thermodynamic signature of the reduction of the void within the pocket by growing aliphatic P1' substituents (H, Me, iPr, iBu) reveals a dramatic, enthalpy-dominated gain in free energy of binding resulting in a factor of 41 000 in Kd for the H-to-iBu transformation. Substituents placing polar decoy groups into the pocket to capture putatively present water molecules could not collect any evidence for a bound solvent molecule.

  8. Determination of the hyperfine coupling constant of the cesium 7S1/2 state

    Science.gov (United States)

    Yang, Guang; Wang, Jie; Yang, Baodong; Wang, Junmin

    2016-08-01

    We report the hyperfine splitting (HFS) measurement of the cesium (Cs) 7S1/2 state by optical-optical double-resonance spectroscopy with the Cs 6S1/2-6P3/2-7S1/2 (852 nm  +  1470 nm) ladder-type system. The HFS frequency calibration is performed by employing a phase-type waveguide electro-optic modulator together with a stable confocal Fabry-Perot cavity. From the measured HFS between the F″  =  3 and F″  =  4 manifolds of the Cs 7S1/2 state (HFS  =  2183.273  ±  0.062 MHz), we have determined the magnetic dipole hyperfine coupling constant (A  =  545.818  ±  0.016 MHz), which is in good agreement with the previous work but much more precise.

  9. Classification of (D4,S1)-equivariant bifurcation problems up to topological codimension 2

    Institute of Scientific and Technical Information of China (English)

    GAO; Shouping(高守平); LI; Yangcheng(李养成)

    2003-01-01

    The techniques from singularity theory are applied to the multiparameter bifurcation problem.The classification of (D4, S1)-equivariant bifurcation problems with topological codimension less than or equal to 2 is given. The corresponding recognition conditions are set up.

  10. Robustness of S1 statistic with Hodges-Lehmann for skewed distributions

    Science.gov (United States)

    Ahad, Nor Aishah; Yahaya, Sharipah Soaad Syed; Yin, Lee Ping

    2016-10-01

    Analysis of variance (ANOVA) is a common use parametric method to test the differences in means for more than two groups when the populations are normally distributed. ANOVA is highly inefficient under the influence of non- normal and heteroscedastic settings. When the assumptions are violated, researchers are looking for alternative such as Kruskal-Wallis under nonparametric or robust method. This study focused on flexible method, S1 statistic for comparing groups using median as the location estimator. S1 statistic was modified by substituting the median with Hodges-Lehmann and the default scale estimator with the variance of Hodges-Lehmann and MADn to produce two different test statistics for comparing groups. Bootstrap method was used for testing the hypotheses since the sampling distributions of these modified S1 statistics are unknown. The performance of the proposed statistic in terms of Type I error was measured and compared against the original S1 statistic, ANOVA and Kruskal-Wallis. The propose procedures show improvement compared to the original statistic especially under extremely skewed distribution.

  11. Final State Interactions and Delta S=-1, Delta C=\\pm 1 B--decays

    CERN Document Server

    Fayyazuddin, A

    2002-01-01

    The final state interactions (FSI) in Delta S=-1, Delta C=\\pm 1, decays of B-meson are discussed. The rescattering corrections are found to be of order of 15-20%. The strong interaction phase shifts are estimated and their effects on CP-asymmetry are discussed.

  12. Crystallization and preliminary crystallographic study of the yeast Malassezia sympodialis allergen Mala s 1

    Energy Technology Data Exchange (ETDEWEB)

    Vilhelmsson, Monica, E-mail: monica.vilhelmsson@medks.ki.se [Department of Medicine, Clinical Allergy Research Unit, Karolinska Institutet and Karolinska University Hospital, Stockholm (Sweden); Center for Infectious Medicine, Department of Medicine, Karolinska University Hospital, Huddinge, Stockholm (Sweden); Hallberg, B. Martin [Department of Biochemistry and Biophysics, Stockholm University, Stockholm (Sweden); Rasool, Omid; Zargari, Arezou; Scheynius, Annika [Department of Medicine, Clinical Allergy Research Unit, Karolinska Institutet and Karolinska University Hospital, Stockholm (Sweden); Achour, Adnane [Center for Infectious Medicine, Department of Medicine, Karolinska University Hospital, Huddinge, Stockholm (Sweden); Department of Medicine, Clinical Allergy Research Unit, Karolinska Institutet and Karolinska University Hospital, Stockholm (Sweden)

    2006-02-01

    Crystals of the M. sympodialis allergen Mala s 1 have been obtained using the hanging-drop vapour-diffusion method. A diffraction data set has been collected from native crystals to 1.35 Å resolution. The opportunistic yeast Malassezia sympodialis can act as an allergen and elicit specific IgE- and T-cell reactivity in patients with atopic eczema. The first identified major allergen from M. sympodialis, Mala s 1, is present on the cell surface of the yeast. Recombinant Mala s 1 was expressed in Escherichia coli, purified and refolded in a soluble form. Crystals of Mala s 1 were obtained in 25% PEG 8K, 0.2 M (NH{sub 4}){sub 2}SO{sub 4}. Crystals belong to space group P2{sub 1}2{sub 1}2, with unit-cell parameters a = 44.4, b = 163.7, c = 50.6 Å, and diffract to 1.35 Å resolution.

  13. Ultrafast excited state dynamics of S2 and S1 states of triphenylmethane dyes.

    Science.gov (United States)

    Singhal, Pallavi; Ghosh, Hirendra N

    2014-08-21

    Excited state dynamics of S2 and S1 states for a series of TPM dyes, pyrogallol red (PGR), bromopyrogallol red (Br-PGR) and aurin tricarboxylic acid (ATC), have been monitored by using ultrafast transient absorption and fluorescence up-conversion techniques. Optical absorption studies indicate that all the TPM dyes exist as keto-enol tautomers depending upon the pH of the solution. Interestingly, all the TPM dyes give S2 emission (major emitting state) in addition to weak S1 emission. S2 emission lifetimes as fast as ∼150-300 fs and S1 emission lifetimes of 2-5 ns were observed depending upon the molecular structure of the dyes. Femtosecond transient absorption studies suggest the presence of an ultrafast non-radiative decay channel from the S2 state in addition to S2 luminescence. The vibrational relaxation time from hot S1 state is found to be 2-6 ps. The heavy atom effect has been observed in ultrafast relaxation dynamics of Br-PGR.

  14. Neutron-scattering cross section of the S=1/2 Heisenberg triangular antiferromagnet

    DEFF Research Database (Denmark)

    Lefmann, K.; Hedegård, P.

    1994-01-01

    In this paper we use a Schwinger-boson mean-field approach to calculate the neutron-scattering cross section from the S = 1/2 antiferromagnet with nearest-neighbor isotropic Heisenberg interaction on a two-dimensional triangular lattice. We investigate two solutions for T = 0: (i) a state with long...

  15. Study of S1 detector' time resolution at NA61/SHINE experiment

    CERN Document Server

    Balkova, Yuliia

    2017-01-01

    This document presents the final report on my project at CERN Summer Student Programme. The aim of the work was to determine time resolution of S1 (scintillation) detector at NA61/SHINE experiment's beamline and how it depends on readout voltage, beam size and beam position.

  16. High-Dispersion Spectroscopic Observations of Comet C/2012 S1 (ISON) with the Subaru Telescope

    Science.gov (United States)

    Shinnaka, Yoshiharu; Kawakita, Hideyo; Nagashima, Masayoshi; Hitomi, Kobayashi; Decock, Alice; Jehin, Emmanuel; Boice, Daniel C.

    2014-11-01

    Comet C/2012 S1 (ISON) was one of the Oort cloud comets and dynamically new. This comet was broken at its perihelion passage on UT 2013 November 28.1 (at Rh ~ 17 solar radius). We observed the comet C/2012 S1 (ISON) on UT 2013 November 15 with the High Dispersion Spectrograph (HDS) mounted on the Subaru Telescope atop Mauna Kea, Hawaii. Its heliocentric and geocentric distances were 0.601 and 0.898 AU, respectively. We selected the slit size of 0”.5 x 9”.0 on the sky to achieve the spectral resolution of R = 72,000 from 550 to 830 nm. The total exposure time of comet C/2012 S1 (ISON) was 1200 seconds. We detected many emission lines caused from radicals (e.g., CN, C2, NH2), ions (H2O+), atoms ([OI] and Na I) and also many unidentified lines in the spectra. We report the (1) the ortho-to-para abundance ratios (OPRs) of water and ammonia estimated from the high-dispersion spectra of H2O+ and NH2, (2) the green-to-red line ratio of forbidden oxygen emissions, (3) the isotopic ratios of C2 (the carbon isotopic ratio from Swan band) and CN (the carbon and nitrogen isotopic ratios from red band), (4) the sodium-to-continuum ratio of comet C/2012 S1 (ISON).

  17. Universality of the Ising and the S=1 model on Archimedean lattices: A Monte Carlo determination

    Science.gov (United States)

    Malakis, A.; Gulpinar, G.; Karaaslan, Y.; Papakonstantinou, T.; Aslan, G.

    2012-03-01

    The Ising models S=1/2 and S=1 are studied by efficient Monte Carlo schemes on the (3,4,6,4) and the (3,3,3,3,6) Archimedean lattices. The algorithms used, a hybrid Metropolis-Wolff algorithm and a parallel tempering protocol, are briefly described and compared with the simple Metropolis algorithm. Accurate Monte Carlo data are produced at the exact critical temperatures of the Ising model for these lattices. Their finite-size analysis provide, with high accuracy, all critical exponents which, as expected, are the same with the well-known 2D Ising model exact values. A detailed finite-size scaling analysis of our Monte Carlo data for the S=1 model on the same lattices provides very clear evidence that this model obeys, also very well, the 2D Ising model critical exponents. As a result, we find that recent Monte Carlo simulations and attempts to define effective dimensionality for the S=1 model on these lattices are misleading. Accurate estimates are obtained for the critical amplitudes of the logarithmic expansions of the specific heat for both models on the two Archimedean lattices.

  18. Compositional Dependence of Structural Properties of Prepared PbS1− Alloys and Films

    Directory of Open Access Journals (Sweden)

    M. F. A. Alias

    2011-01-01

    Full Text Available Results of a study of PbS1− alloys and films with various Pb content have been reported and discussed. Films of PbS1− of thickness 1.5 μm have been deposited on glass substrates by flash thermal evaporation method at room temperature, under vacuum at constant deposition rate. These films were annealed under vacuum around 10−6 Torr at different temperatures up to 523 K. The composition of the elements in PbS1− alloys was determined by standard surfaces techniques such as atomic absorption spectroscopy (AAS and X-ray fluorescence (XRF, and the results were found of high accuracy and in very good agreement with the theoretical values. The structure for alloys and films is determined by using X-ray diffraction. This measurement reveals that the structure is polycrystalline with cubic structure and there are strong peaks at the direction (200 and (111. The effect of heat treatment on the crystalline orientation, relative intensity, and grain size of PbS1− films is presented.

  19. Simultaneous production of hydrogen and ethanol from waste glycerol by Enterobacter aerogenes KKU-S1

    DEFF Research Database (Denmark)

    Reungsang, Alissara; Sittijunda, Sureewan; Angelidaki, Irini

    2013-01-01

    Factors affecting simultaneous hydrogen and ethanol production from waste glycerol by a newly isolated bacterium Enterobacter aerogenes KKU-S1 were investigated employing response surface methodology (RSM) with central composite design (CCD). The Plackett-Burman design was first used to screen th...

  20. On the (S-1, S) Lost Sales Inventory Model with Priority Demand Classes

    NARCIS (Netherlands)

    R. Dekker (Rommert); R.M. Hill; M.J. Kleijn (Marcel)

    1997-01-01

    textabstractIn this paper an inventory model with several demand classes, prioritised according to importance, is analysed. We consider a lot-for-lot or (S-1,S) inventory model with lost sales. For each demand class there is a critical stock level at and below which demand from that class is not

  1. Bioremediation of wastewater from edible oil refinery factory using oleaginous microalga Desmodesmus sp. S1.

    Science.gov (United States)

    Mar, Cho Cho; Fan, Yong; Li, Fu-Li; Hu, Guang-Rong

    2016-12-01

    Edible oil industry produced massive wastewater, which requires extensive treatment to remove pungent smell, high phosphate, carbon oxygen demand (COD), and metal ions prior to discharge. Traditional anaerobic and aerobic digestion could mainly reduce COD of the wastewater from oil refinery factories (WEORF). In this study, a robust oleaginous microalga Desmodesmus sp. S1 was adapted to grow in WEORF. The biomass and lipid content of Desmodesmus sp. S1 cultivated in the WEORF supplemented with sodium nitrate were 5.62 g·L(-1) and 14.49%, whereas those in the WEORF without adding nitrate were 2.98 g·L(-1) and 21.95%. More than 82% of the COD and 53% of total phosphorous were removed by Desmodesmus sp. S1. In addition, metal ions, including ferric, aluminum, manganese and zinc were also diminished significantly in the WEORF after microalgal growth, and pungent smell vanished as well. In comparison with the cells grown in BG-11 medium, the cilia-like bulges and wrinkles on the cell surface of Desmodesmus sp. S1 grown in WEORF became out of order, and more polyunsaturated fatty acids were detected due to stress derived from the wastewater. The study suggests that growing microalgae in WEORF can be applied for the dual roles of nutrient removal and biofuel feedstock production.

  2. New Universality Class in the S=1/2 Fibonacci Heisenberg Chains

    OpenAIRE

    Hida, Kazuo

    2004-01-01

    Low energy properties of the S=1/2 antiferromagnetic Heisenberg chains with Fibonacci exchange modulation are studied using the real space renormalization group method for strong exchange modulation. It is found that the ground state of this model belongs to a new universality class with logarithmically divergent dynamical exponent which is neither like Fibonacci XY chains nor like XY chains with relevant aperiodicity.

  3. Radii in the $sd$ shell and the $s_{1/2}$ "halo" orbit: A game changer

    CERN Document Server

    Bonnard, J

    2016-01-01

    Proton radii of nuclei in the $sd$ shell depart appreciably from the asymptotic law, $\\rho_{\\pi}=\\rho_0A^{1/3}$. The departure exhibits systematic trends fairly well described by a single phenomenological term in the Duflo-Zuker formulation, which also happens to explain the sudden increase in slope in the isotope shifts of several chains at neutron number $N=28$. It was recently shown that this term is associated with the abnormally large size of the $s_{1/2}$ and $p$ orbits in the $sd$ and $pf$ shells respectively. Further to explore the problem, we propose to calculate microscopically radii in the former. Since the (square) radius is basically a one body operator, its evolution is dictated by single particle occupancies determined by shell model calculations. Assuming that the departure from the asymptotic form is entirely due to the $s_{1/2}$ orbit, the expectation value $\\langle s_{1/2}|r^2|s_{1/2}\\rangle$ is determined by demanding that its evolution be such as to describe well nuclear radii. It does, f...

  4. On the (S-1,S) model for renewal demand processes: Poisson's poison

    NARCIS (Netherlands)

    M.A.J. Smith; R. Dekker (Rommert)

    1997-01-01

    textabstractIn the standard (S - 1,S) stock model, demand follows a Poisson process. It has appeared to many stock analysts that this model causes an abundance of stock in reality. In case demand is caused by failure or is derived from another process, demand typically does not follow a Poisson proc

  5. Fiber polymorphism in skeletal muscles of the American lobster, Homarus americanus: continuum between slow-twitch (S1) and slow-tonic (S2) fibers.

    Science.gov (United States)

    Medler, Scott; Lilley, Travis; Mykles, Donald L

    2004-07-01

    In recent years, an increasing number of studies has reported the existence of single fibers expressing more than one myosin heavy chain (MHC) isoform at the level of fiber proteins and/or mRNA. These mixed phenotype fibers, often termed hybrid fibers, are currently being recognized as the predominant fiber type in many muscles, and the implications of these findings are currently a topic of great interest. In a recent study, we reported single fibers from the cutter claw closer muscle of lobsters that demonstrated a gradation between the slow-twitch (S1) and slow-tonic (S2) muscle phenotype. In the present study, we focused on S1 and S2 fibers from the superficial abdominal muscles of the lobster as a model to study the continuum among muscle fiber types. Complementary DNAs (cDNA) encoding an S2 isoform of myosin heavy chain (MHC) and an S2 isoform of tropomyosin (Tm) were isolated from the superficial abdominal flexor muscles of adult lobsters. These identified sequences were used to design PCR primers used in conjunction with RT-PCR and real-time PCR to measure expression levels of these genes in small muscle samples and single fibers. The relative expression of the corresponding S1 MHC and S1 Tm isoforms was measured in the same samples with PCR primers designed according to previously identified sequences. In addition, we measured the relative proportions of MHC, troponin (Tn) T and I protein isoforms present in the same samples to examine the correlation of these proteins with one another and with the MHC and Tm mRNAs. These analyses revealed significant correlations among the different myofibrillar proteins, with the S1 and S2 fibers being characterized by a whole assemblage of myofibrillar isoforms. However, they also showed that small muscle samples, and more importantly single fibers, existed as a continuum from one phenotype to another. Most fibers possessed mixtures of mRNA for MHC isoforms that were unexpected based on protein analysis. These findings

  6. Effect of Self-Regulated Learning and Motivation to Achieve against Teacher Professional Capability for Student S1 PGSD of Science Field Compared with Regular Student S1 PGSD at UPBJJ Serang

    Science.gov (United States)

    Prayekti

    2015-01-01

    This study is to know effect of self-regulated learning and motivation to achieve against teacher professional capability for student S1 PGSD of science field compared with regular student S1 PGSD. The student uses grades of Classroom Action Research (CAR) and Stabilization of Professional Capability (SPC) on curriculum of S1 PGSD to see…

  7. Pan-STARRS 1 observations of the unusual active Centaur P/2011 S1(Gibbs)

    Energy Technology Data Exchange (ETDEWEB)

    Lin, H. W.; Ip, W. H.; Chen, W. P. [Institute of Astronomy, National Central University, Taoyuan 32001, Taiwan (China); Chen, Y. T. [Institute of Astronomy and Astrophysics, Academia Sinica, P.O. Box 23-141, Taipei 106, Taiwan (China); Lacerda, P. [Astrophysics Research Centre, School of Mathematics and Physics, Queens University Belfast, Belfast BT7 1NN (United Kingdom); Holman, M.; Protopapas, P. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Burgett, W. S.; Chambers, K. C.; Flewelling, H.; Huber, M. E.; Jedicke, R.; Kaiser, N.; Magnier, E. A.; Metcalfe, N. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Price, P. A., E-mail: edlin@gm.astro.ncu.edu.tw [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States)

    2014-05-01

    P/2011 S1 (Gibbs) is an outer solar system comet or active Centaur with a similar orbit to that of the famous 29P/Schwassmann-Wachmann 1. P/2011 S1 (Gibbs) has been observed by the Pan-STARRS 1 (PS1) sky survey from 2010 to 2012. The resulting data allow us to perform multi-color studies of the nucleus and coma of the comet. Analysis of PS1 images reveals that P/2011 S1 (Gibbs) has a small nucleus <4 km radius, with colors g {sub P1} – r {sub P1} = 0.5 ± 0.02, r {sub P1} – i {sub P1} = 0.12 ± 0.02, and i {sub P1} – z {sub P1} = 0.46 ± 0.03. The comet remained active from 2010 to 2012, with a model-dependent mass-loss rate of ∼100 kg s{sup –1}. The mass-loss rate per unit surface area of P/2011 S1 (Gibbs) is as high as that of 29P/Schwassmann-Wachmann 1, making it one of the most active Centaurs. The mass-loss rate also varies with time from ∼40 kg s{sup –1} to 150 kg s{sup –1}. Due to its rather circular orbit, we propose that P/2011 S1 (Gibbs) has 29P/Schwassmann-Wachmann 1-like outbursts that control the outgassing rate. The results indicate that it may have a similar surface composition to that of 29P/Schwassmann-Wachmann 1. Our numerical simulations show that the future orbital evolution of P/2011 S1 (Gibbs) is more similar to that of the main population of Centaurs than to that of 29P/Schwassmann-Wachmann 1. The results also demonstrate that P/2011 S1 (Gibbs) is dynamically unstable and can only remain near its current orbit for roughly a thousand years.

  8. Characterization of the casein gene complex in West African goats and description of a new alpha(s1)-casein polymorphism.

    Science.gov (United States)

    Caroli, A; Chiatti, F; Chessa, S; Rignanese, D; Ibeagha-Awemu, E M; Erhardt, G

    2007-06-01

    The analysis of casein polymorphisms was carried out in West Africa goat populations: Red Sokoto (n = 57), West African Dwarf Nigeria (n = 27), West African Dwarf Cameroon (n = 39), and Borno (n = 37). The 4 casein genes alpha(s1) (CSN1S1), beta (CSN2), alpha(s2) (CSN1S2), and kappa (CSN3) were typed at the DNA level. No null alleles were found in any of the genes analyzed. A PCR single-strand conformation polymorphism method was implemented for the identification of CSN1S1*F allele simultaneously with A/0(1), B/E, N and the new allele. The allele differed from CSN1S1*B by a synonymous transversion TCG-->TCT in the codon corresponding to Ser(66) of the mature protein. The new allele, named CSN1S1*B', occurred at a high frequency in all the populations, ranging from 0.295 (West African Dwarf Cameroon) to 0.405 (Borno). A greater frequency was found for alleles associated with high alpha(s1)-casein quantity, as has already been observed in the goat populations from the Mediterranean area. The intermediate E allele occurred only in the Red Sokoto and at a low frequency. The faint F allele occurred in 3 populations at frequencies lower than 0.03. Linkage disequilibrium occurred in all the populations, with highly significant differences in Borno, Red Sokoto, and West Africa Dwarf Nigeria, and significant differences in West Africa Dwarf Cameroon. Only 10 haplotypes showed frequencies > or =0.05 in at least 1 of the 4 populations considered, and the overall frequency was >0.1 only for 4 haplotypes: BAAB, B'ACA, ACAB, and BACA (in the order CSN1S1-CSN2-CSN1S2-CSN3). Haplotype BAAB, postulated as an ancestral haplotype in previous studies, was the most common haplotype in all breeds except Borno, where B'ACA was predominant. The results obtained are of considerable significance given that very little information exists on the subject for African goats. The high frequency of strong alleles in the calcium-sensitive caseins as well as the high linkage disequilibrium found

  9. Molecular Characterization and Expression Analysis of S1 self-incompatibility Locus-linked Pollen 3.15 Gene in Citrus reticulata

    Institute of Scientific and Technical Information of China (English)

    Hong Xia Miao; Zi Xing ye; Yong Hua Qin; Gui Bing Hu

    2013-01-01

    Gametophytic self-incompatibility (GSI) is controlled by a highly polymorphic locus called the S-locus,which is an important factor that can result in seedless fruit in Citrus.The S,self-incompatibility locuslinked pollen 3.15 gene (S,-3.15) belongs to a type of S locus gene.The role of S,-3.15 in the Sl reaction of Citrus has not yet been reported.In this study,full-length sequences of cDNA and DNA encoding the S,-3.15gene,referred to as CrS1-3.15,were isolated from ‘Wuzishatangju’ (Self-incompatibility,Sl) and ‘Shatangju’(Self-compatibility,SC).The predicted amino acid sequences of CrS1-3.15 between ‘Wuzishatangju’ and ‘Shatangju’ differ by only three amino acids.Compared to ‘Wuzishatangju’,three bases were substituted in the genomic DNA of CrS1-3.15 from ‘Shatangju’.Southern blot results showed that one copy of CrS1-3.15 existed in the genomic DNA of both ‘Wuzishatangju’ and ‘Shatangju’.The expression level of the CrS1-3.15 gene in the ovaries of ‘Shatangju’ was approximately 60-fold higher than that in the ovaries of ‘Wuzishatangju’.When ‘Wuzishatangju’ was cross-pollinated,the expression of CrS1-3.15 was upregulated in the ovaries at 3 d,and the highest expression levels were detected in the ovaries at 6 d after cross-pollination of ‘Wuzishatangju’ x ‘Shatangju’.To obtain the CrS,-3.15 protein,the full-length cDNA of CrS1-3.15 genes from ‘Wuzishatangju’ and ‘Shatangju’ was successfully expressed in Pichia pastoris.Pollen germination frequency of ‘Wuzishatangju’ was inhibited significantly with increasing CrS,-3.15 protein concentrations from Sl ‘Wuzishatangju’.

  10. Comparison of sequences of hypervariable region (HVR subunit S-1 gene of field isolate I-37 infectious bronchitis virus with Connecticut serotype

    Directory of Open Access Journals (Sweden)

    N.L.P Indi Dharmayanti

    2003-06-01

    Full Text Available Infectious Bronchitis is a contagious and acute respiratory disease in chickens caused by infectious bronchitis virus (IBV.Antigenic differences in IBV are associated with changes in the sequence of the spike glycoprotein (S. The subunit S1 which demonstrates more sequence variability than S-2 have been identified as hypervariable region (HVR-1 and 2. There were several IB virus field isolates included I-37 have been identified in Indonesia by serum neutralization method. However, gene sequence variation in HVR subunit S-1 had not yet been identified. Isolate I-37 was close to the serotype Connecticut 46 (Conn 46. The aim of this study is to identify sequence variation of HVR subunit S-1 gene of isolate I-37 produced by Reverse Transcriptase-Polymerase Chain Reaction (RT-PCR and sequencing. Several procedures were carried out in the study including virus titration, propagation and was concentrated from the allantoic fluid infected with IBV. Then, RNA was extracted for RTPCR. urther the product was sequnced and its homology with IBV references from GenBank was compared by GenMac version 8.0. Result showed that isolate I-37 produced 515 bp of amplification product. Isolate I-37 and Conn 46 are same serotype, yet their HVR subunit S-1 nucleotides and amino acids (protein differ by 6.9% and 15.6% respectively. It might be concluded that isolate I-37 was variant of Conn 46.

  11. Discovery of 3-arylpropionic acids as potent agonists of sphingosine-1-phosphate receptor-1 (S1P1) with high selectivity against all other known S1P receptor subtypes.

    Science.gov (United States)

    Yan, Lin; Huo, Pei; Doherty, George; Toth, Lesile; Hale, Jeffrey J; Mills, Sander G; Hajdu, Richard; Keohane, Carol A; Rosenbach, Mark J; Milligan, James A; Shei, Gan-Ju; Chrebet, Gary; Bergstrom, James; Card, Deborah; Quackenbush, Elizabeth; Wickham, Alexandra; Mandala, Suzanne M

    2006-07-15

    A series of 3-arylpropionic acids were synthesized as S1P1 receptor agonists. Structure-activity relationship studies on the pendant phenyl ring revealed several structural features offering selectivity of S1P1 binding against S1P2-5. These highly selective S1P1 agonists induced peripheral blood lymphocyte lowering in mice and one of them was found to be efficacious in a rat skin transplantation model, supporting that S1P1 agonism is primarily responsible for the immunosuppressive efficacy observed in preclinical animal models.

  12. Bioactivity and structural properties of chimeric analogs of the starfish SALMFamide neuropeptides S1 and S2.

    Science.gov (United States)

    Jones, Christopher E; Otara, Claire B; Younan, Nadine D; Viles, John H; Elphick, Maurice R

    2014-10-01

    The starfish SALMFamide neuropeptides S1 (GFNSALMFamide) and S2 (SGPYSFNSGLTFamide) are the prototypical members of a family of neuropeptides that act as muscle relaxants in echinoderms. Comparison of the bioactivity of S1 and S2 as muscle relaxants has revealed that S2 is ten times more potent than S1. Here we investigated a structural basis for this difference in potency by comparing the bioactivity and solution conformations (using NMR and CD spectroscopy) of S1 and S2 with three chimeric analogs of these peptides. A peptide comprising S1 with the addition of S2's N-terminal tetrapeptide (Long S1 or LS1; SGPYGFNSALMFamide) was not significantly different to S1 in its bioactivity and did not exhibit concentration-dependent structuring seen with S2. An analog of S1 with its penultimate residue substituted from S2 (S1(T); GFNSALTFamide) exhibited S1-like bioactivity and structure. However, an analog of S2 with its penultimate residue substituted from S1 (S2(M); SGPYSFNSGLMFamide) exhibited loss of S2-type bioactivity and structural properties. Collectively, our data indicate that the C-terminal regions of S1 and S2 are the key determinants of their differing bioactivity. However, the N-terminal region of S2 may influence its bioactivity by conferring structural stability in solution. Thus, analysis of chimeric SALMFamides has revealed how neuropeptide bioactivity is determined by a complex interplay of sequence and conformation.

  13. 降解菌DNEH-S1的室内模拟试验%Indoor Simulation Examination of Degradation Bacteria DNEH - S1

    Institute of Scientific and Technical Information of China (English)

    张奇

    2016-01-01

    农业生产中广泛使用的农药、地膜、化肥等农用化学品,造成多种有机物对土壤的复合污染。当有害物质过多,超过土壤的自净能力,就会引起土壤的组成、结构和功能发生变化,微生物活动受到抑制,有害物质或其分解产物在土壤中逐渐积累,并间接危害人体健康。邻苯二甲酸酯(PAEs)是一类环境内分泌物质,作为农用塑料地膜中的增塑剂被大量使用,易从塑料地膜中释放而造成土壤污染。我国农田土壤普遍存在农药、PAEs等有机物复合污染,生物降解是削减土壤中有机污染物的重要途径。试验研究了降解菌DNEH-S1在土壤中对DEHP降解特性及土壤中养分的动态变化,探讨了典型有机物复合污染土壤生物降解技术的可行性。%Phthalic acid esters (PAEs) is a kind of environmental endocrine substances that is widely used as the plas-ticizer in the farming-use plastic iflm, easy to release from the plastic iflm and cause soil polution. Farmland soils commonly show pesticides, PAEs and other organic compound polution in China and biodegradation is an important approach to cut down organic polutants in soil. This experiment studies the degradation bacteria DNEH - S1 in the soil of DEHP degradation charac-teristics and the dynamic changes of the nutrients in the soil, discussing the bio-degradation technology feasibility of typical organic compound contaminated soil.

  14. Cloning and comparative analysis of gene structure in promoter site of alpha-s1 casein gene in Naeinian goat and sheep

    Directory of Open Access Journals (Sweden)

    Mojtaba Najafi

    2014-12-01

    Full Text Available The 5′ end or alpha-S1 casein promoter has a significant role in milk protein gene expression. The understanding of the translation process of alpha-S1 casein mutants will provide us an opportunity to make the best selection in livestock providing more proteins in milk. Blood samples were taken from three hundred of Naeinian goats and sheep, and DNA extraction was done using modified salting out method. Polymerase chain reactions (PCR were carried out using a specific primer pairs for amplification a fragment of 1133 bp from part of 5′-UTR and exon 1 of alpha s1 casein gene. The AluI and HinfI restriction enzyme treatment of all samples provided the same homozygous AA genotype in both species. Subsequently, one sample of each species was selected and cloned, and the final sequences were analyzed by BioEdit, CLC genomic, Mega4 and DNASIS MAX software. Several polymorphisms are recognized between Naeinian goat and sheep that are presented on motif sites. In this research, the interested location, including exon I and a part of 5′, was analyzed, and genetic element comparisons were done between Naeinian goat and sheep. The number and location of probable binding sites can have a crucial role as a result of antagonistic and synergistic effects on gene regulation activities.

  15. Purification, characterization and N-terminal amino acid sequence of a new major allergen from European chestnut pollen--Cas s 1.

    Science.gov (United States)

    Kos, T; Hoffmann-Sommergruber, K; Ferreira, F; Hirschwehr, R; Ahorn, H; Horak, F; Jager, S; Sperr, W; Kraft, D; Scheiner, O

    1993-11-15

    Pollens from trees of the order Fagales (e.g. birch, alder, hazel, and hornbeam) all contain one major allergen--the main cause for tree pollen allergy. So far the major allergens from birch (Bet v 1), alder (Aln g 1), hazel (Cor a 1), and hornbeam (Car b 1) have been characterized, showing high sequence similarity with each other (1-4). We present the molecular and immunologic characterization of Cas s 1, the major allergen from the European chestnut (Castanea sativa). From aqueous pollen extracts from European chestnut a protein was purified to homogeneity and was subjected to further investigation. The protein revealed a Mr of 22 kDa and was shown to represent the major allergen of the European chestnut (immunoblotting, histamine release) and designated Cas s 1. Despite a marked difference in Mr, Cas s 1 shows significant amino acid sequence similarity at the N-terminus and is antigenically closely related to the major birch pollen allergen Bet v 1 (17 kDa), as shown by binding to the anti-Bet v 1 monoclonal antibody BIP-1 and by IgE-inhibition tests using recombinant Bet v 1.

  16. On the determination of low-energy constants for $\\Delta S=1$ transitions

    CERN Document Server

    Giusti, Leonardo; Laine, Mikko; Peña, C; Wennekers, J; Wittig, H

    2005-01-01

    We present our preliminary results for three-point correlation functions involving the operators entering the $\\Delta{S}=1$ effective Hamiltonian with an active charm quark, obtained using overlap fermions in the quenched approximation. This is the first computation carried out for valence quark masses small enough so as to permit a matching to Quenched Chiral Perturbation Theory in the $\\epsilon$-regime. The commonly observed large statistical fluctuations are tamed by means of low-mode averaging techniques, combined with restrictions to individual topological sectors. We also discuss the matching of the resulting hadronic matrix elements to the effective low-energy constants for $\\Delta{S}=1$ transitions. This involves (a) finite-volume corrections which can be evaluated at NLO in Quenched Chiral Perturbation Theory, and (b) the short-distance renormalization of the relevant four-quark operators in discretizations based on the overlap operator. We discuss perturbative estimates for the renormalization facto...

  17. [Treatment of S-1 plus weekly CDDP for advanced gastric cancer].

    Science.gov (United States)

    Kemmochi, Takeshi; Egawa, Tomohisa; Mihara, Yasunori; Irino, Tomoyuki; Ito, Yasuhiro; Nagashima, Atsushi; Makino, Hiroyuki; Yamamuro, Wataru

    2011-11-01

    We analyzed the clinical efficacy and safety of chemotherapy using S-1 plus weekly CDDP( w-CS therapy) for unresectable gastric cancer. Twenty one patients were treated with this treatment. S-1 80 mg/m²/day was administered for 2 weeks followed by a 1-week rest. CDDP 20 mg/m² was injected intravenously on day 1 and 8. The overall response rate was 52. 3%. The disease control rate was 85.7%. Grade 3 or 4 major toxicity comprised neutropenia (14.2%), thrombocytopenia (4.7%) and plasma creatinine elevation (4.7%). w-CS therapy is satisfied resulting with efficacy and safety. Thus, future clinical trials and accumulation of futher cases are warranted.

  18. Direct lateral interbody fusion (DLIF) at the lumbosacral junction L5-S1.

    Science.gov (United States)

    Shirzadi, Ali; Birch, Kurtis; Drazin, Doniel; Liu, John C; Acosta, Frank

    2012-07-01

    The direct lateral interbody fusion (DLIF), a minimally invasive lateral approach for placement of an interbody fusion device, does not require nerve root retraction or any contact with the great vessels and can lead to short operative times with little blood loss. Due to anatomical restrictions, this procedure has not been used at the lumbosacral (L5-S1) junction. Lumbosacral transitional vertebrae (LSTV), a structural anomaly of the lumbosacral spine associated with low back pain, can result in a level being wrongly identified pre-operatively due to misnumbering of the vertebral levels. To our knowledge, use of the DLIF graft in this patient is the first report of an interbody fusion graft being placed at the disc space between the LSTV and S1 via the transpsoas route. We present a review of the literature regarding the LSTV variation as well as the lateral placement of interbody fusion grafts at the lumbosacral junction.

  19. Observation of an Exotic $S=+1$ Baryon in Exclusive Photoproduction from the Deuteron

    CERN Document Server

    Stepanyan, S; Carman, D S; Pasyuk, E A; Schumacher, R A; Smith, E S; Tedeschi, D J; Todor, L; Adams, G; Ambrozewicz, P; Anciant, E; Anghinolfi, M; Asavapibhop, B; Audit, G; Avakian, H; Bagdasaryan, H; Ball, J P; Barrow, S P; Battaglieri, M; Beard, K; Bektasoglu, M; Bellis, M; Berman, Barry L; Bianchi, N; Biselli, A S; Boiarinov, S; Bouchigny, S; Bradford, R; Branford, D; Briscoe, W J; Brooks, W K; Burkert, V D; Butuceanu, C; Calarco, J R; Carnahan, B; Chen, S; Ciciani, L; Cole, P L; Coleman, A; Cords, D; Corvisiero, P; Crabb, D; Crannell, H; Cummings, J P; De Sanctis, E; Degtyarenko, P V; Denizli, H; Dennis, L; De Vita, R; Dharmawardane, K V; Dhuga, K S; Djalali, C; Dodge, G E; Doughty, D C; Dragovitsch, P; Dugger, M; Dytman, S; Dzyubak, O P; Egiyan, H; Egiyan, K S; Elouadrhiri, L; Empl, A; Eugenio, P; Fatemi, R; Feuerbach, R J; Ficenec, J; Forest, T A; Funsten, H; Garçon, M; Gavalian, G; Gilfoyle, G P; Giovanetti, K L; Gordon, C I O; Gothe, R W; Griffioen, K; Guidal, M; Guillo, M R; Guo, L; Gyurjyan, V; Hadjidakis, C; Hakobyan, R S; Hardie, J; Heddle, D; Heimberg, P; Hersman, F W; Hicks, R S; Holtrop, M; Hu, J; Hyde-Wright, C E; Ito, M M; Jenkins, D; Joo, K; Jüngst, H G; Kellie, J D; Khandaker, M; Kim, K Y; Kim, K; Kim, W; Klein, A; Klein, F J; Klimenko, A V; Klusman, M; Kossov, M; Kramer, L H; Kuang, Y; Kubarovski, V; Kuhn, S E; Kühn, J; Lachniet, J; Lawrence, D; Li, J; Lima, A; Livingston, K; Lukashin, K; Manak, J J; McAleer, S; McNabb, J W C; Mecking, B A; Mehrabyan, S S; Melone, J J; Mestayer, M D; Meyer, C A; Mikhailov, K; Minehart, R C; Mirazita, M; Miskimen, R; Mokeev, V; Morand, L; Morrow, S; Muccifora, V; Müller, J; Murphy, L Y; Mutchler, G S; Napolitano, J; Nasseripour, R; Niccolai, S; Niculescu, G; Niculescu, I; Niczyporuk, B B; Niyazov, R A; Nozar, M; O'Brien, J; O'Rielly, G V; Opper, A K; Osipenko, M; Park, K; Peterson, G; Philips, S A; Pivnyuk, N; Pocanic, D; Pogorelko, O I; Polli, E; Pozdniakov, S; Preedom, B M; Price, J W; Prok, Y; Protopopescu, D; Qin, L M; Raue, B A; Riccardi, G; Ricco, G; Ripani, M; Ritchie, B G; Ronchetti, F; Rossi, P; Rowntree, D; Rubin, P; Sabatie, F; Salgado, C; Santoro, J; Sapunenko, V; Serov, V S; Sharabyan, Yu G; Shaw, J; Simionatto, S; Skabelin, A V; Smith, L C; Sober, D I; Strakovsky, I I; Stavinsky, A V; Stoler, P; Suleiman, R; Taiuti, M; Taylor, S; Thoma, U; Thompson, R; Tur, C; Ungaro, M; Vineyard, M F; Vlassov, A V; Wang, K; Weinstein, L B; Weller, H; Weygand, D P; Whisnant, C S; Wolin, E; Wood, M H; Yegneswaran, A; Yun, J

    2003-01-01

    An exclusive measurement of the reaction $gamma d to K^+ K^- p n$ is reported from the CLAS collaboration at Jefferson Lab. A narrow peak, which can be attributed to an exotic baryon with strangeness $S=+1$, is seen in the $K^+n$ invariant mass at $1542pm 5$ MeV/c$^2$ with a measured width of 21 MeV FWHM that is consistent with the instrumental resolution of the CLAS detector. The statistical significance of the peak is $5.3 pm 0.5 sigma$, for a Gaussian peak shape on top of a smooth background. This result is consistent with inclusive measurements of a narrow $S=+1$ baryon reported by other experimental groups.

  20. Ising Model Spin S = 1 ON Directed BARABÁSI-ALBERT Networks

    Science.gov (United States)

    Lima, F. W. S.

    On directed Barabási-Albert networks with two and seven neighbours selected by each added site, the Ising model with spin S = 1/2 was seen not to show a spontaneous magnetisation. Instead, the decay time for flipping of the magnetisation followed an Arrhenius law for Metropolis and Glauber algorithms, but for Wolff cluster flipping the magnetisation decayed exponentially with time. On these networks the Ising model spin S = 1 is now studied through Monte Carlo simulations. However, in this model, the order-disorder phase transition is well defined in this system. We have obtained a first-order phase transition for values of connectivity m = 2 and m = 7 of the directed Barabási-Albert network.

  1. Continuous Cold-atom Inertial Sensor with $1\\ \\text{nrad.s}^{-1}$ Rotation Stability

    CERN Document Server

    Dutta, I; Fang, B; Venon, B; Alzar, C L Garrido; Geiger, R; Landragin, A

    2016-01-01

    We report the operation of a cold-atom inertial sensor which continuously captures the rotation signal. Using a joint interrogation scheme, where we simultaneously prepare a cold-atom source and operate an atom interferometer (AI) enables us to eliminate the dead times. We show that such continuous operation improves the short-term sensitivity of AIs, and demonstrate a rotation sensitivity of $100\\ \\text{nrad.s}^{-1}.\\text{Hz}^{-1/2}$ in a cold-atom gyroscope of $11 \\ \\text{cm}^2$ Sagnac area. We also demonstrate a rotation stability of $1 \\ \\text{nrad.s}^{-1}$ at $10^4$ s of integration time, which establishes the record for atomic gyroscopes. The continuous operation of cold-atom inertial sensors will enable to benefit from the full sensitivity potential of large area AIs, determined by the quantum noise limit.

  2. Physical Contact between the +20 km s-1 Cloud and the Galactic Circumnuclear Disk

    Science.gov (United States)

    Takekawa, Shunya; Oka, Tomoharu; Tanaka, Kunihiko

    2017-01-01

    We report the discovery of physical contact between the Galactic circumnuclear disk (CND) and an adjacent giant molecular cloud. The central 10 pc of our Galaxy has been imaged in molecular lines at millimeter wavelength using the Nobeyama Radio Observatory 45 m radio telescope. In the position-velocity maps of several high-density probe lines, we have found an emission ``bridge'' connecting the +20 km s-1 cloud (M-0.13-0.08) and the negative longitude extension of the CND. The collision between the +20 km s-1 cloud and the CND may be responsible for the formation of the bridge. This event can promote mass accretion onto the CND and/or into the inner cavity.

  3. Observation of an Exotic S=+1 Baryon in Exclusive Photoproduction from the Deuteron

    Science.gov (United States)

    Stepanyan, S.; Hicks, K.; Carman, D. S.; Pasyuk, E.; Schumacher, R. A.; Smith, E. S.; Tedeschi, D. J.; Todor, L.; Adams, G.; Ambrozewicz, P.; Anciant, E.; Anghinolfi, M.; Asavapibhop, B.; Audit, G.; Avakian, H.; Bagdasaryan, H.; Ball, J. P.; Barrow, S. P.; Battaglieri, M.; Beard, K.; Bektasoglu, M.; Bellis, M.; Berman, B. L.; Bianchi, N.; Biselli, A. S.; Boiarinov, S.; Bouchigny, S.; Bradford, R.; Branford, D.; Briscoe, W. J.; Brooks, W. K.; Burkert, V. D.; Butuceanu, C.; Calarco, J. R.; Carnahan, B.; Chen, S.; Ciciani, L.; Cole, P. L.; Coleman, A.; Cords, D.; Corvisiero, P.; Crabb, D.; Crannell, H.; Cummings, J. P.; de Sanctis, E.; Degtyarenko, P. V.; Denizli, H.; Dennis, L.; de Vita, R.; Dharmawardane, K. V.; Dhuga, K. S.; Djalali, C.; Dodge, G. E.; Doughty, D.; Dragovitsch, P.; Dugger, M.; Dytman, S.; Dzyubak, O. P.; Egiyan, H.; Egiyan, K. S.; Elouadrhiri, L.; Empl, A.; Eugenio, P.; Fatemi, R.; Feuerbach, R. J.; Ficenec, J.; Forest, T. A.; Funsten, H.; Garçon, M.; Gavalian, G.; Gilfoyle, G. P.; Giovanetti, K. L.; Gordon, C. I.; Gothe, R.; Griffioen, K.; Guidal, M.; Guillo, M.; Guo, L.; Gyurjyan, V.; Hadjidakis, C.; Hakobyan, R. S.; Hardie, J.; Heddle, D.; Heimberg, P.; Hersman, F. W.; Hicks, R. S.; Holtrop, M.; Hu, J.; Hyde-Wright, C. E.; Ito, M. M.; Jenkins, D.; Joo, K.; Juengst, H. G.; Kellie, J. D.; Khandaker, M.; Kim, K. Y.; Kim, K.; Kim, W.; Klein, A.; Klein, F. J.; Klimenko, A. V.; Klusman, M.; Kossov, M.; Kramer, L. H.; Kuang, Y.; Kubarovsky, V.; Kuhn, S. E.; Kuhn, J.; Lachniet, J.; Lawrence, D.; Li, J.; Lima, A.; Livingston, K.; Lukashin, K.; Manak, J. J.; McAleer, S.; McNabb, J. W.; Mecking, B. A.; Mehrabyan, S.; Melone, J. J.; Mestayer, M. D.; Meyer, C. A.; Mikhailov, K.; Minehart, R.; Mirazita, M.; Miskimen, R.; Mokeev, V.; Morand, L.; Morrow, S.; Muccifora, V.; Mueller, J.; Murphy, L. Y.; Mutchler, G. S.; Napolitano, J.; Nasseripour, R.; Niccolai, S.; Niculescu, G.; Niculescu, I.; Niczyporuk, B. B.; Niyazov, R. A.; Nozar, M.; O'Brien, J.; O'Rielly, G. V.; Opper, A. K.; Osipenko, M.; Park, K.; Peterson, G.; Philips, S. A.; Pivnyuk, N.; Pocanic, D.; Pogorelko, O.; Polli, E.; Pozdniakov, S.; Preedom, B. M.; Price, J. W.; Prok, Y.; Protopopescu, D.; Qin, L. M.; Raue, B. A.; Riccardi, G.; Ricco, G.; Ripani, M.; Ritchie, B. G.; Ronchetti, F.; Rossi, P.; Rowntree, D.; Rubin, P.; Sabatié, F.; Salgado, C.; Santoro, J.; Sapunenko, V.; Serov, V. S.; Sharabian, Y. G.; Shaw, J.; Simionatto, S.; Skabelin, A. V.; Smith, L. C.; Sober, D. I.; Strakovsky, I. I.; Stavinsky, A.; Stoler, P.; Suleiman, R.; Taiuti, M.; Taylor, S.; Thoma, U.; Thompson, R.; Tur, C.; Ungaro, M.; Vineyard, M. F.; Vlassov, A. V.; Wang, K.; Weinstein, L. B.; Weller, H.; Weygand, D. P.; Whisnant, C. S.; Wolin, E.; Wood, M. H.; Yegneswaran, A.; Yun, J.

    2003-12-01

    In an exclusive measurement of the reaction γd→K+K-pn, a narrow peak that can be attributed to an exotic baryon with strangeness S=+1 is seen in the K+n invariant mass spectrum. The peak is at 1.542±0.005 GeV/c2 with a measured width of 0.021 GeV/c2 FWHM, which is largely determined by experimental mass resolution. The statistical significance of the peak is (5.2±0.6)σ. The mass and width of the observed peak are consistent with recent reports of a narrow S=+1 baryon by other experimental groups.

  4. [Side effects analyses in consideration of renal function for S-1-administered patients].

    Science.gov (United States)

    Iwai, Mina; Kimura, Michio; Yoshimura, Tomoaki; Yasuda, Tadashi

    2011-06-01

    Although many analyses of S-1 side effects are reported, there are no reports where the analyses of side effects were performed in consideration of renal function, which is an important index of medication dose. Therefore, we investigated side effects in consideration of renal function. The subjects were 163 patients administered S-1 at the Department of Surgery of Ogaki Municipal Hospital, between October 2008 and December 2009. The frequency and severity of side effects were high and serious in the groupwhose creatinine clearance was low. A significant difference was observed among 3 groups with regard to thrombocytopenia and dehydration. In conclusion, we think that pharmacists must take renal function into consideration when administering medication, to keepclose medicinal guidance, and to actively observe progress.

  5. BOLD fMRI signal characteristics of S1- and S2-SSFP at 7 Tesla

    NARCIS (Netherlands)

    Goa, Pål E; Koopmans, Peter J; Poser, Benedikt A; Barth, Markus; Norris, David G

    2014-01-01

    OBJECT: To compare the BOLD fMRI signal characteristics at in the cortex and on the pial surface for a non-balanced steady-state free precession sequence (nb-SSFP) at 7 T. MATERIALS AND METHODS: A multi-echo nb-SSFP sequence was used for high resolution fMRI at 7 T. Two S1 (S(+)) echoes at different

  6. A hybrid vanadium fluoride with structurally isolated S = 1 kagome layers.

    Science.gov (United States)

    Aidoudi, Farida H; Downie, Lewis J; Morris, Russell E; A de Vries, Mark; Lightfoot, Philip

    2014-05-01

    A new organically-templated vanadium(III) fluoride, (NH4)2(C2H8N)[V3F12], has been prepared using an ionothermal approach. This compound has a unique layered structure featuring distorted S = 1 kagome planes separated by the cationic species. The compound exhibits magnetic frustration, with a canted antiferromagnetic ground state. On further cooling in the ground state a pronounced change in magnetisation kinetics is observed.

  7. Measurement of anti pp elastic scattering parameters at radical S=1. 8 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Shukla, S.; Amos, N.A.; Avila, C.; Baker, W.F.; Eartly, D.P.; Gomez, B.; Lennox, A.J.; Negret, J.P.; Pruss, S.M.; Rubinstein, R.; Sanabria, J.C. (Fermi National Accelerator Lab., Batavia, IL (United States)); Bertani, M.; Giacomelli, G.; Mondardini, M.R.; Spagnoli, M.; Veronesi, I.; Zucchelli, S. (Univ. Bologna (Italy) Ist. Nazionale di Fisica Nucleare, Bologna (Italy)); Block, M.M.; Guss, C.M.; Sadr, S. (Northwestern Univ., Evanston, IL (United States)); Dimitroyannis, D.A.; Goodman, J.A. (Univ. Maryland, College Park, MD (United States)); Ellsworth, R.W. (George Mason Univ., Fairfax, VA (United States)); Orear, J. (Cornell Univ., Ithaka, NY (United States)); E710 Collaboration

    1992-03-01

    A measurement of the total nuclear cross section, {sigma}{sub t}, the ratio of the real to the imaginary part of the forward nuclear elastic scattering amplitude, {rho}, and the nuclear slope parameter, B, for anti pp elastic scattering at {radical}S=1.8 TeV, is presented. We find {sigma}{sub t}=72.8{+-}3.1 mb, {rho}=0.140{+-}.069 and B=16.99{+-}47 (GeV/c){sup -2}. (orig.).

  8. Eight-year survival after advanced gastric cancer treated with S-1 followed by surgery

    Institute of Scientific and Technical Information of China (English)

    Susumu; Hijioka; Keisho; Chin; Yasuyuki; Seto; Noriko; Yamamoto; Kiyohiko; Hatake

    2010-01-01

    We report a case of advanced gastric cancer, with cervical, axillary, and abdominal paraaortic lymph node metastases, that was successfully treated with chemotherapy and surgery. The disease was initially considered unresectable, and the patient was treated with orally administered S-1. Chemotherapy was effective, and all lymph node metastases disappeared after 6 courses. After 27 mo of chemotherapy, the patient underwent curative surgery, with subtotal gastrectomy and lymph node dissection. Histopathologic...

  9. Room for an S=+1 pentaquark in K+-nucleus phenomenology

    Science.gov (United States)

    Gal, A.; Friedman, E.

    2006-01-01

    Evidence for excitation of exotic S=+1 pentaquark degrees of freedom is presented by studying optical-potential fits to K+-nucleus total, reaction and elastic-differential cross section data at plab~500-700 MeV/c. Estimates of the underlying two-nucleon absorption K+nN→Θ+N reaction cross section are made and are used for discussing the anticipated cross section of the strangeness exchange reaction K+N→πΘ+.

  10. Short Time-Scale Sensory Coding in S1 during Discrimination of Whisker Vibrotactile Sequences.

    Science.gov (United States)

    McGuire, Leah M; Telian, Gregory; Laboy-Juárez, Keven J; Miyashita, Toshio; Lee, Daniel J; Smith, Katherine A; Feldman, Daniel E

    2016-08-01

    Rodent whisker input consists of dense microvibration sequences that are often temporally integrated for perceptual discrimination. Whether primary somatosensory cortex (S1) participates in temporal integration is unknown. We trained rats to discriminate whisker impulse sequences that varied in single-impulse kinematics (5-20-ms time scale) and mean speed (150-ms time scale). Rats appeared to use the integrated feature, mean speed, to guide discrimination in this task, consistent with similar prior studies. Despite this, 52% of S1 units, including 73% of units in L4 and L2/3, encoded sequences at fast time scales (≤20 ms, mostly 5-10 ms), accurately reflecting single impulse kinematics. 17% of units, mostly in L5, showed weaker impulse responses and a slow firing rate increase during sequences. However, these units did not effectively integrate whisker impulses, but instead combined weak impulse responses with a distinct, slow signal correlated to behavioral choice. A neural decoder could identify sequences from fast unit spike trains and behavioral choice from slow units. Thus, S1 encoded fast time scale whisker input without substantial temporal integration across whisker impulses.

  11. Traumatic L5 over S1 spondyloptosis without neurological involvement managed nonoperatively: a case report

    Institute of Scientific and Technical Information of China (English)

    Vijay Goni; Nirmal Raj Gopinathan; Uttam Chand Saini; Shashidhar B Kantharajanna

    2013-01-01

    High-grade spondylolisthesis is very rare.We came across a case of high-grade spondylolisthesis at the L5-S1 level in a 32-year-old manual labourer who was hit by a heavy object on his flexed back.The patient presented to us with persistent deformity in the back.He complained of back pain on prolonged standing and after moderate work.Because of that he was unable to return to his work.On clinical examination there was a large step in the lower lumbar region.Detailed neurological evaluation of the lower limbs did not reveal any sensory or motor deficit,neither did bowel or bladder involvement.Radiographic examination showed L5 over S1 traumatic spondyloptosis.CT scan revealed that neural canal was in normal width.MRI confirmed spondyloptosis of L5 over S1 without any compromise of the spinal canal and with normal-looking cauda.Concerning the delayed presentation and no neurological deficit,the patient was managed conservatively after thorough counsel.At 6 months,the patient returned to his work and at the latest follow-up (15 months) he was free from back pain.Conservative means of treatment can lead to satisfactory outcome,especially when the patient has delayed presentation.

  12. Axial interbody arthrodesis of the L5-S1 segment: a systematic review of the literature.

    Science.gov (United States)

    Schroeder, Gregory D; Kepler, Christopher K; Vaccaro, Alexander R

    2015-09-01

    The object of this study was to determine the fusion rate and safety profile of an axial interbody arthrodesis of the L5-S1 motion segment. A systematic search of MEDLINE was conducted for literature published between January 1, 2000, and August 17, 2014. All peer-reviewed articles related to the fusion rate of L5-S1 and the safety profile of an axial interbody arthrodesis were evaluated. Seventy-four articles were identified, but only 15 (13 case series and 2 retrospective cohort studies) met the study inclusion criteria. The overall pseudarthrosis rate at L5-S1 was 6.9%, and the rate of all other complications was 12.9%. A total of 14.4% of patients required additional surgery, and the infection rate was 5.4%. Deformity studies reported a significantly increased rate of complications (46.3%), and prospectively collected data demonstrated significantly higher complication (36.8%) and revision (22.6%) rates. Lastly, studies with a conflict of interest reported lower complication rates (12.4%). A systematic review of the literature indicates that an axial interbody fusion performed at the lumbosacral junction is associated with a high fusion rate (93.15%) and an acceptable complication rate (12.90%). However, these results are based mainly on retrospective case series by authors with a conflict of interest. The limited prospective data available indicate that the actual fusion rate may be lower and the complication rate may be higher than currently reported.

  13. Magnetic properties of a quasi-one-dimensional S=1/2 antiferromagnet: Copper benzoate

    DEFF Research Database (Denmark)

    Dender, D.C.; Davidovic, D.; Reich, D.H.

    1996-01-01

    We use magnetic susceptibility and inelastic neutron scattering measurements to show that copper benzoate, Cu(C6D5COO)(2) . 3D(2)O, is a quasi-one-dimensional S=1/2 antiferromagnet with an exchange constant J=1.57 meV Below T=0.8 K a ferromagnetic contribution to the susceptibility marks the onset...... of canted three-dimensional (3D) antiferromagnetic order. An external magnetic field suppresses this effect, and the susceptibility measured in high held shows only the response of a S=1/2 chain. The dynamic correlation function S((q) over tilde,omega) measured by neutron scattering shows only 1D spin...... correlations for (h) over bar omega greater than or equal to 0.4 meV at T=1.8 K. There is clear evidence of a continuum of magnetic excitations, consistent with the current theoretical picture of the excitation spectrum of the S=1/2 chain at T=0 K....

  14. On the Absence of EUV Emission from Comet C/2012 S1 (ISON)

    Science.gov (United States)

    Bryans, Paul; Pesnell, W. Dean

    2016-05-01

    When the sungrazing comet C/2012 S1 (ISON) made its perihelion passage within two solar radii of the Sun’s surface, it was expected to be a bright emitter at extreme ultraviolet (EUV) wavelengths. However, despite solar EUV telescopes repointing to track the orbit of the comet, no emission was detected. This “null result” is interesting in its own right, offering the possibility of placing limits on the size and composition of the nucleus. We explain the lack of detection by considering the properties of the comet and the solar atmosphere that determine the intensity of EUV emission from sungrazing comets. By comparing these properties with those of sungrazing comet C/2011 W3 (Lovejoy), which did emit in the EUV, we conclude that the primary factor resulting in non-detectable EUV emission from C/2012 S1 (ISON) was an insufficiently large nucleus. We conclude that the radius of C/2012 S1 (ISON) was at least a factor of four less than that of C/2011 W3 (Lovejoy). This is consistent with white-light observations in the days before perihelion that suggested the comet was dramatically reducing in size on approach.

  15. Analysing the New Saturnian Rings, R/2004 S1 and R/2004 S2

    Science.gov (United States)

    Winter, S. M. Giuliatti; Sfair, R.; Mourão, D. C.; Bastos, T. A.

    2005-12-01

    The Cassini-Huygens arrival into the Saturnian system brought a large amount of data about the satellites and rings. Two diffuse rings were found in the region between the A ring and Prometheus. R/2004 S1 is coorbital to Atlas and R/2004 S2 is close to Prometheus. In this work we analysed the closest approach between Prometheus and both rings. As a result we found that the satellite removes particles from R/2004 S2 ring. Long-term numerical simulations showed that some particles can cross the F ring region . The well known region of the F ring, where small satellites are present and particles are being taking from the ring, gains a new insight with the presence of particles from R/2004 S2 ring. The computation of the Lyapunov Characteristic Exponent reveled that the R/2004 S2 ring lies in a chaotic region while R/2004 S1 ring and Atlas are in a stable region. Atlas is responsible for the formation of three regimes in the R/2004 S1 ring, as expected for a satellite embedded in a ring.

  16. Investigation of the selective androgen receptor modulators S1, S4 and S22 and their metabolites in equine plasma using high-resolution mass spectrometry.

    Science.gov (United States)

    Hansson, Annelie; Knych, Heather; Stanley, Scott; Thevis, Mario; Bondesson, Ulf; Hedeland, Mikael

    2016-04-15

    Selective androgen receptor modulators (SARMs) are prohibited in sports due to their performance enhancing ability. It is important to investigate the metabolism to determine appropriate targets for doping control. This is the first study where the equine metabolites of SARMs S1, S4 (Andarine) and S22 (Ostarine) have been studied in plasma. Each SARM was administered to three horses as an intravenous bolus dose and plasma samples were collected. The samples were pretreated with protein precipitation using cold acetonitrile before separation by liquid chromatography. The mass spectrometric analysis was performed using negative electrospray, quadrupole time-of-flight mass spectrometry operated in MS(E) mode and triple-quadrupole mass spectrometry operated in selected reaction monitoring mode. For the quantification of SARM S1, a deuterated analogue was used as internal standard. The numbers of observed metabolites were eight, nine and four for the SARMs S1, S4 and S22, respectively. The major metabolite was formed by the same metabolic reactions for all three SARMs, namely amide hydrolysis, hydroxylation and sulfonation. The values of the determined maximum plasma concentrations were in the range of 97-170 ng/mL for SARM S1, 95-115 ng/mL for SARM S4 and 92-147 ng/mL for SARM S22 and the compounds could be detected for 96 h, 12 h and 18 h, respectively. The maximum plasma concentration of SARMs S1, S4 and S22 was measured in the first sample (5 min) after administration and they were eliminated fast from plasma. The proposed targets to be used in equine doping control are the parent compounds for all three SARMs, but with the metabolite yielding the highest response as a complementary target. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  17. Effects of Lipids and Heparin Sulphate on Formation of Amyloid Fibril from αs1-Casein%磷脂和硫酸肝素对αs1-酪蛋白淀粉样纤维沉淀形成的影响

    Institute of Scientific and Technical Information of China (English)

    尹建元; John A.Carver; David C.Thorn; 刘继华

    2013-01-01

    αs1-Casein is the major protein in milk and has a molecular chaperone action.With the interest in that,whether κ-and αs2-casein can form amyloid fibrils or not,we investigated amyloid fibril formation from αs1-casein by means of ThT assay,transmission electron microscopy and circular dichroism(CD) spectra.The results show that amyloid fibrils formed from αs1-casein at pH =5.0-5.4 and 65 ℃ under heating for 144 h.The CD spectra show that the structure of αs1-casein has changed from α-helical toβ sheet core,which are the special structure characters of fibrils.Lipids of D6PC promoted amyloid fibril formation from αs1-casein in the concentration of 0.3 and 1 mmol/L.Heparin sulphate did not influence the fibril formation from αs1-casein in the test.It is concluded that although αs1-casein has the effects of molecular chaperon,but it could still form fibrils under harsh conditions.Lipids can influence amyloid fibril formation from αs1-casein,depanding on concentration.It suggests that there is relationship between lipid in membrane and amyloid fibril formation.The results are helpful to exploring the mechanism of fibril formation from αs1-casein.%利用ThT荧光分析法、透射电子显微镜和圆二色光谱检测αs1-酪蛋白形成淀粉样纤维沉淀(Fibril)的动力学过程,优化了其形成条件,研究了Fibril形成的影响因素.实验结果表明,αs1-酪蛋白在65℃高温下,pH=5~5.4的范围内,加热144 h以上,可以形成Fibril.在此过程中,αs1-酪蛋白的二级结构由α螺旋构象向β折叠构象转变.甘油磷酸胆碱D6PC可以显著地促进αs1-酪蛋白Fibril的形成,并呈浓度依赖性,说明一定条件下蛋白质可能与细胞膜的磷脂之间存在相互作用,从而导致酪蛋白二级构象的转变.硫酸肝素对αs1-酪蛋白形成Fibril无影响,说明硫酸肝素对蛋白质二级构象的影响作用因蛋白质的不同而不同,与不同蛋白质的Fibril形成机制相关.

  18. Effect of combined treatment with micelle-incorporated cisplatin (NC-6004) and S-1 on human gastric cancer xenografts.

    Science.gov (United States)

    Kudo, Masahisa; Yamamoto, Yoshiyuki; Koga, Yoshikatsu; Hamaguchi, Tetsuya; Akimoto, Tetsuo; Yasunaga, Masahiro; Matsumura, Yasuhiro

    2016-12-01

    Combination therapy with S-1 and cisplatin (CDDP) is the standard chemotherapy for advanced gastric cancer in Japan; however, its administration requires hospitalization for hydration to prevent nephrotoxicity from CDDP. By contrast, NC-6004 appears to reduce the renal toxicity of CDDP and may be used on an outpatient basis. Thus, the effects of combined treatment with S-1 and NC-6004 were compared with those of S-1 and CDDP in a human gastric cancer model. In vitro cytotoxic effects were investigated in 44As3Luc, MKN45 and MKN74 human gastric cancer cell lines. The effects of NC-6004 and 5-fluorouracil (5-FU) were compared with the effects of CDDP and 5-FU using the combination index method. The in vivo antitumor effects of S-1/NC-6004 and S-1/CDDP were evaluated in mice bearing 44As3Luc xenografts. Both combinations exhibited synergistic activity in MKN45 and MKN74 cells and additive effects in 44As3Luc cells. Moreover, the in vivo antitumor effects did not differ between the S-1/NC-6004 and S-1/CDDP treatment groups. However, a significantly lower body weight loss was observed in S-1/NC-6004-treated mice compared with the S-1/CDDP-treated mice. Our data warrant a clinical evaluation of S-1/NC-6004 combination therapy.

  19. Bitopic Sphingosine 1-Phosphate Receptor 3 (S1P3) Antagonist Rescue from Complete Heart Block: Pharmacological and Genetic Evidence for Direct S1P3 Regulation of Mouse Cardiac Conduction

    Science.gov (United States)

    Sanna, M. Germana; Vincent, Kevin P.; Repetto, Emanuela; Nguyen, Nhan; Brown, Steven J.; Abgaryan, Lusine; Riley, Sean W.; Leaf, Nora B.; Cahalan, Stuart M.; Kiosses, William B.; Kohno, Yasushi; Brown, Joan Heller; McCulloch, Andrew D.

    2016-01-01

    The molecular pharmacology of the G protein–coupled receptors for sphingosine 1-phosphate (S1P) provides important insight into established and new therapeutic targets. A new, potent bitopic S1P3 antagonist, SPM-354, with in vivo activity, has been used, together with S1P3-knockin and S1P3-knockout mice to define the spatial and functional properties of S1P3 in regulating cardiac conduction. We show that S1P3 is a key direct regulator of cardiac rhythm both in vivo and in isolated perfused hearts. 2-Amino-2-[2-(4-octylphenyl)ethyl]propane-1,3-diol in vivo and S1P in isolated hearts induced a spectrum of cardiac effects, ranging from sinus bradycardia to complete heart block, as measured by a surface electrocardiogram in anesthetized mice and in volume-conducted Langendorff preparations. The agonist effects on complete heart block are absent in S1P3-knockout mice and are reversed in wild-type mice with SPM-354, as characterized and described here. Homologous knockin of S1P3-mCherry is fully functional pharmacologically and is strongly expressed by immunohistochemistry confocal microscopy in Hyperpolarization Activated Cyclic Nucleotide Gated Potassium Channel 4 (HCN4)-positive atrioventricular node and His-Purkinje fibers, with relative less expression in the HCN4-positive sinoatrial node. In Langendorff studies, at constant pressure, SPM-354 restored sinus rhythm in S1P-induced complete heart block and fully reversed S1P-mediated bradycardia. S1P3 distribution and function in the mouse ventricular cardiac conduction system suggest a direct mechanism for heart block risk that should be further studied in humans. A richer understanding of receptor and ligand usage in the pacemaker cells of the cardiac system is likely to be useful in understanding ventricular conduction in health, disease, and pharmacology. PMID:26494861

  20. S1P, dihydro-S1P and C24:1-ceramide levels in the HDL-containing fraction of serum inversely correlate with occurrence of ischemic heart disease

    DEFF Research Database (Denmark)

    Argraves, Kelley M; Sethi, Amar A; Gazzolo, Patrick J;

    2011-01-01

    The lysosphingolipid sphingosine 1-phosphate (S1P) is carried in the blood in association with lipoproteins, predominantly high density lipoproteins (HDL). Emerging evidence suggests that many of the effects of HDL on cardiovascular function may be attributable to its S1P cargo.......The lysosphingolipid sphingosine 1-phosphate (S1P) is carried in the blood in association with lipoproteins, predominantly high density lipoproteins (HDL). Emerging evidence suggests that many of the effects of HDL on cardiovascular function may be attributable to its S1P cargo....

  1. Odin observations of ammonia in the Sgr A +50 km s-1 cloud and circumnuclear disk

    Science.gov (United States)

    Sandqvist, Aa.; Hjalmarson, Å.; Frisk, U.; Lundin, S.; Nordh, L.; Olberg, M.; Olofsson, G.

    2017-03-01

    Context. The Odin satellite is now into its sixteenth year of operation, much surpassing its design life of two years. One of the sources which Odin has observed in great detail is the Sgr A complex in the centre of the Milky Way. Aims: To study the presence of NH3 in the Galactic centre and spiral arms. Methods: Recently, Odin has made complementary observations of the 572 GHz NH3 line towards the Sgr A +50 km s-1 cloud and circumnuclear disk (CND). Results: Significant NH3 emission has been observed in both the +50 km s-1 cloud and the CND. Clear NH3 absorption has also been detected in many of the spiral arm features along the line of sight from the Sun to the core of our Galaxy. Conclusions: The very large velocity width (80 km s-1) of the NH3 emission associated with the shock region in the southwestern part of the CND may suggest a formation/desorption scenario similar to that of gas-phase H2O in shocks/outflows. Odin is a Swedish-led satellite project funded jointly by the Swedish National Space Board (SNSB), the Canadian Space Agency (CSA), the National Technology Agency of Finland (Tekes), the Centre National d'Études Spatiales (CNES), France, and the European Space Agency (ESA). The former Space division of the Swedish Space Corporation, today OHB Sweden, is the prime contractor, also responsible for Odin operations.The reduced spectra are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/599/A135

  2. Unusual Water Production Activity of Comet C/2012 S1 (ISON): Outbursts and Continuous Fragmentation

    Science.gov (United States)

    Combi, M. R.; Fougere, N.; Mäkinen, J. T. T.; Bertaux, J.-L.; Quémerais, E.; Ferron, S.

    2014-06-01

    The Solar Wind ANisotropies (SWAN) all-sky hydrogen Lyα camera on the SOlar and Heliospheric Observer (SOHO) satellite observed the hydrogen coma of comet C/2012 S1 (ISON) for most of the last month of its activity from 2013 October 24 to November 24, ending just 4 days before perihelion and its final disruption. The water production rate of the comet was determined from these observations. SOHO has been operating in a halo orbit around the Earth-Sun L1 Lagrange point since its launch in late 1995. Most water vapor produced by comets is ultimately photodissociated into two H atoms and one O atom producing a huge hydrogen coma that is routinely observed in the daily SWAN images in comets of sufficient brightness. Water production rates were calculated from 22 images over most of the last month of the pre-perihelion apparition. The water production rate increased very slowly on average from October 24.9 until November 12.9, staying between 1.8 and 3.4 × 1028 s-1, after which it increased dramatically, reaching 1.6 to 2 × 1030 s-1 from November 21.6 to 23.6. It was not detected after perihelion on December 3.7 when it should have been visible. We examine the active surface area necessary to explain the water production rate and its variation and are able to place constraints on the physical size of the original nucleus necessary to account for the large amount of activity from November 12.9 and until just before perihelion.

  3. Localization of 3d $\\mathcal{N}=2$ Supersymmetric Theories on $S^1 \\times D^2$

    CERN Document Server

    Yoshida, Yutaka

    2014-01-01

    We study three dimensional N=2 supersymmetric Chern-Simons-Matter theories on the direct product of circle and two dimensional hemisphere (S^1 x D^2) with specified boundary conditions by the method of localization. We construct boundary interactions to cancel the supersymmetric variation of three dimensional superpotential term and Chern-Simons term and show inflows of bulk-boundary anomalies. It finds that the boundary conditions induce two dimensional N=(0,2) type supersymmetry on the boundary torus. We also study the relation between the 3d-2d coupled partition function of our model and three dimensional holomorphic blocks.

  4. Measurement of the hyperfine splitting of the 6S$_{1/2}$ level in rubidium

    CERN Document Server

    Galvan, A Perez; Orozco, L A

    2008-01-01

    We present a measurement of the hyperfine splitting of the 6S$_{1/2}$ excited level of rubidium using two photon absorption spectroscopy in a glass cell. The values we obtain for the magnetic dipole constant A are 239.18(03) MHz and 807.66(08) MHz for $^{85}$Rb and $^{87}$Rb, respectively. The combination of the magnetic moments of the two isotopes and our measurements show a hyperfine anomaly in this atomic excited state. The observed hyperfine anomaly difference has a value of $_{87}\\delta_{85}=-0.0036(2)$ due to the finite distribution of nuclear magnetization, the Bohr-Weisskopf effect.

  5. 换壳之作联想乐Phone S1

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    乐Phone在国产智能手机中的口碑还不错,这款新登场的乐Phone S1,在之前乐Phone的基础上。对外观进行了一些修改,变得更潮。搭载Qualcomm QSD 8250处理器(最早的乐Phone是高通SnapDragon QSD8650),主频1GHz.配备512MB RAM,

  6. The S1 buoy station, Po River delta: data handling and presentation

    Directory of Open Access Journals (Sweden)

    Alessandro COLUCCELLI

    2006-12-01

    Full Text Available The technical setting of the mete-oceanographic buoy at site S1 south of the Po River delta is presented. The station was deployed by Istituto di Scienze Marine (ISMAR of CNR of Bologna, in cooperation with the local Regional Government and Environmental Agencies (ARPA of E. Romagna, and ADRICOSM. The buoy mooring and data flow architecture is discussed, with some emphasis on the WWW data presentation. The possible integration with other remote stations, data and mete-oceanographic operational activities is also proposed.

  7. Diazido{(S-1-phenyl-N,N-bis[(2-pyridylmethyl]ethanamine}copper(II

    Directory of Open Access Journals (Sweden)

    Sankara Rao Rowthu

    2011-07-01

    Full Text Available In the title compound, [Cu(N32(C20H21N3], the CuII ion is coordinated by the three N atoms of the (S-1-phenyl-N,N-bis[(2-pyridylmethyl]ethanamine ligand and two N atoms from two azide anions, resulting in a distorted square-pyramidal environment. A weak intermolecular C—H...N hydrogen-bonding interaction between one pyridine group of the ligand and an azide N atom of an adjacent complex unit gives a one-dimensional chain structure parallel to the c axis.

  8. S1 guideline for diagnostic evaluation in androgenetic alopecia in men, women and adolescents.

    Science.gov (United States)

    Blume-Peytavi, U; Blumeyer, A; Tosti, A; Finner, A; Marmol, V; Trakatelli, M; Reygagne, P; Messenger, A

    2011-01-01

    Androgenetic alopecia (AGA) is the most common hair loss disorder, affecting both men and women. Due to the frequency and the often significant impairment of life perceived by the affected patients, competent advice, diagnosis and treatment is particularly important. As evidence-based guidelines on hair disorders are rare, a European consensus group was constituted to develop guidelines for the diagnostic evaluation and treatment of AGA. This S1 guideline for diagnostic evaluation of AGA in men, women and adolescents reviews the definition of AGA and presents expert opinion-based recommendations for sex-dependent steps in the diagnostic procedure.

  9. Ligand-induced expansion of the S1' site in the anthrax toxin lethal factor

    Energy Technology Data Exchange (ETDEWEB)

    Maize, Kimberly M.; Kurbanov, Elbek K.; Johnson, Rodney L.; Amin, Elizabeth Ambrose; Finzel, Barry C. (UMM)

    2016-07-05

    The Bacillus anthracis lethal factor (LF) is one component of a tripartite exotoxin partly responsible for persistent anthrax cytotoxicity after initial bacterial infection. Inhibitors of the zinc metalloproteinase have been investigated as potential therapeutic agents, but LF is a challenging target because inhibitors lack sufficient selectivity or possess poor pharmaceutical properties. These structural studies reveal an alternate conformation of the enzyme, induced upon binding of specific inhibitors, that opens a previously unobserved deep pocket termed S1'* which might afford new opportunities to design selective inhibitors that target this subsite.

  10. Magic Wavelength for Caesium Transition Line 6S1/2 -6P3/2

    Institute of Scientific and Technical Information of China (English)

    ZHENG Yu-Nan; ZHOU Xiao-Ji; CHEN Jing-Biao; CHEN Xu-Zong

    2006-01-01

    @@ We investigate the magic wavelengths of the trapping laser for 6S1/2 - 6P3/2 of the Cs atom in a region where the optical shift between two different states can be eliminated. For fine levels and linear polarized laser they are 930.4 nm and 937.2nm. The magic wavelengths range from 927. 7nm to 945.0nm for circle-polarized perturbing laser. Effects of nuclear spin, the hyper-fine Zeeman levels, and the polarization of the light, which generate different magic wavelengths, are further discussed.

  11. Valence bond phases in S = 1/2 Kane-Mele-Heisenberg model.

    Science.gov (United States)

    Zare, Mohammad H; Mosadeq, Hamid; Shahbazi, Farhad; Jafari, S A

    2014-11-12

    The phase diagram of the Kane-Mele-Heisenberg model in a classical limit [47] contains disordered regions in the coupling space, as the result of competition between different terms in the Hamiltonian, leading to frustration in finding a unique ground state. In this work we explore the nature of these phases in the quantum limit, for a S = 1/2. Employing exact diagonalization in Sz and nearest neighbour valence bond bases, and bond and plaquette valence bond mean field theories, we show that the disordered regions are divided into ordered quantum states in the form of plaquette valence bond crystals and staggered dimerized phases.

  12. Ferroquadrupolar phase of the S=1 bilinear–biquadratic Heisenberg model on the square lattice

    Energy Technology Data Exchange (ETDEWEB)

    Pires, A.S.T., E-mail: antpires@fisica.ufmg.br

    2014-12-15

    Using the SU(3) Schwinger bosons formalism in a mean field approximation we have investigated the ferroquadrupolar phase of the S=1 Heisenberg model with bilinear and biquadratic exchange interactions on the square lattice. This nonmagnetic phase is characterized by a finite quadrupole moment. We have compared our results with the ones obtained from other theories. - Highlights: • The quadrupole moment of the ferroquadrupolar phase is calculated. • The static spin structure factor is obtained. • The quadrupole structure factor is calculated and shows to diverge at q=(0,0)

  13. Local probe of fractional edge states of S=1 Heisenberg spin chains.

    Science.gov (United States)

    Delgado, F; Batista, C D; Fernández-Rossier, J

    2013-10-18

    Spin chains are among the simplest physical systems in which electron-electron interactions induce novel states of matter. Here we propose to combine atomic scale engineering and spectroscopic capabilities of state of the art scanning tunnel microscopy to probe the fractionalized edge states of individual atomic scale S=1 spin chains. These edge states arise from the topological order of the ground state in the Haldane phase. We also show that the Haldane gap and the spin-spin correlation length can be measured with the same technique.

  14. 2(2S+1)-component model and its connection with other field theories

    CERN Document Server

    Dvoeglazov, V V

    1994-01-01

    This talk presents the review of forgotten but attractive formalism proposed by Joos and Weinberg in the sixties for description of high-spin particles. Problems raised in the recent works [Ahluwalia {\\it et al.}] are discussed. New results obtained by the author in his preceding papers ["Hadronic J.", 1993, v. 16, No. 5, pp. 423-428; No. 6, pp. 459-467; Preprints IFUNAM FT-93-19, 24, 35] are reported. In {\\it Appendix}, bibliography of publications related with mentioned $2(2S+1)$- component formalism is presented.

  15. A hidden BFKL / XXX s = -1/2 spin chain mapping

    CERN Document Server

    Romagnoni, Alberto

    2011-01-01

    A new mapping between the BFKL equation and Beisert's representation of the XXX Heisenberg ferromagnet with spin s = - 1/2 is given. The action of the Hamiltonian operator of a spin chain with SL(2) invariance on a symmetric double copy of a harmonic oscillator excited state is shown to be identical to the action of the BFKL Hamiltonian on the gluon Green function for the azimuthal-angle averaged forward scattering case. A natural mapping between the gluon Green function, discretized in virtuality space, and the double harmonic oscillator excited state emerges.

  16. (1S-1,2-O-Benzylidene-α-d-glucurono-6,3-lactone

    Directory of Open Access Journals (Sweden)

    David J. Watkin

    2009-02-01

    Full Text Available X-ray crystallographic analysis has established that the major product from the protection of d-glucoronolactone with benzaldehyde is (1S-1,2-O-benzylidene-α-d-glucurono-6,3-lactone, C13H12O6, rather than the R epimer. The crystal structure exists as O—H...O hydrogen-bonded chains of molecules lying parallel to the a axis. The absolute configuration was determined by the use of d-glucuronolactone as the starting material.

  17. Redox-Controled Preservation of Mediterranean Sapropel S1 deposits during Formation and Interruption

    Science.gov (United States)

    De Lange, Gert J.; Filippidi, Amalia; Goudeau, Marie-Louise; Hennekam, Rick

    2016-04-01

    Organic-rich units (sapropels) occur in Mediterraneran sediments in a repetitive, climate-controled way. Their deposition is thought to be precession-related and to be associated with humid climate conditions. The last humid period from 11 - 5 kyr 14C ago, occurred simultaneous with a sustained circum-Mediterranean wet period and vegetated Sahara. Within that period, the most recent sapropel (S1) formed synchronously between 9.8 and 5.7 14C ky BP at all water depths greater than a few hundred metres. As a consequence of increased fresh water (monsoon) input, surface waters had a reduced salinity and concomitantly the deep (> 1.8 km) eastern Mediterranean Sea was devoid of oxygen during 4,000 years of S1 formation. This has resulted in a differential basin-wide preservation of S1sediments determined by water depth, as a result of different ventilation/climate-related redox conditions above and below 1.8 km. The end of this period is marked by a basin-wide high sedimentary manganese-oxide peak that represents an abrupt re-ventilation of the deep-water at 5.7 kyr. The sustaining oxic conditions thereafter have resulted in a downward progressing oxidation-front that is not only characterized by the degradation of most organic matter over its active pathway, but also by the built-up of manganese oxide. The latter has resulted in a secondary diagenetic Mn-peak below the first, upper, ventilation Mn-peak. Apart from the major re-ventilation event at the end of sapropel S1 formation, also other, short-term ventilation events appear to have occurred during its formation, notably during the 8.2 ka event. This potentially basin-wide event is particularly noticeable at relatively shallow near-coastal sites of high sedimentation rates. It marks a brief episode of not only re-oxygenated deep water thus reduced preservation, but also decreased primary productivity thus nutrient supply. This 8.2 cal ka BP interruption event is thought to be related to enhanced deep water formation

  18. Impact of intratumoral expression levels of fluoropyrimidine-metabolizing enzymes on treatment outcomes of adjuvant S-1 therapy in gastric cancer.

    Directory of Open Access Journals (Sweden)

    Ji-Yeon Kim

    Full Text Available We analyzed the expression levels of fluoropyrimidine-metabolizing enzymes (thymidylate synthase [TS], dihydropyrimidine dehydrogenase [DPD], thymidine phosphorylase [TP] and orotate phosphoribosyltransferase [OPRT] to identify potential biomarkers related to treatment outcomes in gastric cancer (GC patients receiving adjuvant S-1 chemotherapy. In this study, 184 patients who received curative gastrectomy (D2 lymph node dissection and adjuvant S-1 were included. Immunohistochemistry and quantitative reverse transcription polymerase chain reaction were performed to measure the protein and mRNA levels of TS, DPD, TP, and OPRT in tumor tissue. In univariate analysis, low intratumoral DPD protein expression was related to poorer 5-year disease-free survival (DFS; 78% vs. 88%; P = 0.068. Low intratumoral DPD mRNA expression (1st [lowest] quartile was also related to poorer DFS (69% vs. 90%; P < 0.001 compared to high intratumoral DPD expression (2nd to 4th quartiles. In multivariate analyses, low intratumoral DPD protein or mRNA expression was related to worse DFS (P < 0.05, irrespective of other clinical variables. TS, TP, and OPRT expression levels were not related to treatment outcomes. Severe non-hematologic toxicities (grade ≥ 3 had a trend towards more frequent development in patients with low intratumoral DPD mRNA expression (29% vs. 16%; P = 0.068. In conclusion, GC patients with high intratumoral DPD expression did not have inferior outcome following adjuvant S-1 therapy compared with those with low DPD expression. Instead, low intratumoral DPD expression was related to poor DFS.

  19. Sequence and phylogenetic analysis of genome segments S1, S2, S3 and S6 of Mal de Río Cuarto virus, a newly accepted Fijivirus species.

    Science.gov (United States)

    Distéfano, Ana J; Conci, Luis R; Muñoz Hidalgo, Marianne; Guzmán, Fabiana A; Hopp, Horacio E; del Vas, Mariana

    2003-03-01

    Mal de Río Cuarto virus (MRCV) is a newly described species of the genus Fijivirus, family Reoviridae. The nucleotide sequence of four MRCV genome segments was determined. MRCV S1, S2, S3 and S6 were predicted to encode proteins of 168.4, 134.4, 141.7 and 90 kDa, respectively. MRCV S1 encodes a basic protein that contains conserved RNA-dependent RNA polymerase motifs, and is homologous to Rice black streaked dwarf virus (RBSDV), Fiji disease virus (FDV) and Nilaparvata lugens reovirus (NLRV) polymerases as well as to corresponding proteins of members of other genera of the Reoviridae. MRCV S2 codes for a protein with intermediate homology to the ones coded by RBSDV S4 and FDV S3 'B' spike, which is presumably the B-spike protein. MRCV S3 most probably encodes the major core protein and is highly homologous to corresponding proteins of RBSDV S2 and FDV S3. MRCV S6-encoded protein has low homology to the proteins of unknown function coded by RBSDV S6 and FDV S6. The identity levels between all analyzed MRCV coded proteins and their RBSDV counterparts varied between 84.5 and 44.8%. The analysis of the reported sequences allowed a phylogenetic comparison of MRCV with other reovirus and supported its taxonomic status within the genus.

  20. Molecular Characteristics of S1 Gene of Infectious Bronchitis Virus Isolated from Chicken Proventriculus

    Institute of Scientific and Technical Information of China (English)

    CHENG Li-qin; ZHOU Ji-yong; John Dikki; SHEN Xing-yan; CHEN Ji-gang; ZHANG De-yong

    2003-01-01

    Infectious bronchitis virus was isolated from swollen proventriculi of clinically ill chicken. Thesuspected virus samples (2/97, 3/97, 1/98) were adapted in SPF chicken embryos for virus isolation andidentification. All the virus isolates were able to agglutinate chicken erythrocytes after treatment with trypsin,and interfer with the reproduction of Newcastle disease virus in chicken embryos, and have low antigenic relat-edness values with reference positive IBV. The isolates 2/97, 3/97, 1/98 RNAs extracted from the allantoicfluid of inoculated embryonated eggs were converted to cDNA by reverse transcription with 3'-primer of S1gene of (IBV). Polymerase chain reaction (PCR) was performed with two primers which span the S1 gene.Amplified product of 1.93 kb was subjected to EcoR Ⅰ and BamH Ⅰ digestion and the fragments obtainedwere the same as expected size. The PCR product was ligated to pBlueScript-SK (+) vector, and its nucleotidesequence was determined by the dideoxy-mediated chain termination method. Nucleotide sequence analysisshowed 73.6 - 99.7 % homology between the isolated IBV and the IBV strains in GenBank. The homology ofamino acid was 71.4 - 99.4 %.

  1. On the determination of low-energy constants for {delta}S=1 transitions

    Energy Technology Data Exchange (ETDEWEB)

    Giusti, L.; Pena, C. [European Organization for Nuclear Research, Geneva (Switzerland); Hernandez, P. [Dpto. Fisica Teorica and IFIC, Edificio Institutos Investigacion, Valencia (Spain); Laine, M. [Bielefeld Univ. (Germany). Fakultaet fuer Physik; Wennekers, J.; Wittig, H. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

    2005-10-01

    We present our preliminary results for three-point correlation functions involving the operators entering the {delta}S=1 effective Hamiltonian with an active charm quark, obtained using overlap fermions in the quenched approximation. This is the first computation carried out for valence quark masses small enough so as to permit a matching to Quenched Chiral Perturbation Theory in the {epsilon}-regime. The commonly observed large statistical fluctuations are tamed by means of low-mode averaging techniques, combined with restrictions to individual topological sectors. We also discuss the matching of the resulting hadronic matrix elements to the effective low-energy constants for {delta}S=1 transitions. This involves (a) finite-volume corrections which can be evaluated at NLO in Quenched Chiral Perturbation Theory, and (b) the short-distance renormalization of the relevant four-quark operators in discretizations based on the overlap operator. We discuss perturbative estimates for the renormalization factors and possible strategies for their non-perturbative evaluation. Our results can be used to isolate the long-distance contributions to the {delta}I=1/2 rule, coming from physics effects around the intrinsic QCD scale. (orig.)

  2. S1 gene-based phylogeny of infectious bronchitis virus: An attempt to harmonize virus classification.

    Science.gov (United States)

    Valastro, Viviana; Holmes, Edward C; Britton, Paul; Fusaro, Alice; Jackwood, Mark W; Cattoli, Giovanni; Monne, Isabella

    2016-04-01

    Infectious bronchitis virus (IBV) is the causative agent of a highly contagious disease that results in severe economic losses to the global poultry industry. The virus exists in a wide variety of genetically distinct viral types, and both phylogenetic analysis and measures of pairwise similarity among nucleotide or amino acid sequences have been used to classify IBV strains. However, there is currently no consensus on the method by which IBV sequences should be compared, and heterogeneous genetic group designations that are inconsistent with phylogenetic history have been adopted, leading to the confusing coexistence of multiple genotyping schemes. Herein, we propose a simple and repeatable phylogeny-based classification system combined with an unambiguous and rationale lineage nomenclature for the assignment of IBV strains. By using complete nucleotide sequences of the S1 gene we determined the phylogenetic structure of IBV, which in turn allowed us to define 6 genotypes that together comprise 32 distinct viral lineages and a number of inter-lineage recombinants. Because of extensive rate variation among IBVs, we suggest that the inference of phylogenetic relationships alone represents a more appropriate criterion for sequence classification than pairwise sequence comparisons. The adoption of an internationally accepted viral nomenclature is crucial for future studies of IBV epidemiology and evolution, and the classification scheme presented here can be updated and revised novel S1 sequences should become available. Copyright © 2016 Elsevier B.V. All rights reserved.

  3. Optical Parameters of Spray-Deposited CdS1- y Te y Thin Films

    Science.gov (United States)

    Ikhmayies, Shadia J.

    2017-02-01

    CdS x Te1- x and CdS1- y Te y solid solutions are usually formed in the interfacial region in CdS/CdTe solar cells during the deposition of the CdTe layer and/or the processing steps of the device. In this work, indium-doped CdS1- y Te y thin films were prepared by first producing CdS:In thin films by the spray pyrolysis technique on glass substrates, then annealing the films in nitrogen atmosphere in the presence of elemental tellurium. The films were characterized by scanning electron microscopy, energy dispersive x-ray spectroscopy, and transmittance measurements. The transmittance was used to deduce the reflectance from which the optical parameters were computed. The extinction coefficient, refractive index, the real and imaginary parts of the dielectric constant, optical conductivity, and energy loss were computed, and their dependence on the composition was investigated. In addition, the dispersion of the refractive index was analyzed by the single oscillator model, and dispersion parameters were investigated.

  4. Spin S = 1 centers: a universal type of paramagnetic defects in nanodiamonds of dynamic synthesis

    Science.gov (United States)

    Shames, A. I.; Osipov, V. Yu; von Bardeleben, H. J.; Vul', A. Ya

    2012-06-01

    Intrinsic paramagnetic defects in ˜5 nm sized nanodiamonds, produced by various dynamic synthesis (DySND) techniques (detonation, shock-wave, pulsed laser ablation of solid carbon containing targets), have been studied by multi-frequency electron paramagnetic resonance (EPR). X-band (9-10 GHz) EPR spectra of DySND, in addition to the main intensive singlet Lorentzian-like EPR signal, reveal a low intensity doublet pattern within the half-field (HF) region (g ˜ 4). On transferring spectra to the Q-band (34 GHz) the shape of the HF pattern changes and splitting between doublet components is reduced from 10.4 to 2.6 mT. The HF patterns observed are attributed to the ‘forbidden’ ΔMS = 2 transitions between the Zeeman levels of some spin-triplet (S = 1) centers. The model of two triplet centers with g ˜ 2.003 and zero-field splitting parameters D1 = 0.095 cm-1 (TR1) and D2 = 0.030 cm-1 (TR2) satisfactorily describes experimental results at both microwave frequencies. The spin-triplet-type defects are observed in a wide variety of DySND samples irrespective of industrial supplier, cooling and carbon soot refinement methods, initial purity, disintegration, or subsequent targeted chemical modification. This indicates that the intrinsic defects with S = 1 in DySND systems are of universal origin.

  5. NMR evidence for peculiar spin gaps in a doped S=1/2 Heisenberg spin chain

    Energy Technology Data Exchange (ETDEWEB)

    Utz, Yannic; Rudisch, Christian; Hammerath, Franziska; Grafe, Hans-Joachim; Mohan, Ashwin; Ribeiro, Patrick; Hess, Christian; Wolter, Anja; Kataev, Vladislav; Nishimoto, Satoshi; Drechsler, Stefan-Ludwig; Buechner, Bernd [IFW Dresden (Germany); Singh, Surjeet [Indian Institute of Science Education and Research, Pune (India); Saint-Martin, Romuald; Revcolevschi, Alexandre [Laboratoire de Physico-Chimie de l' Etat Solide, Universite Paris-Sud, Orsay (France)

    2012-07-01

    We present {sup 63}Cu Nuclear Magnetic Resonance (NMR) measurements on undoped, Ca-doped and Ni-doped SrCuO{sub 2} single crystals. SrCuO{sub 2} is a good realization of a one-dimensional S=1/2 Heisenberg spin chain. This is manifested by the theoretically-expected temperature-independent NMR spin-lattice relaxation rate T{sub 1}{sup -1}. In Sr{sub 0.9}Ca{sub 0.1}CuO{sub 2} an exponential decrease of T{sub 1}{sup -1} below 90 K evidences the opening of a gap in the spin excitation spectrum, which amounts to {Delta}=50 K. DMRG calculations are presented to discuss the origin of this spin gap. New results on SrCu{sub 0.99}Ni{sub 0.01}O{sub 2} also indicate the presence of a spin gap, which is twice as large as in Sr{sub 0.9}Ca{sub 0.1}CuO{sub 2}, despite the minor doping level of Ni compared to Ca. We discuss different possible impacts of Ca (S=0) and Ni (S=1) doping on structural and magnetic properties of the parent compound.

  6. Spin nematic and orthogonal nematic states in S=1 non-Heisenberg magnet

    Energy Technology Data Exchange (ETDEWEB)

    Fridman, Yu.A., E-mail: frid@tnu.crimea.edu [V.I. Vernadsky Taurida national university, Academician Vernadsky ave., 4, 95007 Simferopol (Ukraine); Kosmachev, O.A. [V.I. Vernadsky Taurida national university, Academician Vernadsky ave., 4, 95007 Simferopol (Ukraine); Klevets, Ph.N. [V.I. Vernadsky Taurida national university, Academician Vernadsky ave., 4, 95007 Simferopol (Ukraine); Institut fuer Physik, Universitaet Augsburg, Universitaetsstrasse 1, 86159 Augsburg (Germany)

    2013-01-15

    Phases of S=1 non-Heisenberg magnet at various relationships between the exchange integrals are studied in the mean-field limit at zero temperature. It is shown that four phases can be realized in the system under consideration: the ferromagnetic, antiferromagnetic, nematic, and the orthogonal nematic states. The phase diagram is constructed. It is shown that the phase transitions between the ferromagnetic phase and the orthogonal nematic phase and between the antiferromagnetic phase and the orthogonal nematic phase are the degenerated first-order transitions. For the first time the spectra of elementary excitations in all phases are obtained within the mean-field limit. - Highlights: Black-Right-Pointing-Pointer We investigated phases of S=1 non-Heisenberg magnet. Black-Right-Pointing-Pointer Found four phases: ferromagnetic, antiferromagnetic, nematic, and orthogonal nematic. Black-Right-Pointing-Pointer The phase diagram is determined. Black-Right-Pointing-Pointer The spectra of elementary excitations are obtained in all phases for the first time.

  7. Optical Parameters of Spray-Deposited CdS1-y Te y Thin Films

    Science.gov (United States)

    Ikhmayies, Shadia J.

    2016-11-01

    CdS x Te1-x and CdS1-y Te y solid solutions are usually formed in the interfacial region in CdS/CdTe solar cells during the deposition of the CdTe layer and/or the processing steps of the device. In this work, indium-doped CdS1-y Te y thin films were prepared by first producing CdS:In thin films by the spray pyrolysis technique on glass substrates, then annealing the films in nitrogen atmosphere in the presence of elemental tellurium. The films were characterized by scanning electron microscopy, energy dispersive x-ray spectroscopy, and transmittance measurements. The transmittance was used to deduce the reflectance from which the optical parameters were computed. The extinction coefficient, refractive index, the real and imaginary parts of the dielectric constant, optical conductivity, and energy loss were computed, and their dependence on the composition was investigated. In addition, the dispersion of the refractive index was analyzed by the single oscillator model, and dispersion parameters were investigated.

  8. Phase Structure of lattice $SU(2) x U_{S}(1)$ three-dimensional Gauge Theory

    CERN Document Server

    Farakos, K; McNeill, D

    1999-01-01

    We discuss a phase diagram for a relativistic SU(2) x U_{S}(1) lattice gauge theory, with emphasis on the formation of a parity-invariant chiral condensate, in the case when the $U_{S}(1)$ field is infinitely coupled, and the SU(2) field is moved away from infinite coupling by means of a strong-coupling expansion. We provide analytical arguments on the existence of (and partially derive) a critical line in coupling space, separating the phase of broken SU(2) symmetry from that where the symmetry is unbroken. We review uncoventional (Kosterlitz-Thouless type) superconducting properties of the model, upon coupling it to external electromagnetic potentials. We discuss the rôle of instantons of the unbroken subgroup U(1) of SU(2), in eventually destroying superconductivity under certain circumstances. The model may have applications to the theory of high-temperature superconductivity. In particular, we argue that in the regime of the couplings leading to the broken SU(2) phase, the model may provide an explanati...

  9. The chiral S = -1 meson-baryon interaction with new constraints on the NLO contributions

    Science.gov (United States)

    Ramos, A.; Feijoo, A.; Magas, V. K.

    2016-10-01

    We present a study of the S = - 1 meson-baryon interaction, employing a chiral SU(3) Lagrangian up to next-to-leading order (NLO) and implementing unitarization in coupled channels. The parameters of the model have been fitted to a large set of experimental scattering data in different two-body channels, to threshold branching ratios, and to the precise SIDDHARTA value of the energy shift and width of kaonic hidrogen. In contrast to other groups, we have taken into consideration the K- p →K+Ξ- ,K0Ξ0 reaction data, since we found in a previous work to be especially sensitive to the NLO parameters of the chiral Lagrangian. In the present work we also include the Born terms, which usually have very little effect, and find them to be non-negligible in the K- p → KΞ channels, correspondingly causing significant modifications to the NLO parameters. We furthermore show that the importance of the Born terms becomes more visible in the isospin projected amplitudes of the K- p → KΞ reactions. The measurement of processes that filter single isospin components, like the KL0 p →K+Ξ0 reaction that could be measured at the proposed secondary KL0 beam at Jlab, would put valuable constraints on the chiral models describing the meson-baryon interaction in the S = - 1 sector.

  10. Quantum vs Classical Magnetization Plateaus of S=1/2 Frustrated Heisenberg Chains

    Science.gov (United States)

    Hida, Kazuo; Affleck, Ian

    2005-06-01

    The competition between quantum and classical magnetization plateaus of S=1/2 frustrated Heisenberg chains with modified exchange couplings is investigated. The conventional S=1/2 frustrated Heisenberg chain is known to exhibit a 3-fold degenerate \\uparrow\\downarrow\\uparrow-type classical plateau at 1/3 of the saturation magnetization accompanied by the spontaneous Z3 translational symmetry breakdown. The stability of this plateau phase against period 3 exchange modulation which favors the \\bullet\\hskip -1pt-\\hskip -1pt\\bullet \\uparrow-type quantum plateau state (\\bullet\\hskip -1pt-\\hskip -1pt\\bullet = singlet dimer) is studied by bosonization, renormalization group and numerical diagonalization methods. The ground state phase diagram and the spin configuration in each phase are numerically determined. The translationally invariant Valence Bond Solid-type model with 4-spin and third neighbor interactions, which has the exact \\bullet\\hskip -1pt-\\hskip -1pt\\bullet \\uparrow-type quantum plateau state, is also presented. The phase transition to the classical \\uparrow\\downarrow\\uparrow-type ground state is also observed by varying the strength of 4-spin and third neighbor interactions. The relation between these two types of models with quantum plateau states is discussed.

  11. Isomerization, Perturbations, Calculations and the S_{1} State of C_{2}H_{2}

    Science.gov (United States)

    Baraban, J. H.; Changala, P. B.; Berk, J. R. P.; Field, R. W.; Stanton, J. F.; Merer, A. J.

    2013-06-01

    Preliminary analysis of the energy region of the cis-trans isomerization transition state on the S_{1} surface of C_{2}H_{2} has revealed novel patterns and surprising perturbations, including unusually large (and high-order) anharmonicities, as well as K-staggerings of several vibrational levels. These effects complicate the analysis considerably, and require new models and calculations to account for and predict features of the observed spectra. The ˜{A}-˜{X} spectrum of acetylene has been studied both experimentally and theoretically for almost a century, and this cycle of unexpected phenomena eliciting innovative responses is found throughout its history. Especially in the last ten years, progress in understanding the S_{1} state rovibrational level structure and cis-trans isomerization has been accelerated by combining the information available from both ab initio computation and spectroscopic observations. The resulting dialogue has then frequently suggested fruitful avenues for further experiments and calculations. Current challenges and recent results in understanding the cis-trans isomerization transition state region will be discussed in this context.

  12. 1H, 13C and 15N resonance assignments and second structure information of Fag s 1: Fagales allergen from Fagus sylvatica.

    Science.gov (United States)

    Moraes, A H; Asam, C; Batista, A; Almeida, F C L; Wallner, M; Ferreira, F; Valente, A P

    2016-04-01

    Fagales allergens belonging to the Bet v 1 family account responsible for the majority of spring pollinosis in the temperate climate zones in the Northern hemisphere. Among them, Fag s 1 from beech pollen is an important trigger of Fagales pollen associated allergic reactions. The protein shares high similarity with birch pollen Bet v 1, the best-characterized member of this allergen family. Of note, recent work on Bet v 1 and its homologues found in Fagales pollen demonstrated that not all allergenic members of this family have the capacity to induce allergic sensitization. Fag s 1 was shown to bind pre-existing IgE antibodies most likely primarily directed against other members of this multi-allergen family. Therefore, it is especially interesting to compare the structures of Bet v 1-like pollen allergens, which have the potential to induce allergic sensitization with allergens that are mainly cross-reactive. This in the end will help to identify allergy eliciting molecular pattern on Bet v 1-like allergens. In this work, we report the (1)H, (15)N and (13)C NMR assignment of beech pollen Fag s 1 as well as the secondary structure information based on backbone chemical shifts.

  13. Substrate binds in the S1 site of the F253A mutant of LeuT, a neurotransmitter sodium symporter homologue

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hui; Gouaux, Eric (Oregon HSU)

    2012-10-10

    LeuT serves as the model protein for understanding the relationships between structure, mechanism and pharmacology in neurotransmitter sodium symporters (NSSs). At the present time, however, there is a vigorous debate over whether there is a single high-affinity substrate site (S1) located at the original, crystallographically determined substrate site or whether there are two high-affinity substrates sites, one at the primary or S1 site and the other at a second site (S2) located at the base of the extracellular vestibule. In an effort to address the controversy over the number of high-affinity substrate sites in LeuT, one group studied the F253A mutant of LeuT and asserted that in this mutant substrate binds exclusively to the S2 site and that 1 mM clomipramine entirely ablates substrate binding to the S2 site. Here we study the binding of substrate to the F253A mutant of LeuT using ligand binding and X-ray crystallographic methods. Both experimental methods unambiguously show that substrate binds to the S1 site of the F253A mutant and that binding is retained in the presence of 1 mM clomipramine. These studies, in combination with previous work, are consistent with a mechanism ofr LeuT that involves a single high-affinity substrate binding site.

  14. Substrate binds in the S1 site of the F253A mutant of LeuT, a neurotransmitter sodium symporter homologue.

    Science.gov (United States)

    Wang, Hui; Gouaux, Eric

    2012-09-01

    LeuT serves as the model protein for understanding the relationships between structure, mechanism and pharmacology in neurotransmitter sodium symporters (NSSs). At the present time, however, there is a vigorous debate over whether there is a single high-affinity substrate site (S1) located at the original, crystallographically determined substrate site or whether there are two high-affinity substrates sites, one at the primary or S1 site and the other at a second site (S2) located at the base of the extracellular vestibule. In an effort to address the controversy over the number of high-affinity substrate sites in LeuT, one group studied the F253A mutant of LeuT and asserted that in this mutant substrate binds exclusively to the S2 site and that 1 mM clomipramine entirely ablates substrate binding to the S2 site. Here we study the binding of substrate to the F253A mutant of LeuT using ligand binding and X-ray crystallographic methods. Both experimental methods unambiguously show that substrate binds to the S1 site of the F253A mutant and that binding is retained in the presence of 1 mM clomipramine. These studies, in combination with previous work, are consistent with a mechanism for LeuT that involves a single high-affinity substrate binding site.

  15. Hepatitis B virus PreS1 facilitates hepatocellular carcinoma development by promoting appearance and self-renewal of liver cancer stem cells.

    Science.gov (United States)

    Liu, Zhixin; Dai, Xuechen; Wang, Tianci; Zhang, Chengcheng; Zhang, Wenjun; Zhang, Wei; Zhang, Qi; Wu, Kailang; Liu, Fang; Liu, Yingle; Wu, Jianguo

    2017-08-01

    Hepatitis B virus (HBV) is a major etiologic agent of hepatocellular carcinoma (HCC). However, the molecular mechanism by which HBV infection contributes to HCC development is not fully understood. Here, we initially showed that HBV stimulates the production of cancer stem cells (CSCs)-related markers (CD133, CD117 and CD90) and CSCs-related genes (Klf4, Sox2, Nanog, c-Myc and Oct4) and facilitates the self-renewal of CSCs in human hepatoma cells. Cellular and clinical studies revealed that HBV facilitates hepatoma cell growth and migration, enhances white blood cell (WBC) production in the sera of patients, stimulates CD133 and CD117 expression in HCC tissues, and promotes the CSCs generation of human hepatoma cells and clinical cancer tissues. Detailed studies revealed that PreS1 protein of HBV is required for HBV-mediated CSCs generation. PreS1 activates CD133, CD117 and CD90 expression in normal hepatocyte derived cell line (L02) and human hepatoma cell line (HepG2 and Huh-7); facilitates L02 cells migration, growth and sphere formation; and finally enhances the abilities of L02 cells and HepG2 cells to induce tumorigeneses in nude mice. Thus, PreS1 acts as a new oncoprotein to play a key role in the appearance and self-renewal of CSCs during HCC development. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. S1P, dihydro-S1P and C24:1-ceramide levels in the HDL-containing fraction of serum inversely correlate with occurrence of ischemic heart disease

    DEFF Research Database (Denmark)

    Argraves, Kelley M; Sethi, Amar A; Gazzolo, Patrick J;

    2011-01-01

    The lysosphingolipid sphingosine 1-phosphate (S1P) is carried in the blood in association with lipoproteins, predominantly high density lipoproteins (HDL). Emerging evidence suggests that many of the effects of HDL on cardiovascular function may be attributable to its S1P cargo....

  17. [VALUE OF SMART PHONE Scoliometer SOFTWARE IN OBTAINING OPTIMAL LUMBAR LORDOSIS DURING L4-S1 FUSION SURGERY].

    Science.gov (United States)

    Yu, Weibo; Liang, De; Ye, Linqiang; Jiang, Xiaobing; Yao, Zhensong; Tang, Jingjing; Tang, Yongchao

    2015-10-01

    To investigate the value of smart phone Scoliometer software in obtaining optimal lumbar lordosis (LL) during L4-S1 fusion surgery. Between November 2014 and February 2015, 20 patients scheduled for L4-S1 fusion surgery were prospectively enrolled the study. There were 8 males and 12 females, aged 41-65 years (mean, 52.3 years). The disease duration ranged from 6 months to 6 years (mean, 3.4 years). Before operation, the pelvic incidence (PI) and Cobb angle of L4-S1 (CobbL4-S1) were measured on lateral X-ray film of lumbosacral spine by PACS system; and the ideal CobbL4-S1 was then calculated according to previously published methods [(PI+9 degrees) x 70%]. Subsequently, intraoperative CobbL4-S1 was monitored by the Scoliometer software and was defined as optimal while it was less than 5 degrees difference compared with ideal CobbL4-S1. Finally, the CobbL4-S1 was measured by the PACS system after operation and the consistency was compared between Scoliometer software and PACS system to evaluate the accuracy of this software. In addition, value of this method in obtaining optimal LL was validated by comparing the difference between ideal CobbL4-S1 and preoperative one with that between ideal CobbL4-S1 and postoperative one. The CobbL4-S1 was (36.17 ± 1.53)degrees for ideal one, (22.57 ± 5.50)degrees for preoperative one, (32.25 ± 1.46)degrees for intraoperative one measured by Scoliometer software, and (34.43 ± 1.72)degrees for postoperative one, respectively. The observed intraclass correlation coefficient (ICC) was excellent [ICC = 0.96, 95% confidence interval (0.93, 0.97)] and the mean absolute difference (MAD) was low (MAD = 1.23) between Scoliometer software and PACS system. The deviation between ideal CobbL4-S1 and postoperative CobbL4-S1 was (2.31 ± 0.23)degrees, which was significantly lower than the deviation between ideal CobbL4-S1 and preoperative CobbL4-S1 (13.60 ± 1.85)degrees (t = 6.065, P = 0.001). Scoliometer software can help surgeon obtain

  18. S1 gene sequence analysis of infectious bronchitis virus vaccinal strains (H120 & H52 and their embryo-passaged derivatives

    Directory of Open Access Journals (Sweden)

    Bakhshesh, M.

    2016-07-01

    Full Text Available Avian infectious bronchitis is an acute and highly contagious disease that mainly causes respiratory symptoms in poultry. A number of serotypes and variants of the viral agent with poor cross-protection are the major problem to achieve desired immunity from vaccination. The S1 subunit of S glycoprotein (spike is the major determinant of IBV so that a minor change in amino acid sequence of this protein, alters the virus strain. Therefore, characterization of the sequence of S1 gene is necessary to identify virus strains and their similarities with the vaccinal strains. In this research, the S1 sequence of H52 and H120 vaccinal strains of Razi Institute was fully characterized, and also the effect of serial passages in embryonated - eggs (5 passages beyond the master seed on the S1 gene was investigated. The results showed that H120 and H52 strains of Razi Institute are 100% identical to the reference vaccine strains available in the GenBank. In addition, the H52 strain showed one amino acid substitution from the 3rd passage in which Glycine (G was replaced by Valine (V at position 118 making these passages exactly identical to the H120 strain while no change occurred for the H120 strain during these passages. Analysis of the original vaccinal strains which are widely administered in Iran, is definitely useful for prevention and control strategies against the circulating viruses. To identify the genetic change(s responsible for attenuation of these strains during passages in embryonated-egg, characterization of other genes, especially those involved in replication is recommended.

  19. Minimally Invasive Approach For Extraforaminal Synovial Cyst L5-S1.

    Science.gov (United States)

    Torres Campa-Santamarina, Jose; Towne, Sara; Alimi, Marjan; Navarro-Ramirez, Rodrigo; Härtl, Roger

    2015-10-22

    Symptoms from synovial cysts are produced by neural compression in the spinal canal or the foramen. Few cases of extraforaminal synovial cyst have been published in the literature. This is a case report of a 65-year-old female who presented with a three-month history of sciatic pain and no relief with conservative treatment. MRI showed a left-sided extraforaminal synovial cyst at L5-S1 with compression of the L5 nerve root at the lateral portion of the foramen. Minimally invasive surgery for resection was performed using an extraforaminal tubular microscopic endoscopy-assisted approach. The patient improved clinically and remained symptom-free for the entire follow-up of 30 months.

  20. Early changes in shoot transcriptome of rice in response to Rhodotorula mucilaginosa JGTA-S1

    Directory of Open Access Journals (Sweden)

    Chinmay Saha

    2015-12-01

    Full Text Available Yeasts of Rhodotorula genus have been reported to show endophytic colonization in different plants. Some of the Rhodotorula species are found to exhibit plant growth promoting activities and also have been reported to protect plants against invading pathogens. A yeast strain closely related to Rhodotorula mucilaginosa was isolated from the endosphere of Typha angustifolia collected from a Uranium mine. A microarray analysis was performed to investigate the early changes in rice shoot transcripts in response to this yeast (R. mucilaginosa JGTA-S1. Transcriptional changes were monitored in 6 h and 24 h treated rice plant shoots as compared to 0 h control. The microarray data has been submitted to the NCBI GEO repository under the accession number of GSE64321.

  1. Tarlov cyst as a rare cause of S1 radiculopathy: A case report.

    Science.gov (United States)

    Nadler, S F; Bartoli, L M; Stitik, T P; Chen, B

    2001-05-01

    A 37-year-old female physician presented with a chief complaint of left posterior thigh pain, which began insidiously approximately 4 months before her initial examination. Initially, she had been evaluated by her physician, and magnetic resonance imaging (MRI) was ordered. The MRI scan was reported to be within normal limits, with the exception of minimal disc bulging at L4-5. She had received physical therapy with little benefit and was referred for physiatric assessment. Review of the patient's original MRI scan showed the presence of perineurial (Tarlov) cysts within the sacral canal at the level of S2, with compression of the adjacent nerve root. Subsequent electrodiagnostic testing showed axonal degeneration consistent with an S1 radiculopathy. Tarlov cysts can be a rare cause of lumbosacral radiculopathy and should be considered in the differential diagnosis of radicular leg pain.

  2. Vibrational Spectrum of o-Dimethoxybenzene in the S1 and D0 States

    Institute of Scientific and Technical Information of China (English)

    HUANG,Jian-Han; TZENG,Wen-Bih; HUANG,Ke-Long

    2008-01-01

    The optimized molecular geometries of o-dimethoxybenzene (ODMB) in the S0 state were predicted by ab initio and density functional theory calculations. Its vibrational spectra in the S1 and D0 states were studied by one color resonant two photon ionization (1C-R2PI) and mass analyzed threshold ionization (MATI) experiments. The results indicated that trans rotamer was most stable. Only one rotamer of ODMB was detected by the 1C-R2PI spectra, and its band origin was (35750±2) cm-1, its ionization energy was (61617±5) cm-1. Most of the observed vibrations in the D0 state resulted from the in-plane ring and substituent sensitive modes.

  3. Color coherence in p pbar collisions at squareroot s = 1.8 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Abachi, S.

    1996-09-01

    We report on two preliminary studies of color coherence effects on {ital p}{ital {anti p}} collisions based on data collected by the D{null} detector during the 1992-1993 and 1994-1995 runs at the Fermilab Tevatron collider at a center of mass energy {radical}s = 1. 8 TeV. Demonstration of initial-to-final state color interference effects is done in a higher energy region by measuring spatial correlations between the softer third jet and the second leading- {ital E}{sub {ital T}} jet in multi-jet events and in a lower energy regime by examining particle distribution patterns in W+Jet events. The data are compared to Monte Carlo simulations with different color coherence implementations and the predictions of an NLO parton level calculation.

  4. Spin-weighted spheroidal equation in the case of s = 1

    Institute of Scientific and Technical Information of China (English)

    Sun Yue; Tian Gui-Hua; Dong Kun

    2011-01-01

    We present a series of studies to solve the spin-weighted spheroidal wave equation by using the method of supersymmetric quantum mechanics. We first obtain the first four terms of super-potential of the spin-weighted spheroidal wave equation in the case of s = 1. These results may help summarize the general form for the n-th term of the super-potential, which is proved to be correct by means of induction. Then we compute the eigen-values and the eigenfunctions for the ground state. Finally, the shape-invariance property is proved and the eigen-values and eigen-functions for excited states are obtained. All the results may be of significance for studying the electromagnetic radiation processes near rotating black holes and computing the radiation reaction in curved space-time.

  5. The gravity dual of supersymmetric gauge theories on a squashed $S^1 \\times S^3$

    CERN Document Server

    Cassani, Davide

    2014-01-01

    We present a new one-parameter family of supersymmetric solutions deforming AdS_5. This is constructed as an asymptotically locally anti de Sitter (AlAdS) solution of five-dimensional minimal gauged supergravity, with topology R x R^4 and a non-trivial graviphoton field, and can be uplifted to ten or eleven dimensional supergravities. An analytic continuation of this solution yields the gravity dual to a class of four-dimensional N=1 supersymmetric gauge theories on a curved manifold with topology S^1 x S^3, comprising an SU(2) x U(1)-symmetric squashed three-sphere, with a non-trivial background gauge field coupling to the R-symmetry current. We compute the holographically renormalised on-shell action and interpret it in terms of the Casimir energy of the dual field theory. We also determine the holographic conserved charges of the solution and discuss relations between them.

  6. Clinical and morphological study of calf enlargement following S-1 radiculopathy

    Directory of Open Access Journals (Sweden)

    Osvaldo J. M. Nascimento

    1992-09-01

    Full Text Available Calf enlargement following sciatica is a rare condition. It is reported the case of a 28-year-old woman who complained of repeated episodes of lower back pain radiating into the left buttock and foot. One year after the beginning of her symptoms, she noticed enlargement of her left calf. X-ray studies disclosed L5-S1 disk degeneration. EMG showed muscle denervation with normal motor conduction velocity. Open biopsies of the gastrocnemius muscles were performed. The left gastrocnemius muscle showed hypertrophic type 2 fibers in comparison with the right gastrocnemius. Electron microscopy showed mildly increased number of mitochondria in these fibers. A satisfactory explanation for denervation hypertrophy has yet to be provided.

  7. S=--1 Meson-Baryon Scattering in Coupled Channel Unitarized Chiral Perturbation Theory

    CERN Document Server

    García-Recio, C; Ruiz-Arriola, E; Vacas, M J V

    2003-01-01

    The $s-$wave meson-baryon scattering amplitude is analyzed for the strangeness $S=-1$ and isospin I=0 sector in a Bethe-Salpeter coupled channel formalism incorporating Chiral Symmetry. Four two-body channels have been considered: $\\bar K N$, $\\pi \\Sigma $, $\\eta \\Lambda $, $ K \\Xi$. The needed two particle irreducible matrix amplitude is taken from lowest order Chiral Perturbation Theory in a relativistic formalism. Off-shell behaviour is parameterized in terms of low energy constants, which outnumber those assumed in previous works and provide a better fit to the data. The position of the complex poles in the second Riemann sheet of the scattering amplitude determine masses and widths of the $\\Lambda (1405)$ and $\\Lambda(1670)$ resonances which compare well with accepted numbers.

  8. Strangeness $S=-1$ hyperon-nucleon scattering at leading order in the covariant Weinberg's approach

    CERN Document Server

    Li, Kai-Wen; Geng, Li-Sheng

    2016-01-01

    Inspired by the success of covariant baryon chiral perturbation theory in the one baryon sector and in the heavy-light systems, we explore the relevance of relativistic effects in the construction of the strangeness $S=-1$ hyperon-nucleon interaction using chiral perturbation theory. Due to the non-perturbative nature of the hyperon-nucleon interaction, we follow the covariant Weinberg's approach recently proposed by Epelbaum and Gegelia to sum the leading order chiral potential using the Kadyshevsky equation (Epelbaum, 2012) in this exploratory work. By fitting the five low-energy constants to available experimental data, we find that the cutoff dependence is mitigated compared with the results obtained in the Weinberg's approach for both partial wave phase shifts and the description of experimental data. Nevertheless, at leading order, the description of experimental data remains quantitatively similar. We discuss in detail the cutoff dependence of the partial wave phase shifts and cross sections in the Wei...

  9. IMAGING COMET ISON C/2012 S1 IN THE INNER CORONA AT PERIHELION

    Energy Technology Data Exchange (ETDEWEB)

    Druckmüller, Miloslav [Faculty of Mechanical Engineering, Brno University of Technology, 616 69 Brno (Czech Republic); Habbal, Shadia Rifai [Institute for Astronomy, University of Hawaii, Honolulu 96822, Hawaii (United States); Aniol, Peter [ASTELCO Systems GmbH, D-82152 Martinsried (Germany); Ding, Adalbert [Institute of Optics and Atomic Physics, Technische Universitaet Berlin, and Institute of Technical Physics, Berlin (Germany); Morgan, Huw [Institute of Mathematics, Physics and Computer Science, Aberystwyth University, Ceredigion, Cymru SY23 3BZ (United Kingdom)

    2014-04-01

    Much anticipation and speculation were building around comet ISON, or C/2012 S1, discovered on 2012 September 21 by the International Scientific Optical Network telescope in Russia, and bound for the Sun on 2013 November 28, with a closest heliocentric approach distance of 2.7 R {sub ☉}. Here we present the first white light image of the comet's trail through the inner corona. The image was taken with a wide field Lyot-type coronagraph from the Mees Observatory on Haleakala at 19:12 UT, past its perihelion passage at 18:45 UT. The perfect match between the comet's trail captured in the inner corona and the trail that had persisted across the field of view of 2-6 R {sub ☉} of the Solar and Heliospheric Observatory Large Angle and Spectrometric Coronagraph Experiment/C2 coronagraph at 19:12 UT demonstrates that the comet survived its perihelion passage.

  10. O/S-1/ interactions - The product channels. [collisional electron quenching and chemical reaction pathway frequencies

    Science.gov (United States)

    Slanger, T. G.; Black, G.

    1978-01-01

    The first measurements are reported of the reaction pathways for the interaction between oxygen atoms in the 4.19 eV S-1 state, and four molecules, N2O, CO2, H2O, and NO. Distinction is made between three possible paths - quenching to O(D-1), quenching to O(P-3), and chemical reaction. With N2O, the most reasonable interpretation of the data indicates that there no reaction, in sharp contrast with the interaction between O(D-1) and N2O, which proceeds entirely by reaction. Similarly, there is no reaction with CO2. With H2O, the reactive pathway is the dominant one, although electronic quenching is not negligible. With NO, O(D-1) is the preferred product.

  11. Microbial hydrogen production with Bacillus coagulans IIT-BT S1 isolated from anaerobic sewage sludge.

    Science.gov (United States)

    Kotay, Shireen Meher; Das, Debabrata

    2007-04-01

    Bacillus coagulans strain IIT-BT S1 isolated from anaerobically digested activated sewage sludge was investigated for its ability to produce H(2) from glucose-based medium under the influence of different environmental parameters. At mid-exponential phase of cell growth, H(2) production initiated and reached maximum production rate in the stationary phase. The maximal H(2) yield (2.28 mol H(2)/molglucose) was recorded at an initial glucose concentration of 2% (w/v), pH 6.5, temperature 37 degrees C, inoculum volume of 10% (v/v) and inoculum age of 14 h. Cell growth rate and rate of hydrogen production decreased when glucose concentration was elevated above 2% w/v, indicating substrate inhibition. The ability of the organism to utilize various carbon sources for H(2) fermentation was also determined.

  12. Ferrimagnetic states in S = 1/2 frustrated Heisenberg chains with period 3 exchange modulation

    Science.gov (United States)

    Hida, K.

    2007-04-01

    The ground state properties of the S = 1/2 frustrated Heisenberg chain with period 3 exchange modulation are investigated using the numerical diagonalization and density matrix renormalization group (DMRG) method. It is known that this model has a magnetization plateau at one third of the saturation magnetization Ms. On the other hand, the ground state is ferrimagnetic even in the absence of frustration if one of the nearest neighbour bond is ferromagnetic and the others are antiferromagnetic. In the present work, we show that this ferrimagnetic state continues to the region in which all bonds are antiferromagnetic if the frustration is strong. This state further continues to the above-mentioned 1/3 plateau state. In between, we also find the noncollinear ferrimagnetic phase in which the spontaneous magnetization is finite but less than Ms/3. The intuitive interpretation for the phase diagram is given and the physical properties of these phases are discussed.

  13. Ferrimagnetic states in S = 1/2 frustrated Heisenberg chains with period 3 exchange modulation

    Energy Technology Data Exchange (ETDEWEB)

    Hida, K [Divison of Material Science, Graduate School of Science and Engineering, Saitama University, Saitama, Saitama, 338-8570 (Japan)

    2007-04-11

    The ground state properties of the S = 1/2 frustrated Heisenberg chain with period 3 exchange modulation are investigated using the numerical diagonalization and density matrix renormalization group (DMRG) method. It is known that this model has a magnetization plateau at one third of the saturation magnetization M{sub s}. On the other hand, the ground state is ferrimagnetic even in the absence of frustration if one of the nearest neighbour bond is ferromagnetic and the others are antiferromagnetic. In the present work, we show that this ferrimagnetic state continues to the region in which all bonds are antiferromagnetic if the frustration is strong. This state further continues to the above-mentioned 1/3 plateau state. In between, we also find the noncollinear ferrimagnetic phase in which the spontaneous magnetization is finite but less than M{sub s}/3. The intuitive interpretation for the phase diagram is given and the physical properties of these phases are discussed.

  14. The Occurrence of Type S1A Serine Proteases in Sponge and Jellyfish

    Science.gov (United States)

    Rojas, Ana; Doolittle, Russell F.

    2003-01-01

    Although serine proteases are found in all kinds of cellular organisms and many viruses, the classic "chymotrypsin family" (Group S1A by th e 1998 Barrett nomenclature) has an unusual phylogenetic distribution , being especially common in animals, entirely absent from plants and protists, and rare among fungi. The distribution in Bacteria is larg ely restricted to the genus Streptomyces, although a few isolated occ urrences in other bacteria have been reported. The family may be enti rely absent from Archaea. Although more than a thousand sequences have been reported for enzymes of this type from animals, none of them ha ve been from early diverging phyla like Porifera or Cnidaria, We now report the existence of Group SlA serine proteases in a sponge (phylu m Porifera) and a jellyfish (phylum Cnidaria), making it safe to conc lude that all animal groups possess these enzymes.

  15. S=-1 meson-baryon scattering in coupled-channel unitarized Chiral Perturbation Theory

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Recio, C.; Nieves, J.; Ruiz Arriola, E. [Departamento de Fisica Moderna, Universidad de Granada, E-18071, Granada (Spain); Vicente Vacas, M. [Departamento de Fisica Teorica and IFIC, Centro Mixto Universidad de Valencia-CSIC, Ap. Correos 22085, E-46071, Valencia (Spain)

    2003-11-01

    The s-wave meson-baryon scattering amplitude is analyzed for the strangeness S=-1 and isospin I=0 sector in a Bethe-Salpeter coupled-channel formalism incorporating Chiral Symmetry. Four two-body channels have been considered: anti K N, {pi}{sigma}, {eta}{lambda}, K {xi}. The needed two-particle irreducible matrix amplitude is taken from lowest-order Chiral Perturbation Theory in a relativistic formalism. Off-shell behaviour is parameterized in terms of low-energy constants, which outnumber those assumed in previous works and provide a better fit to the data. The position of the complex poles in the second Riemann sheet of the scattering amplitude determines masses and widths of the {lambda}(1405) and {lambda}(1670) resonances which compare well with accepted numbers. (orig.)

  16. 2,5-Disubstituted pyrrolidine carboxylates as potent, orally active sphingosine-1-phosphate (S1P) receptor agonists.

    Science.gov (United States)

    Colandrea, Vincent J; Legiec, Irene E; Huo, Pei; Yan, Lin; Hale, Jeffrey J; Mills, Sander G; Bergstrom, James; Card, Deborah; Chebret, Gary; Hajdu, Richard; Keohane, Carol Ann; Milligan, James A; Rosenbach, Mark J; Shei, Gan-Ju; Mandala, Suzanne M

    2006-06-01

    A series of 2,5-cis-disubstituted pyrrolidines were synthesized and evaluated as S1P receptor agonists. Compounds 15-21 were identified with good selectivity over S1P3 which lowered circulating lymphocytes after oral administration in mice.

  17. Antigen S1, encoded by the MIC1 gene, is characterized as an epitope of human CD59, enabling measurement of mutagen-induced intragenic deletions in the AL cell system

    Science.gov (United States)

    Wilson, A. B.; Seilly, D.; Willers, C.; Vannais, D. B.; McGraw, M.; Waldren, C. A.; Hei, T. K.; Davies, A.; Chatterjee, A. (Principal Investigator)

    1999-01-01

    S1 cell membrane antigen is encoded by the MIC1 gene on human chromosome 11. This antigen has been widely used as a marker for studies in gene mapping or in analysis of mutagen-induced gene deletions/mutations, which utilized the human-hamster hybrid cell-line, AL-J1, carrying human chromosome 11. Evidence is presented here which identifies S1 as an epitope of CD59, a cell membrane complement inhibiting protein. E7.1 monoclonal antibody, specific for the S1 determinant, was found to react strongly with membrane CD59 in Western blotting, and to bind to purified, urinary form of CD59 in ELISAs. Cell membrane expression of S1 on various cell lines always correlated with that of CD59 when examined by immunofluorescent staining. In addition, E7.1 antibody inhibited the complement regulatory function of CD59. Identification of S1 protein as CD59 has increased the scope of the AL cell system by enabling analysis of intragenic mutations, and multiplex PCR analysis of mutated cells is described, showing variable loss of CD59 exons.

  18. S1 Pocket of a Bacterially Derived Subtilisin-like Protease Underpins Effective Tissue Destruction*

    Science.gov (United States)

    Wong, Wilson; Wijeyewickrema, Lakshmi C.; Kennan, Ruth M.; Reeve, Shane B.; Steer, David L.; Reboul, Cyril; Smith, A. Ian; Pike, Robert N.; Rood, Julian I.; Whisstock, James C.; Porter, Corrine J.

    2011-01-01

    The ovine footrot pathogen, Dichelobacter nodosus, secretes three subtilisin-like proteases that play an important role in the pathogenesis of footrot through their ability to mediate tissue destruction. Virulent and benign strains of D. nodosus secrete the basic proteases BprV and BprB, respectively, with the catalytic domain of these enzymes having 96% sequence identity. At present, it is not known how sequence variation between these two putative virulence factors influences their respective biological activity. We have determined the high resolution crystal structures of BprV and BprB. These data reveal that that the S1 pocket of BprV is more hydrophobic but smaller than that of BprB. We show that BprV is more effective than BprB in degrading extracellular matrix components of the host tissue. Mutation of two residues around the S1 pocket of BprB to the equivalent residues in BprV dramatically enhanced its proteolytic activity against elastin substrates. Application of a novel approach for profiling substrate specificity, the Rapid Endopeptidase Profiling Library (REPLi) method, revealed that both enzymes prefer cleaving after hydrophobic residues (and in particular P1 leucine) but that BprV has more restricted primary substrate specificity than BprB. Furthermore, for P1 Leu-containing substrates we found that BprV is a significantly more efficient enzyme than BprB. Collectively, these data illuminate how subtle changes in D. nodosus proteases may significantly influence tissue destruction as part of the ovine footrot pathogenesis process. PMID:21990366

  19. spo(2|2-Equivariant Quantizations on the Supercircle S^{1|2}

    Directory of Open Access Journals (Sweden)

    Najla Mellouli

    2013-08-01

    Full Text Available We consider the space of differential operators $mathcal{D}_{lambdamu}$ acting between$lambda$- and $mu$-densities defined on $S^{1|2}$ endowed with its standard contact structure.This contact structure allows one to define a filtration on $mathcal{D}_{lambdamu}$ which is finerthan the classical one, obtained by writting a differential operator in terms of the partial derivativeswith respect to the different coordinates.The space $mathcal{D}_{lambdamu}$ and the associated graded space of symbols $mathcal{S}_{delta}$($delta=mu-lambda$ can be considered as $mathfrak{spo}(2|2$-modules, where $mathfrak{spo}(2|2$ isthe Lie superalgebra of contact projective vector fields on $S^{1|2}$.We show in this paper that there is a unique isomorphism of $mathfrak{spo}(2|2$-modules between$mathcal{S}_{delta}$ and $mathcal{D}_{lambdamu}$ that preserves the principal symbol (i.e.an $mathfrak{spo}(2|2$-equivariant quantization for some values of $delta$ called non-critical values.Moreover, we give an explicit formula for this isomorphism, extending in this way the resultsof [Mellouli N., SIGMA 5 (2009, 111, 11 pages] which were established for second-order differential operators.The method used here to build the $mathfrak{spo}(2|2$-equivariant quantization is the same as the oneused in [Mathonet P., Radoux F., Lett. Math. Phys. 98 (2011, 311-331] to prove the existence of a $mathfrak{pgl}(p+1|q$-equivariant quantization on$mathbb{R}^{p|q}$.

  20. Peningkatan Kemampuan Berpikir Statistis Mahasiswa S1 Melalui Pembelajaran MEAs yang Dimodifikasi

    Directory of Open Access Journals (Sweden)

    Bambang Avip Priatna Martadiputra

    2012-02-01

    Full Text Available This paper contains the results of research on improving the ability to think statisis S1 students through the learning model-eliciting Activities (MEAs are modified from the MEAs that have been developed by Garfield, Delmas and Zieffler (2010 by entering the didactical Design Research (DDR when creating instructional materials , In this research, quasi experimental method with a pretest-posttest design. Research carried out on all students S1 Department of Mathematics Education of a State in Bandung who are following the lecture Basic Statistics on odd semester of 2011/2012 academic year. In the control class (class A student Pend Prodi. Mat force 2010/2011 39 were given conventional learning while the experimental class 1 (student of class B Prodi Pend. Mat force 2010/2011 41 people and the experimental class 2 (student Prodi Pend. Mat force repeating 2008/2009 Basic Statistics 12 persons were given a modified learning MEAs. Furthermore, in each class, the students were divided into three groups: high, medium and low based on a score initial capability test results statistically (TKAS. Data on statistical thinking skills students thinking skills obtained through statistical tests (TKBS, while the disposition of the statistical data is obtained by using scale student disposition. The results showed that there are differences in the increase in the ability to think statistically significant student between the control class, the experimental class 1 and class experiment 2. Increased statistical thinking skills students use learning MEAs modified significantly higher compared to students using conventional teaching. There are differences increase student statistically significant disposition between the control class, the experimental class 1 and class experiment 2. Improved statistical disposition of students who use the learning MEAs modified significantly higher compared to students using conventional teaching.

  1. Characterization of S1 nuclease sensitive site at transcription initiation region of Attacus ricini rDNA

    Institute of Scientific and Technical Information of China (English)

    何明亮; 赵慕钧; 靳嘉瑞; 李载平

    1997-01-01

    A single-stranded S1 nuclease hypersensitive site which contains a d(AT)18 sequence structure locat-ed in the 5 -non transcription spacer of silkworm A . ricini ribosomal RNA gene has been reported[1] Using starved-refed silkworms, another S1 nuclease sensitive site was found existing in the rDNA chromatin, while under merely starving, this S1 sensitive site disappeared[2] . Recently this inducible S1 sensitive site has been further determined. It consists of a d(GT)10-d(AT)10 special DNA sequence at the transcription initiation region, and shows a behavior of ease in DNA-unwinding, indicating that S1 nuclease sensitive sites may have an important function in the regulation of rDNA transcription and replication.

  2. 爱普生投影机家族再添生力军EMP-S1H

    Institute of Scientific and Technical Information of China (English)

    王颖

    2004-01-01

    @@ 继市场反馈效果非常好的EMP-S1之后,爱普生公司全新推出其的加强版机型--EMP-S1H.此款新机型不但保留了原有EMP-S1的诸多强项,而且专门针对商务使用时较常出现的问题渗入更完善的技术解决与设计理念,从而打造出功能更强大的实用商务投影机EMP-S1H.不相信么?看看以下问题EMP-S1H是如何解决的吧!

  3. Development and immunogenicity of recombinant GapA(+) Mycoplasma gallisepticum vaccine strain ts-11 expressing infectious bronchitis virus-S1 glycoprotein and chicken interleukin-6.

    Science.gov (United States)

    Shil, Pollob K; Kanci, Anna; Browning, Glenn F; Markham, Philip F

    2011-04-12

    Mycoplasma gallisepticum (MG) is a major pathogen of poultry that causes chronic respiratory disease in chickens and infectious sinusitis in turkeys. A live attenuated vaccine, ts-11, has been used for the control of MG in several countries. The efficacy of this vaccine is highly dose dependent and the flock antibody response is weak. To improve the functionality of the vaccine and investigate its potential as a delivery vector for foreign antigens and immunomodulatory proteins, we developed a derivative of ts-11 expressing infectious bronchitis virus-S1 glycoprotein (IBV-S1) and releasing chicken interleukin-6 into the extracellular milieu (MG ts-11 C3 (+CS)) using a transposon-based delivery vector. Following administration of MG ts-11 C3 (+CS) to chickens by eye-drop, an antibody response to MG and IBV-S1, as determined by the rapid serum agglutination test (RSA) and Western blotting, respectively, could be detected. Birds inoculated with the recombinant vaccine had significantly enhanced weight gain and were partially protected against damage by pathogenic IBV. These results indicate that the ChIL-6 released by MG ts-11 C3 (+CS) may have had a non-specific effect on growth rate. They also suggest that ts-11 is a promising vaccine vector, capable of delivering heterologous protective antigens, and may also provide non-specific benefits when engineered to express immunomodulatory proteins. With some improvements in the expression system, it could be used to induce a targeted immune response against specific mucosal pathogens, and co-expression of several antigens would allow development of a novel multivalent vaccine.

  4. Protein: FBA3 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBA3 Atg8 conjugation sysytem Map1lc3b Map1alc3, Map1lc3 MAP1LC3B Microtubule-associated protein...s 1A/1B light chain 3B Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifi...er LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associated protein 1 l

  5. TRAPPIST monitoring of comets C/2012 S1 (ISON) and C/2013 R1 (Lovejoy)

    Science.gov (United States)

    Opitom, C.; Jehin, E.; Manfroid, J.; Hutsemékers, D.; Gillon, M.

    2014-07-01

    We present the results of a dense photometric monitoring of comets C/2012 S1 (Ison) and C/2013 R1 (Lovejoy) using narrow-band cometary filters and the 60-cm TRAPPIST robotic telescope [1]. We were able to isolate the emission of the OH, NH, CN, C_2, and C_3 radicals for both comets as well as the dust continuum in four bands. By applying a Haser model [2] and fitting the observed profiles, we derive gas production rates. From the continuum bands, we computed the dust Afρ parameters [3]. We were able to follow the evolution of the gas and dust activity of these comets for weeks, looking for changes with the heliocentric distance, study the coma morphology, and analyze their composition and dust coma properties. Comet C/2012 S1 (ISON) was observed about three times a week from October 12 (r=1.43 au) to November 23, 2013. It was then at a heliocentric distance of 0.33 au, only five days before perihelion, when it disintegrated. This dense monitoring allowed us to detect fast changes of the cometary activity. We observed a slowly rising activity in October and early November, and two major outbursts around November 13 and November 19 [4], the gas and dust production rates being multiplied by at least a factor of five during each outburst and then slowly decreasing in the following days. These outbursts were correlated with changes in gas-production-rate ratios. The coma morphology study revealed strong jets in both gas and dust filters. Since the comet was very active in November, we were even able to detect OH jets in our images. Comet C/2013 R1 (Lovejoy) was observed before perihelion from September 9 (r=1.94 au) to November 16 (r=1.12 au), 2013 when the comet was too far North. We recovered the comet post-perihelion on February 13 (r=1.24 au), 2014 and planned to observe it until May (r=2.5 au) with narrow-band filters. We compare the evolution of gas and dust activity as well as the evolution of gas production rates ratios on both sides of perihelion. The

  6. Dynamic Cross Talk between S1P and CXCL12 Regulates Hematopoietic Stem Cells Migration, Development and Bone Remodeling

    Directory of Open Access Journals (Sweden)

    Karin Golan

    2013-09-01

    Full Text Available Hematopoietic stem cells (HSCs are mostly retained in a quiescent non-motile mode in their bone marrow (BM niches, shifting to a migratory cycling and differentiating state to replenish the blood with mature leukocytes on demand. The balance between the major chemo-attractants CXCL12, predominantly in the BM, and S1P, mainly in the blood, dynamically regulates HSC recruitment to the circulation versus their retention in the BM. During alarm situations, stress-signals induce a decrease in CXCL12 levels in the BM, while S1P levels are rapidly and transiently increased in the circulation, thus favoring mobilization of stem cells as part of host defense and repair mechanisms. Myeloid cytokines, including G-CSF, up-regulate S1P signaling in the BM via the PI3K pathway. Induced CXCL12 secretion from stromal cells via reactive oxygen species (ROS generation and increased S1P1 expression and ROS signaling in HSCs, all facilitate mobilization. Bone turnover is also modulated by both CXCL12 and S1P, regulating the dynamic BM stromal microenvironment, osteoclasts and stem cell niches which all functionally express CXCL12 and S1P receptors. Overall, CXCL12 and S1P levels in the BM and circulation are synchronized to mutually control HSC motility, leukocyte production and osteoclast/osteoblast bone turnover during homeostasis and stress situations.

  7. Transcriptional targeting of sphingosine-1- phosphate receptor S1P2 by epigallocatechin- 3-gallate prevents sphingosine-1-phosphate- mediated signaling in macrophage-differentiated HL-60 promyelomonocytic leukemia cells

    Directory of Open Access Journals (Sweden)

    Chokor R

    2014-05-01

    Full Text Available Rima Chokor, Sylvie Lamy, Borhane AnnabiLaboratoire d'Oncologie Moléculaire, Centre de recherche BIOMED, Département de Chimie, Université du Québec à Montréal, Montreal, QC, CanadaBackground: Macrophage chemotaxis followed by blood–brain barrier transendothelial migration is believed to be associated with inflammation in the central nervous system. Antineuroinflammatory strategies have identified the dietary-derived epigallocatechin-3-gallate (EGCG as an efficient agent to prevent neuroinflammation-associated neurodegenerative diseases by targeting proinflammatory mediator signaling.Methods: Given that high levels of sphingosine kinase and its product, sphingosine-1-phosphate (S1P, are present in brain tumors, we used quantitative reverse-transcription polymerase chain reaction (qRT-PCR and immunoblotting to test whether EGCG may impact on S1P receptor gene expression and prevent S1P response in undifferentiated and in terminally differentiated macrophages.Results: Promyelomonocytic human leukemia (HL-60 cells were differentiated into macrophages, and S1P triggered phosphorylation in extracellular signal-regulated kinase (ERK, c-Jun N-terminal kinase (JNK, and P38 mitogen-activated protein kinase (MAPK intracellular signaling, as shown by Western blot analysis. Pretreatment of cells with EGCG prior to differentiation inhibited the response to S1P in all three pathways, while EGCG abrogated P38 MAPK phosphorylation when present only during differentiation. Terminally-differentiated macrophages were, however, insensitive to EGCG treatment. Using qRT-PCR, gene expression of the S1P receptors S1P1, S1P2, and S1P5 was predominantly induced in terminally-differentiated macrophages, while the S1P2 was decreased by EGCG treatment.Conclusion: Our data suggest that diet-derived EGCG achieves efficient effects as a preventive agent, targeting signaling pathways prior to cell terminal differentiation. Such properties could impact on cell chemotaxis

  8. A Shift in ApoM/S1P Between HDL-Particles in Women With Type 1 Diabetes Mellitus Is Associated With Impaired Anti-Inflammatory Effects of the ApoM/S1P Complex.

    Science.gov (United States)

    Frej, Cecilia; Mendez, Armando J; Ruiz, Mario; Castillo, Melanie; Hughes, Thomas A; Dahlbäck, Björn; Goldberg, Ronald B

    2017-06-01

    Type 1 diabetes mellitus (T1D) patients have an increased risk of cardiovascular disease despite high levels of high-density lipoproteins (HDL). Apolipoprotein M (apoM) and its ligand sphingosine 1-phospate (S1P) exert many of the anti-inflammatory effects of HDL. We investigated whether apoM and S1P are altered in T1D and whether apoM and S1P are important for HDL functionality in T1D. ApoM and S1P were quantified in plasma from 42 healthy controls and 89 T1D patients. HDL was isolated from plasma and separated into dense, medium-dense, and light HDL by ultracentrifugation. Primary human aortic endothelial cells were challenged with tumor necrosis factor-α in the presence or absence of isolated HDL. Proinflammatory adhesion molecules E-selectin and vascular cellular adhesion molecule-1 were quantified by flow cytometry. Activation of the S1P1- receptor was evaluated by analyzing downstream signaling targets and receptor internalization. There were no differences in plasma levels of apoM and S1P between controls and T1D patients, but the apoM/S1P complexes were shifted from dense to light HDL particles in T1D. ApoM/S1P in light HDL particles from women were less efficient in inhibiting expression of vascular cellular adhesion molecule-1 than apoM/S1P in denser particles. The light HDL particles were unable to activate Akt, whereas all HDL subfractions were equally efficient in activating Erk and receptor internalization. ApoM/S1P in light HDL particles were inefficient in inhibiting tumor necrosis factor-α-induced vascular cellular adhesion molecule-1 expression in contrast to apoM/S1P in denser HDL particles. T1D patients have a higher proportion of light particles and hence more dysfunctional HDL, which could contribute to the increased cardiovascular disease risk associated with T1D. © 2017 American Heart Association, Inc.

  9. Severe adverse effects of 5-fluorouracil in S-1 were lessened by haemodialysis due to elimination of the drug.

    Science.gov (United States)

    Inoue, Kazunori; Nagasawa, Yasuyuki; Yamamoto, Ryohei; Omori, Hiroki; Kimura, Tomonori; Tomida, Kodo; Furumatsu, Yoshiyuki; Imai, Enyu; Isaka, Yoshitaka; Rakugi, Hiromi

    2009-04-01

    S-1 and cisplatin are used as one of the first-line chemotherapies for gastric cancer in Japan. The plasma concentration of 5-fluorouracil (5-FU) is increased in patients with renal dysfunction because gimeracil in S-1 inhibits the degradation of 5-FU and about 50% of gimeracil is excreted in the urine. We describe a 35-year-old man with acute kidney injury while taking S-1 and cisplatin for advanced gastric cancer and who presented severe adverse effects of 5-FU. This case report describes the evolution of the plasma concentrations of 5-FU with haemodialysis along with a decrease in the adverse drug effects.

  10. Electronically induced contrast enhancement in whisker S1 cortical response fields.

    Science.gov (United States)

    von Kraus, Lee M; Francis, Joseph T

    2014-01-01

    The ability of an organism to specifically attend to relevant sensory information during learning and subsequent performance of a task is highly dependent on the release of the neurotransmitter Acetylcholine (ACh). Electrophysiological studies have shown that pairing endogenous ACh with specific visual or auditory stimuli induces long lasting enhancements of subsequent cortical responses to the previously paired stimulus. In this study we present data suggesting that similar effects can be elicited in the rat whisker sensory system. Specifically, we show that pairing whisker deflection with electrical stimulation of the magnocellular basal nucleus (BN: a natural source of cortical ACh) causes an increase in the center-surround contrast of the treated whisker's cortical response field (CRF). Meanwhile, deflections of whiskers distant from the treated whisker show overall increased response magnitudes, but non-significant changes in contrast between principle vs. surround barrel responses. Control trials, in which BN stimulation was not paired with whisker deflection, showed similar lack of contrast enhancement. These results indicate that BN stimulation, paired with incoming whisker information, selectively increases the paired whisker's CRF center-surround contrast, while unpaired BN stimulation causes a more general increases in S1 responsiveness, without contrast modulation. Enhanced control over whisker sensory pathway attentional mechanisms has the potential to facilitate a more effective transfer of desired information to the animal's neural processing circuitry, thereby allowing experimental evaluation of more complex behavior and cognition than was previously possible.

  11. Constraints on the S=-1 meson-baryon interaction at NLO

    Science.gov (United States)

    Feijoo, A.; Magas, V. K.; Ramos, A.

    2017-03-01

    This work contains a study of the meson-baryon interaction in the S = -1 sector by means of a chiral SU(3) Lagrangian up to next-to-leading order (NLO) and implementing unitarization in coupled channels. In order to get more reliable values of the parameters which are present in the model, we performed several fits which take a large set of experimental scattering data in different two-body channels, threshold branching ratios, and the precise SIDDHARTA values of the energy shift and width of kaonic hidrogen into consideration. In previous studies, we had shown that the K- p → KΞ reactions are especially sensitive to the next to Weinberg-Tomozawa (WT) corrections in the hierarchy. In addition, we pointed out the need to employ processes which are described by pure isospin amplitudes as a tool to discern which models are more realistic among those which give small values for the χ2 in the fits. Following the former suggestion, we present results which include data from K- p → ηΛ, ηΣ reactions which have pure isospin I = 0 and I = 1 component respectively. Finally, to check the goodness of the new obtained parametrization of the model, we present a prediction for another process that filters the I = 1 isospin component: the pure I = 1 K_L^ - p \\to {K^ + }{Ξ^0} reaction which could be measured at the proposed secondary K0L beam at Jlab.

  12. Final report on the regional supplementary comparison APMP.AUV.A-S1

    Science.gov (United States)

    Plangsangmas, Virat; Leeudomwong, Surat; Scott, Andrew; Zhong, Bo; Huang, Yuchung

    2014-01-01

    A regional supplementary comparison APMP.AUV.A-S1 has been carried out for the measurement of sound pressure level, frequency and total distortion of a multi-frequency sound calibrator. The role of the Pilot laboratory was undertaken by the National Institute of Metrology (Thailand) (NIMT). The multi-frequency sound calibrator was circulated through thirteen National Metrology Institutes (NMIs). Two NMIs were added to the original time schedule after starting the circulation. The measurements took place between September 2008 and July 2010. This report includes the measurement results from all the participants. Supplementary Comparison Reference Values (SCRVs) have been determined from the results. Deviations from the SCRVs are mostly within declared expanded uncertainties. It has been found that a term for the inherent instability in this type of device needs to be included in any uncertainty budget, and a recommended minimum value of this has been given. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCAUV, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  13. Monte carlo simulation study of the square lattice S=1/2 quantum heisenberg antiferromagnet

    CERN Document Server

    Kim, J K

    1999-01-01

    For the two dimensional S= 1/2 isotopic quantum Heisenberg antiferromagnet on a square lattice, we report our results of an extensive quantum Monte Carlo simulation for various physical observables such as the correlation length xi, the staggered magnetic susceptibility chi sub S sub T , the structure factor peak value S(Q), the internal energy epsilon, and the uniform susceptibility chi sub u. We find that chi sub S sub T approx chi sup 2 T and S(Q) approx xi sup 2 T sup 2 , in agreement with the predictions of the conventional theory but in disagreement with recent experiments. Our estimate of the spin stiffness constant rho sub s and spin wave velocity c, from the low temperature behavior of the chi sub u is shown to be consistent with the theoretical prediction of the low temperature behavior of the epsilon, and of the xi provided an additional correction up to T sup 2. However, our data are definitely inconsistent with the scenario of the crossover for the xi.

  14. Extending the Family of V(4+) S=(1/2) Kagome Antiferromagnets.

    Science.gov (United States)

    Clark, Lucy; Aidoudi, Farida H; Black, Cameron; Arachchige, Kasun S A; Slawin, Alexandra M Z; Morris, Russell E; Lightfoot, Philip

    2015-12-14

    The ionothermal synthesis, structure, and magnetic susceptibility of a novel inorganic-organic hybrid material, imidazolium vanadium(III,IV) oxyfluoride [C3 H5 N2 ][V9 O6 F24 (H2 O)2 ] (ImVOF) are presented. The structure consists of inorganic vanadium oxyfluoride slabs with kagome layers of V(4+) S=${{ 1/2 }}$ ions separated by a mixed valence layer. These inorganic slabs are intercalated with imidazolium cations. Quinuclidinium (Q) and pyrazinium (Pyz) cations can also be incorporated into the hybrid structure type to give QVOF and PyzVOF analogues, respectively. The highly frustrated topology of the inorganic slabs, along with the quantum nature of the magnetism associated with V(4+) , means that these materials are excellent candidates to host exotic magnetic ground states, such as the highly sought quantum spin liquid. Magnetic susceptibility measurements of all samples suggest an absence of conventional long-range magnetic order down to 2 K despite considerable antiferromagnetic exchange.

  15. Results from the Worldwide Coma Morphology Campaign for Comet ISON (C/2012 S1)

    CERN Document Server

    Samarasinha, Nalin H

    2015-01-01

    We present the results of a global coma morphology campaign for comet C/2012 S1 (ISON), which was organized to involve both professional and amateur observers. In response to the campaign, many hundreds of images, from nearly two dozen groups were collected. Images were taken primarily in the continuum, which help to characterize the behavior of dust in the coma of comet ISON. The campaign received images from January 12 through November 22, 2013 (an interval over which the heliocentric distance decreased from 5.1 AU to 0.35 AU), allowing monitoring of the long-term evolution of coma morphology during the pre-perihelion leg of comet ISON. Data were contributed by observers spread around the world, resulting in particularly good temporal coverage during November when comet ISON was brightest but its visibility was limited from any one location due to the small solar elongation. We analyze the northwestern sunward continuum coma feature observed in comet ISON during the first half of 2013, finding that it was l...

  16. Effect of prosthesis endplate lordosis angles on L5-S1 kinematics after disc arthroplasty.

    Science.gov (United States)

    Tsitsopoulos, Parmenion P; Wojewnik, Bartosz; Voronov, Leonard I; Havey, Robert M; Renner, Susan M; Zelenakova, Julia; McIntosh, Braden; Carandang, Gerard; Abjornson, Celeste; Patwardhan, Avinash G

    2012-06-01

    We hypothesized that L5-S1 kinematics will not be affected by the lordosis distribution between the prosthesis endplates. Twelve cadaveric lumbosacral spines (51.3 ± 9.8 years) were implanted with 6° or 11° prostheses (ProDisc-L) with four combinations of superior/inferior lordosis (6°/0°, 3°/3°, 11°/0°, 3°/8°). Specimens were tested intact and after prostheses implantation with different lordosis distributions. Center of rotation (COR) and range of motion (ROM) were quantified. Six-degree lordosis prostheses (n = 7) showed no difference in flexion-extension ROM, regardless of design (6°/0° or 3°/3°) (p > 0.05). In lateral bending (LB), both designs reduced ROM (p lordosis prostheses (n = 5) showed no difference in flexion-extension ROM for either design (p > 0.05). LB ROM decreased with distributed lordosis prostheses (3°/8°) (p lordosis distribution among the two prosthesis endplates. The ProDisc-L prosthesis design where all lordosis is concentrated in the superior endplate yielded COR locations that were anterior and caudal to intact controls. The prosthesis with lordosis distributed between the two endplates yielded a COR that tended to be closer to intact. Further clinical and biomechanical studies are needed to assess the long-term impact of lordosis angle distribution on the fate of the facet joints.

  17. Form factors of descendant operators: Reduction to perturbed $M(2,2s+1)$ models

    CERN Document Server

    Lashkevich, Michael

    2014-01-01

    In the framework of the algebraic approach to form factors in two-dimensional integrable models of quantum field theory we consider the reduction of the sine-Gordon model to the $\\Phi_{13}$\\=/perturbation of minimal conformal models of the $M(2,2s+1)$ series. We find in an algebraic form the condition of compatibility of local operators with the reduction. We propose a construction that make it possible to obtain reduction compatible local operators in terms of screening currents. As an application we obtain exact multiparticle form factors for the compatible with the reduction conserved currents $T_{\\pm2k}$, $\\Theta_{\\pm(2k-2)}$, which correspond to the spin $\\pm(2k-1)$ integrals of motion, for any positive integer~$k$. Furthermore, we obtain all form factors of the operators $T_{2k}T_{-2l}$, which generalize the famous $T\\bar T$ operator. The construction is analytic in the $s$ parameter and, therefore, makes sense in the sine-Gordon theory.

  18. Observation of an Exotic Baryon with S=+1 in Photoproduction from the Proton

    CERN Document Server

    Kubarovski, V; Weygand, D P; Stoler, P; Battaglieri, M; De Vita, R; Adams, G; Ji Li; Nozar, M; Salgado, C; Ambrozewicz, P; Anciant, E; Anghinolfi, M; Asavapibhop, B; Audit, G; Auger, T; Avakian, H; Bagdasaryan, H; Ball, J P; Barrow, S; Beard, K; Bektasoglu, M; Bellis, M; Benmouna, N; Berman, B L; Bianchi, N; Biselli, A S; Boiarinov, S; Bouchigny, S; Bradford, R; Branford, D; Briscoe, W J; Brooks, W K; Burkert, V D; Butuceanu, C; Calarco, J R; Carman, D S; Carnahan, B; Cetina, C; Chen, S; Ciciani, L; Cole, P L; Connelly, J; Cords, D; Corvisiero, P; Crabb, D; Crannell, H; Cummings, J P; De Sanctis, E; Degtyarenko, P V; Denizli, H; Dennis, L; Dharmawardane, K V; Djalali, C; Dodge, G E; Doughty, D; Dragovitsch, P; Dugger, M; Dytman, S; Dzyubak, O P; Egiyan, H; Egiyan, K S; Elouadrhiri, L; Empl, A; Eugenio, P; Farhi, L; Fatemi, R; Feuerbach, R J; Ficenec, J; Forest, T A; Frolov, V; Funsten, H; Gaff, S J; Garçon, M; Gavalian, G; Gilfoyle, G P; Giovanetti, K L; Girard, P; Gothe, R W; Gordon, C I O; Griffioen, K; Guidal, M; Guillo, M R; Gyurjyan, V; Hadjidakis, C; Hakobyan, R S; Hancock, D; Hardie, J; Heddle, D; Heimberg, P; Hersman, F W; Hicks, K; Holtrop, M; Hu, J; Hyde-Wright, C E; Ilieva, Y; Ito, M M; Jenkins, D; Joo, K; Jüngst, H G; Kelley, J H; Khandaker, M; Kim, K Y; Kim, K; Kim, W; Klein, F J; Klimenko, A V; Klusman, M; Kossov, M; Kramer, L H; Kuhn, S E; Kühn, J; Lachniet, J; Laget, J M; Langheinrich, J; Lawrence, D; Longhi, A; Lukashin, K; Major, R W; Manak, J J; Marchand, C; McAleer, S; McNabb, J W C; Mecking, B A; Mehrabyan, S S; Melone, J J; Mestayer, M D; Meyer, C A; Mikhailov, K; Minehart, R C; Mirazita, M; Miskimen, R; Mokeev, V; Morand, L; Morrow, S A; Mozer, M U; Muccifora, V; Müller, J; Mutchler, G S; Napolitano, J; Nasseripour, R; Nelson, S O; Niccolai, S; Niculescu, G; Niculescu, I; Niczyporuk, B B; Niyazov, R A; O'Brien, J T; O'Rielly, G V; Opper, A K; Osipenko, M; Park, K; Pasyuk, E A; Peterson, G; Philips, S A; Pivnyuk, N; Pocanic, D; Pogorelko, O I; Polli, E; Pozdniakov, S; Preedom, B M; Price, J W; Prok, Y; Protopopescu, D; Qin, L M; Raue, B A; Riccardi, G; Ripani, M; Ritchie, B G; Ronchetti, F; Rossi, P; Rowntree, D; Rubin, P D; Sabatie, F; Sabourov, K; Santoro, J P; Sapunenko, V; Sargsyan, M; Schumacher, R A; Serov, V S; Shafi, A; Sharabyan, Yu G; Shaw, J; Simionatto, S; Skabelin, A V; Smith, E S; Smith, T; Smith, L C; Sober, D I; Spraker, M; Stavinsky, A V; Stepanyan, S; Strakovsky, I I; Strauch, S; Taiuti, M; Taylor, S; Tedeschi, D J; Thoma, U; Thompson, R; Todor, L; Tur, C; Ungaro, M; Vineyard, M F; Vlassov, A V; Wang, K; Weinstein, L B; Weisberg, A; Whisnant, C S; Wolin, E; Wood, M H; Yegneswaran, A; Yun, J

    2004-01-01

    The reaction $\\gamma p \\to \\pi^+K^-K^+n$ was studied at Jefferson Lab using a tagged photon beam with an energy range of 3-5.47 GeV. A narrow baryon state with strangeness S=+1 and mass $M=1555\\pm 10$ MeV/c$^2$ was observed in the $nK^+$ invariant mass spectrum. The peak's width is consistent with the CLAS resolution (FWHM=26 MeV/c$^2$), and its statistical significance is 7.8 $\\pm$ 1.0 ~$\\sigma$. A baryon with positive strangeness has exotic structure and cannot be described in the framework of the naive constituent quark model. The state is consistent with the mass predicted by a chiral soliton model \\cite{Diakonov} for 5-quark baryon states. In addition, the $pK^+$ invariant mass distribution was analyzed in the reaction $\\gamma p\\to K^-K^+p$ with high statistics in search of doubly-charged exotic baryon states. No resonance structures were found in this spectrum.

  19. Activity of a peptidase secreted by Phanerochaete chrysosporium depends on lysine to subsite S'1.

    Science.gov (United States)

    da Silva, Ronivaldo Rodrigues; de Oliveira, Lilian Caroline Gonçalves; Juliano, Maria Aparecida; Juliano, Luiz; Rosa, Jose C; Cabral, Hamilton

    2017-01-01

    Peptidases are enzymes that catalyze the rupture of peptide bonds. Catalytic specificity studies of these enzymes have illuminated their modes of action and preferred hydrolysis targets. We describe the biochemical characteristics and catalytic specificity of a lysine-dependent peptidase secreted by the basidiomycete fungus Phanerochaete chrysosporium. We attained 5.7-fold purification of a ∼23-kDa neutral peptidase using size-exclusion (Sephadex G-50 resin) and ion-exchange (Source 15S resin) chromatography. Using the Fluorescence Resonance Energy Transfer substrate Abz-KLRSSKQ-EDDnp, we detected maximal activity at pH 7.0 and 45-55°C. The peptidase retained ∼80% of its enzymatic activity for a wide range of conditions (pH 4-9; temperatures up to 50°C for 1h). The peptidase activity was lowered by the ionic surfactants, sodium dodecyl sulfate and cetyltrimethylammonium bromide; the reducing agent, dithiothreitol; the chaotrope, guanidine; copper (II) ion; and the cysteine peptidase-specific inhibitors, iodoacetic acid and N-ethylmaleimide. The peptidase preferred the basic amino acids K and R and high selectivity on S'1 subsite, exhibiting a condition of lysine-dependence to catalysis on anchoring of this subsite. Copyright © 2016 Elsevier B.V. All rights reserved.

  20. {J}/{ψ} production in p overlinep collisions at s = 1.8 TeV

    Science.gov (United States)

    Abachi, S.; Abbott, B.; Abolins, M.; Acharya, B. S.; Adam, I.; Adams, D. L.; Adams, M.; Ahn, S.; Aihara, H.; Alitti, J.; Álvarez, G.; Alves, G. A.; Amidi, E.; Amos, N.; Anderson, E. W.; Aronson, S. H.; Astur, R.; Avery, R. E.; Baden, A.; Balamurali, V.; Balderston, J.; Baldin, B.; Bantly, J.; Bartlett, J. F.; Bazizi, K.; Bendich, J.; Beri, S. B.; Bertram, I.; Bezzubov, V. A.; Bhat, P. C.; Bhatnagar, V.; Bhattacharjee, M.; Bischoff, A.; Biswas, N.; Blazey, G.; Blessing, S.; Bloom, P.; Boehnlein, A.; Bojko, N. I.; Borcherding, F.; Borders, J.; Boswell, C.; Brandt, A.; Brock, R.; Bross, A.; Buchholz, D.; Burtovoi, V. S.; Butler, J. M.; Carvalho, W.; Casey, D.; Castilla-Valdez, H.; Chakraborty, D.; Chang, S.-M.; Chekulaev, S. V.; Chen, L.-P.; Chen, W.; Chopra, S.; Choudhary, B. C.; Christenson, J. H.; Chung, M.; Claes, D.; Clark, A. R.; Cobau, W. G.; Cochran, J.; Cooper, W. E.; Cretsinger, C.; Cullen-Vidal, D.; Cummings, M. A. C.; Cutts, D.; Dahl, O. I.; De, K.; Demarteau, M.; Demina, R.; Denisenko, K.; Denisenko, N.; Denisov, D.; Denisov, S. P.; Diehl, H. T.; Diesburg, M.; Di Loreto, G.; Dixon, R.; Draper, P.; Drinkard, J.; Ducros, Y.; Dugad, S. R.; Durston-Johnson, S.; Edmunds, D.; Ellison, J.; Elvira, V. D.; Engelmann, R.; Eno, S.; Eppley, G.; Ermolov, P.; Eroshin, O. V.; Evdokimov, V. N.; Fahey, S.; Fahland, T.; Fatyga, M.; Fatyga, M. K.; Featherly, J.; Feher, S.; Fein, D.; Ferbel, T.; Finocchiaro, G.; Fisk, H. E.; Fisyak, Y.; Flattum, E.; Forden, G. E.; Fortner, M.; Frame, K. C.; Franzini, P.; Fuess, S.; Gallas, E.; Galyaev, A. N.; Geld, T. L.; Genik, R. J.; Genser, K.; Gerber, C. E.; Gibbard, B.; Glebov, V.; Glenn, S.; Glicenstein, J. F.; Gobbi, B.; Goforth, M.; Goldschmidt, A.; Gómez, B.; Goncharov, P. I.; González Solís, J. L.; Gordon, H.; Goss, L. T.; Graf, N.; Grannis, P. D.; Green, D. R.; Green, J.; Greenlee, H.; Griffin, G.; Grossman, N.; Grudberg, P.; Grünendahl, S.; Gu, W. X.; Guglielmo, G.; Guida, J. A.; Guida, J. M.; Guryn, W.; Gurzhiev, S. N.; Gutierrez, P.; Gutnikov, Y. E.; Hadley, N. J.; Haggerty, H.; Hagopian, S.; Hagopian, V.; Hahn, K. S.; Hall, R. E.; Hansen, S.; Hatcher, R.; Hauptman, J. M.; Hedin, D.; Heinson, A. P.; Heintz, U.; Hernández-Montoya, R.; Heuring, T.; Hirosky, R.; Hobbs, J. D.; Hoeneisen, B.; Hoftun, J. S.; Hsieh, F.; Hu, Tao; Hu, Ting; Hu, Tong; Huehn, T.; Igarashi, S.; Ito, A. S.; James, E.; Jaques, J.; Jerger, S. A.; Jiang, J. Z.-Y.; Joffe-Minor, T.; Johari, H.; Johns, K.; Johnson, M.; Johnstad, H.; Jonckheere, A.; Jones, M.; Jöstlein, H.; Jun, S. Y.; Jung, C. K.; Kahn, S.; Kalbfleisch, G.; Kang, J. S.; Kehoe, R.; Kelly, M. L.; Kerth, L.; Kim, C. L.; Kim, S. K.; Klatchko, A.; Klima, B.; Klochkov, B. I.; Klopfenstein, C.; Klyukhin, V. I.; Kochetkov, V. I.; Kohli, J. M.; Koltick, D.; Kostritskiy, A. V.; Kotcher, J.; Kourlas, J.; Kozelov, A. V.; Kozlovski, E. A.; Krishnaswamy, M. R.; Krzywdzinski, S.; Kunori, S.; Lami, S.; Landsberg, G.; Lebrat, J.-F.; Leflat, A.; Li, H.; Li, J.; Li, Y. K.; Li-Demarteau, Q. Z.; Lima, J. G. R.; Lincoln, D.; Linn, S. L.; Linnemann, J.; Lipton, R.; Liu, Y. C.; Lobkowicz, F.; Loken, S. C.; Lökös, S.; Lueking, L.; Lyon, A. L.; Maciel, A. K. A.; Madaras, R. J.; Madden, R.; Mani, S.; Mao, H. S.; Margulies, S.; Markeloff, R.; Markosky, L.; Marshall, T.; Martin, M. I.; Marx, M.; May, B.; Mayorov, A. A.; McCarthy, R.; McKibben, T.; McKinley, J.; McMahon, T.; Melanson, H. L.; de Mello Neto, J. R. T.; Merritt, K. W.; Miettinen, H.; Mincer, A.; de Miranda, J. M.; Mishra, C. S.; Mohammadi-Baarmand, M.; Mokhov, N.; Mondal, N. K.; Montgomery, H. E.; Mooney, P.; da Motta, H.; Mudan, M.; Murphy, C.; Murphy, C. T.; Nang, F.; Narain, M.; Narasimham, V. S.; Narayanan, A.; Neal, H. A.; Negret, J. P.; Neis, E.; Nemethy, P.; Nešić, D.; Nicola, M.; Norman, D.; Oesch, L.; Oguri, V.; Oltman, E.; Oshima, N.; Owen, D.; Padley, P.; Pang, M.; Para, A.; Park, C. H.; Park, Y. M.; Partridge, R.; Parua, N.; Paterno, M.; Perkins, J.; Peryshkin, A.; Peters, M.; Piekarz, H.; Pischalnikov, Y.; Podstavkov, V. M.; Pope, B. G.; Prosper, H. B.; Protopopescu, S.; Pušeljić, D.; Qian, J.; Quintas, P. Z.; Raja, R.; Rajagopalan, S.; Ramirez, O.; Rao, M. V. S.; Rapidis, P. A.; Rasmussen, L.; Read, A. L.; Reucroft, S.; Rijssenbeek, M.; Rockwell, T.; Roe, N. A.; Rubinov, P.; Ruchti, R.; Rutherfoord, J.; Santoro, A.; Sawyer, L.; Schamberger, R. D.; Schellman, H.; Sculli, J.; Shabalina, E.; Shaffer, C.; Shankar, H. C.; Shao, Y. Y.; Shivpuri, R. K.; Shupe, M.; Singh, J. B.; Sirotenko, V.; Smart, W.; Smith, A.; Smith, R. P.; Snihur, R.; Snow, G. R.; Snyder, S.; Solomon, J.; Sood, P. M.; Sosebee, M.; Souza, M.; Spadafora, A. L.; Stephens, R. W.; Stevenson, M. L.; Stewart, D.; Stoianova, D. A.; Stoker, D.; Streets, K.; Strovink, M.; Sznajder, A.; Taketani, A.; Tamburello, P.; Tarazi, J.; Tartaglia, M.; Taylor, T. L.; Thompson, J.; Trippe, T. G.; Tuts, P. M.; Varelas, N.; Varnes, E. W.; Virador, P. R. G.; Vititoe, D.; Volkov, A. A.; Vorobiev, A. P.; Wahl, H. D.; Wang, G.; Warchol, J.; Watts, G.; Wayne, M.; Weerts, H.; Wen, F.; White, A.; White, J. T.; Wightman, J. A.; Wilcox, J.; Willis, S.; Wimpenny, S. J.; Wirjawan, J. V. D.; Womersley, J.; Won, E.; Wood, D. R.; Xu, H.; Yamada, R.; Yamin, P.; Yanagisawa, C.; Yang, J.; Yasuda, T.; Yoshikawa, C.; Youssef, S.; Yu, J.; Yu, Y.; Zhang, D. H.; Zhu, Q.; Zhu, Z. H.; Zieminska, D.; Zieminski, A.; Zverev, E. G.; Zylberstejn, A.; DØ Collaboration

    1996-02-01

    We have studied {J}/{ψ} production in p overlinep collisions at s = 1.8 TeV with the DØ detector at Fermilab using μ+μ- data. We have measured the inclusive {J}/{ψ} production cross section as a function of {J}/{ψ} transverse momentum, pT. For the kinematic range pT > 8 GeV/ c and |η| < 0.6 we obtain σ(p overlinep → {J}/{ψ} + X) · Br( {J}/{ψ} → μ +μ -) = 2.08 ± 0.17( stat) ± 0.46(syst) nb. Using the muon impact parameter we have estimated the fraction of {J}/{ψ} mesons coming from B meson decays to be fb = 0.35 ± 0.09(stat)±0.10(syst) and inferred the inclusive b production cross section. From the information on the event topology the fraction of nonisolated {J}/{ψ} events has been measured to be fnonisol = 0.64 ± 0.08(stat)±0.06(syst). We have also obtained the fraction of {J}/{ψ} events resulting from radiative decays of χc states, fχ = 0.32 ± 0.07(stat)±0.07(syst). We discuss the implications of our measurements for charmonium production processes.

  1. Observations of Comet ISON (C/2012 S1) from Lowell Observatory

    CERN Document Server

    Knight, Matthew M

    2014-01-01

    We observed dynamically new sungrazing comet ISON (C/2012 S1) extensively at Lowell Observatory throughout 2013 in order to characterize its behavior prior to perihelion. ISON had "typical" abundances for an Oort Cloud comet. Its dust production, as measured by Afrho, remained nearly constant during the apparition but its CN gas production increased by ~50x. The minimum active area necessary to support observed water production rates exceeded the likely surface area of the nucleus and suggests a population of icy grains in the coma. Together with the flattening of the dust radial profile over time, this is consistent with ejection of a large quantity of slow moving dust and icy grains in the coma at large heliocentric distance. The dust morphology was dominated by the tail, but a faint sunward dust fan was detected in March, April, May, and September. We imaged multiple gas species in September, October, and November. Excess CN signal was observed in the sunward hemisphere in September and early October. In N...

  2. The weak measurement process and the weak value of spin for metastable helium 23S1

    Science.gov (United States)

    Monachello, Vincenzo; Barker, Peter; Flack, Robert; Hiley, Basil

    2016-05-01

    An experiment is being designed and constructed in order to measure the weak value of spin for an atomic system. The principle of the ``weak measurement'' process was first proposed by Aharonov, Albert and Vaidman, and describes a scenario in which a system is weakly coupled to a pointer between well-defined pre- and post-selected states. This experiment will utilise a pulsed supersonic beam of spin-1 metastable Helium (He*) atoms in the 23S1 state. The spin of the pre-selected He* atoms will be weakly coupled to its centre-of-mass. During its flight, the atomic beam will be prepared in a desired quantum state and travel through two inhomogeneous magnets (weak and strong) which both comprise the ``weak measurement'' process. The deviation of the post-selected ms = + 1 state as measured using a micro-channel plate, phosphor screen and CCD camera setup will allow for the determination of the weak value of spin. This poster will report on the methods used and the experimental realisation.

  3. The chiral S=-1 meson-baryon interaction with new constrains on the NLO contributions

    CERN Document Server

    Ramos, A; Magas, V K

    2016-01-01

    We present a study of the $S=-1$ meson-baryon interaction, employing a chiral SU(3) Lagrangian up to next-to-leading order (NLO) and implementing unitarization in coupled channels. The parameters of the model have been fitted to a large set of experimental scattering data in different two-body channels, to threshold branching ratios, and to the precise SIDDHARTA value of the energy shift and width of kaonic hidrogen. In contrast to other groups, we have taken into consideration the $K^- p\\to K^+\\Xi^-, K^0\\Xi^0$ reaction data, since we found in a previous work to be especially sensitive to the NLO parameters of the chiral Lagrangian. In the present work we also include the Born terms, which usually have very little effect, and find them to be non-negligible in the $K^- p\\to K\\Xi$ channels, correspondingly causing significant modifications to the NLO parameters. We furthermore show that the importance of the Born terms becomes more visible in the isospin projected amplitudes of the $K^-p \\to K\\Xi$ reactions. Th...

  4. Spin dynamics of S = 1/2 kagome lattice antiferromagnets observed by high-field ESR

    Energy Technology Data Exchange (ETDEWEB)

    Ohta, Hitoshi [Molecular Photoscience Research Center, Kobe University, Kobe 657-8501 (Japan); Graduate School of Science, Kobe University, Kobe 657-8501 (Japan); Zhang, Wei-min [Graduate School of Science, Kobe University, Kobe 657-8501 (Japan); Okubo, Susumu; Fujisawa, Masashi [Molecular Photoscience Research Center, Kobe University, Kobe 657-8501 (Japan); Sakurai, Takahiro [Center for Supports to Research and Education Activities, Kobe University, Kobe 657-8501 (Japan); Okamoto, Yoshihiko; Yoshida, Hiroyuki; Hiroi, Zenji [Institute for Solid State Physics (ISSP), University of Tokyo, Kashiwa, Chiba 277-8581 (Japan)

    2010-03-15

    Due to the existence of strong spin frustration in a system, the spin dynamics of S = 1/2 kagome lattice antiferromagnet at low temperature has attracted much interest. High-field ESR has been measured on its model substances, Cu{sub 3}V{sub 2}O{sub 7}(OH){sub 2} . 2H{sub 2}O (volborthite) and BaCu{sub 3}V{sub 2}O{sub 3}(OH){sub 2} (vesignieite), down to 1.8 K using pulsed magnetic fields up to 16 T. The measurements are performed for 160 and 315 GHz using polycrys-talline samples. Although both samples showed the g-shift and the change of linewidth at low temperature, volborthite showed a small gap excitation of the order of 40 GHz (1.9 K) while vesignieite showed a paramagnetic behavior down to 1.9 K. Observed difference will be discussed in connection with the crystal structure, and the possible spin liquid state in vesignieite will be discussed. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  5. COADJOINT ORBITS FOR THE CENTRAL EXTENSION OF Diff+(S1) AND THEIR REPRESENTATIVES

    Institute of Scientific and Technical Information of China (English)

    Dai Jialing(戴佳玲); Doug Pickrell

    2004-01-01

    According to Kirillov's idea, the irreducible unitary representations of a Lie group G roughly correspond to the coadjoint orbits O. In the forward direction one applies the methods of geometric quantization to produce a representation, and in the reverse direction one computes a transform of the character of a representation, to obtain a coadjoint orbit. The method of orbits in the representations of Lie groups suggests the detailed study of coadjoint orbits of a Lie group G in the space g* dual to the Lie algebra g of G.In this paper, two primary goals are achieved: one is to completely classify the smooth coadjoint orbits of Virasoro group for nonzero central charge c; the other is to find representatives for coadjoint orbits. These questions have been considered previously by Segal,Kirillov, and Witten, but their results are not quite complete. To accomplish this, the authors start by describing the coadjoint action of D-the Lie group of all orientation preserving diffeomorphisms on the circle S1, and its central extension (~D), then the authors will give a complete classification of smooth coadjoint orbits. In fact, they can be parameterized by a subspace of conjugacy classes of PSU(1, 1). Finally, the authors will show how to find representatives of coadjoint orbits by analyzing the vector fields stabilizing the orbits, and describe the amazing connection between the characteristic (trace) of conjugacy classes of PSU(1, 1) and that of vector fields stabilizing orbits.

  6. High Field Magnetization Studies of Low Dimensional Heisenberg S = 1/2 Antiferromagnets

    Science.gov (United States)

    Landee, C. P.; Turnbull, M. M.

    1998-03-01

    The magnetization curves of a number of low dimensional S=1/2 Heisenberg antiferromagnets have been determined in fields up to 30 tesla at low temperatures at the National High Magnetic Fields Laboratory. Materials studied include a family of 1D materials, based upon Cu(pyrazine)(NO_3)_2, 2D magnets consisting of pyrazine-bridged copper layers, and several spin ladders with singlet ground states. All of the magnetization data show upward curvature and are well described by T = 0 calculations based upon finite cluster models(Bonner and Fisher, Phys. Rev. A135, 640 (1964); Yang and Mutter, NANL cond-mat/9610092.). Chemical substitution on the pyrazine rings permits the variation of exchange constants by more than 25 percent for the family of well isolated chains. The spin ladder systems consist of ferromagnetic dimers weakly connected by antiferromagnetic intradimer interactions. Field induced transitions are seen at fields of less than one tesla for each of the three compounds.

  7. Observation of an Exotic Baryon with S=+1 in Photoproduction from the Proton

    Science.gov (United States)

    Kubarovsky, V.; Guo, L.; Weygand, D. P.; Stoler, P.; Battaglieri, M.; Devita, R.; Adams, G.; Li, Ji; Nozar, M.; Salgado, C.; Ambrozewicz, P.; Anciant, E.; Anghinolfi, M.; Asavapibhop, B.; Audit, G.; Auger, T.; Avakian, H.; Bagdasaryan, H.; Ball, J. P.; Barrow, S.; Beard, K.; Bektasoglu, M.; Bellis, M.; Benmouna, N.; Berman, B. L.; Bianchi, N.; Biselli, A. S.; Boiarinov, S.; Bouchigny, S.; Bradford, R.; Branford, D.; Briscoe, W. J.; Brooks, W. K.; Burkert, V. D.; Butuceanu, C.; Calarco, J. R.; Carman, D. S.; Carnahan, B.; Cetina, C.; Chen, S.; Ciciani, L.; Cole, P. L.; Connelly, J.; Cords, D.; Corvisiero, P.; Crabb, D.; Crannell, H.; Cummings, J. P.; de Sanctis, E.; Degtyarenko, P. V.; Denizli, H.; Dennis, L.; Dharmawardane, K. V.; Djalali, C.; Dodge, G. E.; Doughty, D.; Dragovitsch, P.; Dugger, M.; Dytman, S.; Dzyubak, O. P.; Egiyan, H.; Egiyan, K. S.; Elouadrhiri, L.; Empl, A.; Eugenio, P.; Farhi, L.; Fatemi, R.; Feuerbach, R. J.; Ficenec, J.; Forest, T. A.; Frolov, V.; Funsten, H.; Gaff, S. J.; Garçon, M.; Gavalian, G.; Gilfoyle, G. P.; Giovanetti, K. L.; Girard, P.; Gothe, R.; Gordon, C. I.; Griffioen, K.; Guidal, M.; Guillo, M.; Gyurjyan, V.; Hadjidakis, C.; Hakobyan, R. S.; Hancock, D.; Hardie, J.; Heddle, D.; Heimberg, P.; Hersman, F. W.; Hicks, K.; Holtrop, M.; Hu, J.; Ilieva, Y.; Ito, M. M.; Jenkins, D.; Joo, K.; Juengst, H. G.; Kelley, J. H.; Khandaker, M.; Kim, K. Y.; Kim, K.; Kim, W.; Klein, F. J.; Klimenko, A. V.; Klusman, M.; Kossov, M.; Kramer, L. H.; Kuhn, S. E.; Kuhn, J.; Lachniet, J.; Laget, J. M.; Langheinrich, J.; Lawrence, D.; Longhi, A.; Lukashin, K.; Major, R. W.; Manak, J. J.; Marchand, C.; McAleer, S.; McNabb, J. W.; Mecking, B. A.; Mehrabyan, S.; Melone, J. J.; Mestayer, M. D.; Meyer, C. A.; Mikhailov, K.; Minehart, R.; Mirazita, M.; Miskimen, R.; Mokeev, V.; Morand, L.; Morrow, S. A.; Mozer, M. U.; Muccifora, V.; Mueller, J.; Mutchler, G. S.; Napolitano, J.; Nasseripour, R.; Nelson, S. O.; Niccolai, S.; Niculescu, G.; Niculescu, I.; Niczyporuk, B. B.; Niyazov, R. A.; O'Brien, J. T.; O'Rielly, G. V.; Opper, A. K.; Osipenko, M.; Park, K.; Pasyuk, E.; Peterson, G.; Philips, S. A.; Pivnyuk, N.; Pocanic, D.; Pogorelko, O.; Polli, E.; Pozdniakov, S.; Preedom, B. M.; Price, J. W.; Prok, Y.; Protopopescu, D.; Qin, L. M.; Raue, B. A.; Riccardi, G.; Ripani, M.; Ritchie, B. G.; Ronchetti, F.; Rossi, P.; Rowntree, D.; Rubin, P. D.; Sabatié, F.; Sabourov, K.; Santoro, J. P.; Sapunenko, V.; Sargsyan, M.; Schumacher, R. A.; Serov, V. S.; Shafi, A.; Sharabian, Y. G.; Shaw, J.; Simionatto, S.; Skabelin, A. V.; Smith, E. S.; Smith, T.; Smith, L. C.; Sober, D. I.; Spraker, M.; Stavinsky, A.; Stepanyan, S.; Strakovsky, I. I.; Strauch, S.; Taiuti, M.; Taylor, S.; Tedeschi, D. J.; Thoma, U.; Thompson, R.; Todor, L.; Tur, C.; Ungaro, M.; Vineyard, M. F.; Vlassov, A. V.; Wang, K.; Weinstein, L. B.; Weisberg, A.; Whisnant, C. S.; Wolin, E.; Wood, M. H.; Yegneswaran, A.; Yun, J.

    2004-01-01

    The reaction γp→π+K-K+n was studied at Jefferson Laboratory using a tagged photon beam with an energy range of 3 5.47GeV. A narrow baryon state with strangeness S=+1 and mass M=1555±10 MeV/c2 was observed in the nK+ invariant mass spectrum. The peak’s width is consistent with the CLAS resolution (FWHM=26 MeV/c2), and its statistical significance is (7.8±1.0)σ. A baryon with positive strangeness has exotic structure and cannot be described in the framework of the naive constituent quark model. The mass of the observed state is consistent with the mass predicted by the chiral soliton model for the Θ+ baryon. In addition, the pK+ invariant mass distribution was analyzed in the reaction γp→K-K+p with high statistics in search of doubly charged exotic baryon states. No resonance structures were found in this spectrum.

  8. Form factors of descendant operators: reduction to perturbed M(2,2s+1) models

    Energy Technology Data Exchange (ETDEWEB)

    Lashkevich, Michael [Landau Institute for Theoretical Physics,1a prospekt Akademika Semenova, 142432 Chernogolovka (Russian Federation); Moscow Institute of Physics and Technology,9 Institutsky per., 141707 Dolgoprudny (Russian Federation); Kharkevich Institute for Information Transmission Problems,19 Bolshoy Karetny per., 127994 Moscow (Russian Federation); Pugai, Yaroslav [Landau Institute for Theoretical Physics,1a prospekt Akademika Semenova, 142432 Chernogolovka (Russian Federation); Moscow Institute of Physics and Technology,9 Institutsky per., 141707 Dolgoprudny (Russian Federation)

    2015-04-23

    In the framework of the algebraic approach to form factors in two-dimensional integrable models of quantum field theory we consider the reduction of the sine-Gordon model to the Φ{sub 13}-perturbation of minimal conformal models of the M(2,2s+1) series. We find in an algebraic form the condition of compatibility of local operators with the reduction. We propose a construction that make it possible to obtain reduction compatible local operators in terms of screening currents. As an application we obtain exact multiparticle form factors for the compatible with the reduction conserved currents T{sub ±2k}, Θ{sub ±(2k−2)}, which correspond to the spin ±(2k−1) integrals of motion, for any positive integer k. Furthermore, we obtain all form factors of the operators T{sub 2k}T{sub −2l}, which generalize the famous TT̄ operator. The construction is analytic in the s parameter and, therefore, makes sense in the sine-Gordon theory.

  9. Outgassing Behavior of C/2012 S1 (ISON) From September 2011 to June 2013

    CERN Document Server

    Meech, Karen J; Kleyna, Jan; Ansdell, Megan; Chiang, Hsin-Fang; Hainaut, Olivier; Vincent, Jean-Baptiste; Boehnhardt, Hermann; Fitzsimmons, Alan; Rector, Travis; Riesen, Timm; Keane, Jacqueline V; Reipurth, Bo; Hsieh, Henry H; Michaud, Peter; Milani, Giannantonio; Bryssinck, Erik; Ligustri, Rolando; Trabatti, Roberto; Tozzi, Gian-Paolo; Mottola, Stefano; Kuehrt, Ekkehard; Bhatt, Bhuwan; Sahu, Devendra; Lisse, Carey; Denneau, Larry; Jedicke, Robert; Magnier, Eugene; Wainscoat, Richard

    2013-01-01

    We report photometric observations for comet C/2012 S1 (ISON) obtained during the time period immediately after discovery (r=6.28 AU) until it moved into solar conjunction in mid-2013 June using the UH2.2m, and Gemini North 8-m telescopes on Mauna Kea, the Lowell 1.8m in Flagstaff, the Calar Alto 1.2m telescope in Spain, the VYSOS-5 telescopes on Mauna Loa Hawaii and data from the CARA network. Additional pre-discovery data from the Pan STARRS1 survey extends the light curve back to 2011 September 30 (r=9.4 AU). The images showed a similar tail morphology due to small micron sized particles throughout 2013. Observations at sub-mm wavelengths using the JCMT on 15 nights between 2013 March 9 (r=4.52 AU) and June 16 (r=3.35 AU) were used to search for CO and HCN rotation lines. No gas was detected, with upper limits for CO ranging between (3.5-4.5)E27 molec/s. Combined with published water production rate estimates we have generated ice sublimation models consistent with the photometric light curve. The inbound ...

  10. Deeply Embedded Protostellar Population in the 20 km s-1 Cloud of the Central Molecular Zone

    CERN Document Server

    Lu, Xing; Kauffmann, Jens; Pillai, Thushara; Longmore, Steven N; Kruijssen, J M Diederik; Battersby, Cara; Gu, Qiusheng

    2015-01-01

    We report the discovery of a population of deeply embedded protostellar candidates in the 20 km s$^{-1}$ cloud, one of the massive molecular clouds in the Central Molecular Zone (CMZ) of the Milky Way, using interferometric submillimeter continuum and H$_2$O maser observations. The submillimeter continuum emission shows five 1-pc scale clumps, each of which further fragments into several 0.1-pc scale cores. We identify 17 dense cores, among which 12 are gravitationally bound. Among the 18 H$_2$O masers detected, 13 coincide with the cores and probably trace outflows emanating from the protostars. There are also 5 gravitationally bound dense cores without H$_2$O maser detection. In total the 13 masers and 5 cores may represent 18 protostars with spectral types later than B1 or potential growing more massive stars at earlier evolutionary stage, given the non-detection in the centimeter radio continuum. In combination with previous studies of CH$_3$OH masers, we conclude that the star formation in this cloud is ...

  11. Protein Foods

    Science.gov (United States)

    ... Text Size: A A A Listen En Español Protein Foods Foods high in protein such as fish, ... for the vegetarian proteins, whether they have carbohydrate. Protein Choices Plant-Based Proteins Plant-based protein foods ...

  12. Ricci Flow of Warped Product Metrics with Positive Isotropic Curvature on $S^{p+1}× S^1$

    Indian Academy of Sciences (India)

    H A Gururaja

    2012-11-01

    We study the asymptotic behaviour of the ODE associated to the evolution of curvature operator in the Ricci flow of a doubly warped product metric on $S^{p+1}× S^1$ with positive isotropic curvature.

  13. Transsacral transdiscal L5-S1 screws for the management of high-grade spondylolisthesis in an adolescent.

    Science.gov (United States)

    Palejwala, Ali; Fridley, Jared; Jea, Andrew

    2016-06-01

    The surgical management of high-grade spondylolisthesis in adolescents remains a controversial issue. Because the basic procedure, posterolateral fusion, is associated with a significant rate of pseudarthrosis and listhesis progression, there is a pressing need for alternative surgical techniques. In the present report, the authors describe the case of an adolescent patient with significant low-back pain who was found to have Grade IV spondylolisthesis at L5-S1 that was treated with transsacral transdiscal screw fixation. Bilateral pedicle screws were placed starting from the top of the S-1 pedicle, across the L5-S1 intervertebral disc space, and into the L-5 body. At 14 months after surgery, the patient had considerable improvement in his pain and radiographic fusion across L5-S1. The authors conclude that transsacral transdiscal pedicle screws may serve as an efficacious and safe option for the correction of high-grade spondylolisthesis in adolescent patients.

  14. The elusive S2 state, the S1/S2 splitting, and the excimer states of the benzene dimer.

    Science.gov (United States)

    Balmer, Franziska A; Trachsel, Maria A; van der Avoird, Ad; Leutwyler, Samuel

    2015-06-21

    We observe the weak S0 → S2 transitions of the T-shaped benzene dimers (Bz)2 and (Bz-d6)2 about 250 cm(-1) and 220 cm(-1) above their respective S0 → S1 electronic origins using two-color resonant two-photon ionization spectroscopy. Spin-component scaled (SCS) second-order approximate coupled-cluster (CC2) calculations predict that for the tipped T-shaped geometry, the S0 → S2 electronic oscillator strength fel(S2) is ∼10 times smaller than fel(S1) and the S2 state lies ∼240 cm(-1) above S1, in excellent agreement with experiment. The S0 → S1 (ππ(∗)) transition is mainly localized on the "stem" benzene, with a minor stem → cap charge-transfer contribution; the S0 → S2 transition is mainly localized on the "cap" benzene. The orbitals, electronic oscillator strengths fel(S1) and fel(S2), and transition frequencies depend strongly on the tipping angle ω between the two Bz moieties. The SCS-CC2 calculated S1 and S2 excitation energies at different T-shaped, stacked-parallel and parallel-displaced stationary points of the (Bz)2 ground-state surface allow to construct approximate S1 and S2 potential energy surfaces and reveal their relation to the "excimer" states at the stacked-parallel geometry. The fel(S1) and fel(S2) transition dipole moments at the C2v-symmetric T-shape, parallel-displaced and stacked-parallel geometries are either zero or ∼10 times smaller than at the tipped T-shaped geometry. This unusual property of the S0 → S1 and S0 → S2 transition-dipole moment surfaces of (Bz)2 restricts its observation by electronic spectroscopy to the tipped and tilted T-shaped geometries; the other ground-state geometries are impossible or extremely difficult to observe. The S0 → S1/S2 spectra of (Bz)2 are compared to those of imidazole ⋅ (Bz)2, which has a rigid triangular structure with a tilted (Bz)2 subunit. The S0 → S1/ S2 transitions of imidazole-(benzene)2 lie at similar energies as those of (Bz)2, confirming our assignment of the

  15. Symmetry control of radiative decay in linear polyenes: low barriers for isomerization in the S1 state of hexadecaheptaene.

    Science.gov (United States)

    Christensen, Ronald L; Galinato, Mary Grace I; Chu, Emily F; Fujii, Ritsuko; Hashimoto, Hideki; Frank, Harry A

    2007-02-14

    The room temperature absorption and emission spectra of the 4-cis and all-trans isomers of 2,4,6,8,10,12,14-hexadecaheptaene are almost identical, exhibiting the characteristic dual emissions S1-->S0 (21Ag- --> 11Ag-) and S2-->S0 (11Bu+ --> 11Ag-) noted in previous studies of intermediate length polyenes and carotenoids. The ratio of the S1-->S0 and S2-->S0 emission yields for the cis isomer increases by a factor of approximately 15 upon cooling to 77 K in n-pentadecane. In contrast, for the trans isomer this ratio shows a 2-fold decrease with decreasing temperature. These results suggest a low barrier for conversion between the 4-cis and all-trans isomers in the S1 state. At 77 K, the cis isomer cannot convert to the more stable all-trans isomer in the 21Ag- state, resulting in the striking increase in its S1-->S0 fluorescence. These experiments imply that the S1 states of longer polyenes have local energy minima, corresponding to a range of conformations and isomers, separated by relatively low (2-4 kcal) barriers. Steady state and time-resolved optical measurements on the S1 states in solution thus may sample a distribution of conformers and geometric isomers, even for samples represented by a single, dominant ground state structure. Complex S1 potential energy surfaces may help explain the complicated S2-->S1 relaxation kinetics of many carotenoids. The finding that fluorescence from linear polyenes is so strongly dependent on molecular symmetry requires a reevaluation of the literature on the radiative properties of all-trans polyenes and carotenoids.

  16. The S 1, 1A 2(n,π*) state of acetone in a supersonic nozzle beam. Methyl internal rotation

    Science.gov (United States)

    Baba, Masaaki; Hanazaki, Ichiro

    1983-12-01

    Fluorescence excitation spectra of the S 1, 1A 2(n, π*) state of acetone and acetone- d6 have been measured. Active vibrational modes are the CH 3 torsion and the CO out-of-plane wagging. The barriers to internal rotation, V3, for acetone and acetone- d6 in the S 1 state have been estimated to be 740 ± 90 and 720 ± 60 cm -1, respectively.

  17. UNUSUAL WATER PRODUCTION ACTIVITY OF COMET C/2012 S1 (ISON): OUTBURSTS AND CONTINUOUS FRAGMENTATION

    Energy Technology Data Exchange (ETDEWEB)

    Combi, M. R.; Fougere, N. [Department of Atmospheric, Oceanic, and Space Sciences, University of Michigan, 2455 Hayward Street, Ann Arbor, MI 48109-2143 (United States); Mäkinen, J. T. T. [Finnish Meteorological Institute, Box 503, SF-00101 Helsinki (Finland); Bertaux, J.-L.; Quémerais, E. [LATMOS/IPSL, Université de Versailles Saint-Quentin, 11, Boulevard d' Alembert, F-78280 Guyancourt (France); Ferron, S., E-mail: mcombi@umich.edu [ACRI-st, Sophia-Antipolis (France)

    2014-06-10

    The Solar Wind ANisotropies (SWAN) all-sky hydrogen Lyα camera on the SOlar and Heliospheric Observer (SOHO) satellite observed the hydrogen coma of comet C/2012 S1 (ISON) for most of the last month of its activity from 2013 October 24 to November 24, ending just 4 days before perihelion and its final disruption. The water production rate of the comet was determined from these observations. SOHO has been operating in a halo orbit around the Earth-Sun L1 Lagrange point since its launch in late 1995. Most water vapor produced by comets is ultimately photodissociated into two H atoms and one O atom producing a huge hydrogen coma that is routinely observed in the daily SWAN images in comets of sufficient brightness. Water production rates were calculated from 22 images over most of the last month of the pre-perihelion apparition. The water production rate increased very slowly on average from October 24.9 until November 12.9, staying between 1.8 and 3.4 × 10{sup 28} s{sup –1}, after which it increased dramatically, reaching 1.6 to 2 × 10{sup 30} s{sup –1} from November 21.6 to 23.6. It was not detected after perihelion on December 3.7 when it should have been visible. We examine the active surface area necessary to explain the water production rate and its variation and are able to place constraints on the physical size of the original nucleus necessary to account for the large amount of activity from November 12.9 and until just before perihelion.

  18. Count-as-one, Forming-into-one, Unary Trait, S1

    Directory of Open Access Journals (Sweden)

    Lorenzo Chiesa

    2006-10-01

    Full Text Available While a significant amount of research has recently been carried out that investigates the similarities and differences between Alain Badiou and Jacques Lacan#39;s theories of the subject, less attention has been paid to the direct relationship between the latter and Badiou#39;s set-theoretical ontology. This article applies some of the most important conceptual propositions advanced in the first two Parts of Being and Event to the key psychoanalytic issue of the identification of the conscious and unconscious subject as expounded by Lacan in his ninth Seminar, L#39;identification. More specifically, this article aims to show how Badiou#39;s notions of the quot;count-as-onequot; and the quot;forming-into-onequot; can profitably be put to work in order better to understand Lacan#39;s notions of the quot;unary traitquot; and the S1, the quot;master-signifierquot;. What is at stake in both cases is the relationship between structure and metastructure, presentation and representation. Furthermore, this article provides an outline for a set-theoretical formalisation of the relation between consciousness and the unconscious as developed by Lacan in L#39;identification. Lacan#39;s breaking of the solidarity between unity and totality allows him to work with parts: from the inexistence of totality as a one follows the possibility of thinking the part as quot;partial systemquot;. Lacan identifies this system with the unconscious. Applying a number of set-theoretical axioms, this article argues that the existence of the unconscious as partial system ultimately relies on the in-existence of the void, or, more specifically, the existence of the void as part that in-exists as element.

  19. The S1(n,π*) states of cyclopentanone and cyclobutanone in a supersonic nozzle beam

    Science.gov (United States)

    Baba, Masaaki; Hanazaki, Ichiro

    1984-12-01

    Fluorescence excitation spectra of cyclopentanone and cyclobutanone have been observed for their (n,π*) transition in a pulsed supersonic nozzle beam using a high power tunable laser. A drastic reduction of hot bands has been attained, making it possible to discuss the vibronic assignments in more detail than the previous works. The C=O out-of-plane wagging mode was found to be active for both molecules. The ring twisting and flapping in cyclopentanone and the ring puckering in cyclobutanone were also active. The molecules are pyramidally distorted in the excited states with double minimum potentials in the out-of-plane displacement coordinates. The barrier to inversion (V) and the C=O out-of-plane angle at the potential minimum (θm) have been determined for the S1(n,π*) state; V=680±17 cm-1 and θm=34° for cyclopentanone, and V=1850±50 cm-1 and θm=42° for cyclobutanone. The puckering mode (ν20') of cyclobutanone was also found to have a double minimum potential with V=16.9 cm-1. The rotational envelope of each vibronic band has been analyzed on the basis of a computer simulation for an asymmetric top molecule. In contrast with formaldehyde, the A-type (parallel) component, as well as the B-type, was shown to be important in these cyclic ketones. The mechanism of the vibronic intensity borrowing is discussed on the basis of the band-type considerations.

  20. OUTGASSING BEHAVIOR OF C/2012 S1 (ISON) FROM 2011 SEPTEMBER TO 2013 JUNE

    Energy Technology Data Exchange (ETDEWEB)

    Meech, Karen J.; Yang, Bin; Kleyna, Jan; Chiang, Hsin-Fang; Riesen, Timm; Keane, Jacqueline V.; Reipurth, Bo; Hsieh, Henry H. [NASA Astrobiology Institute, Honolulu, HI 96822 (United States); Ansdell, Megan [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Hainaut, Olivier [European Southern Observatory, Santiago 19001 (Chile); Vincent, Jean-Baptiste; Boehnhardt, Hermann [Max-Planck-Institut fur Sonnensystemforschung, Max-Planck-Strasse 2, D-37191 Katlenburg-Lindau (Germany); Fitzsimmons, Alan [Queens University Belfast, Belfast BT7 1NN (United Kingdom); Rector, Travis [Department of Physics and Astronomy, University of Alaska Anchorage, 3211 Providence Drive, Anchorage, AK 99508 (United States); Michaud, Peter [Gemini Observatory, Northern Operations Center, 670 North A' ohoku Place, Hilo, HI 96720 (United States); Milani, Giannantonio [Associazione Astronomica Euganea, via Tommaseo, I-35131 Padova (Italy); Bryssinck, Erik [BRIXIIS Observatory, Eyckensbeekstraat, B-9150 Kruibeke (Belgium); Ligustri, Rolando [Talmassons Observatory (C.A.S.T.), via Cadorna, I-33030 Talmassons (Italy); Trabatti, Roberto [Stazione Astronomica Descartes, via Lambrinia 4, I-2013 Chignolo Po' (Italy); Tozzi, Gian-Paolo, E-mail: meech@ifa.hawaii.edu [INAF-Osservatorio Astrofisico di Arcetri, Largo E. Fermi 5, I-40125 Firenze (Italy); and others

    2013-10-20

    We report photometric observations for comet C/2012 S1 (ISON) obtained during the time period immediately after discovery (r = 6.28 AU) until it moved into solar conjunction in mid-2013 June using the UH2.2 m, and Gemini North 8 m telescopes on Mauna Kea, the Lowell 1.8 m in Flagstaff, the Calar Alto 1.2 m telescope in Spain, the VYSOS-5 telescopes on Mauna Loa Hawaii and data from the CARA network. Additional pre-discovery data from the Pan STARRS1 survey extends the light curve back to 2011 September 30 (r = 9.4 AU). The images showed a similar tail morphology due to small micron sized particles throughout 2013. Observations at submillimeter wavelengths using the James Clerk Maxwell Telescope on 15 nights between 2013 March 9 (r = 4.52 AU) and June 16 (r = 3.35 AU) were used to search for CO and HCN rotation lines. No gas was detected, with upper limits for CO ranging between 3.5-4.5 × 10{sup 27} molecules s{sup –1}. Combined with published water production rate estimates we have generated ice sublimation models consistent with the photometric light curve. The inbound light curve is likely controlled by sublimation of CO{sub 2}. At these distances water is not a strong contributor to the outgassing. We also infer that there was a long slow outburst of activity beginning in late 2011 peaking in mid-2013 January (r ∼ 5 AU) at which point the activity decreased again through 2013 June. We suggest that this outburst was driven by CO injecting large water ice grains into the coma. Observations as the comet came out of solar conjunction seem to confirm our models.

  1. LHC constraints and prospects for $S_1$ scalar leptoquark explaining the $\\bar B \\to D^{(*)} \\tau \\bar\

    CERN Document Server

    Dumont, Béranger; Watanabe, Ryoutaro

    2016-01-01

    Recently, deviations in flavor observables of B -> D(*) tau nu have been shown between the predictions in the Standard Model and the experimental results reported by BaBar, Belle, and LHCb collaborations. One of the solutions to this anomaly is obtained in a class of leptoquark model with a scalar leptoquark boson S_1, which is a SU(3)_c triplet and SU(2)_L singlet particle with -1/3 hypercharge interacting with a quark-lepton pair. With well-adjusted couplings, this model can explain the anomaly and be compatible with all flavor constraints. In such a case, the S_1 boson can be pair-produced at CERN's Large Hadron Collider (LHC) and subsequently decay as S_1 -> t tau, b nu, c tau. This paper explores the current 8 and 13 TeV constraints, as well as the detailed prospects at 14 TeV, of this flavor-motivated S_1 model. From the current available 8 and 13 TeV LHC searches, we obtain constraints on the S_1 boson mass for M_{S_1} D(*) tau nu anomaly can be probed with mass less than around 600/800 GeV at the 14 ...

  2. Comment on the Nature of the D_{s1}^*(2710) and D_{sJ}^*(2860) Mesons

    CERN Document Server

    Godfrey, Stephen

    2013-01-01

    Two charm-strange mesons, the D_{s1}^*(2710) and the D_{sJ}^*(2860), have recently been observed by several experiments. There has been speculation in the literature that the D_{s1}^*(2710) is the 2^3S_1(c\\bar{s}) state and the D_{sJ}^*(2860) is the 1^3D_1(c\\bar{s}) state. In this paper we explore this and other explanations in the context of the relativized quark model and the pseudoscalar emission decay model. We conclude that the D_{s1}^*(2710) is most likely the 1^3D_1 (c\\bar{s}) state and the D_{sJ}^*(2860) is most likely the 1^3D_3 (c\\bar{s}) state with the 1D_2 resonances also contributing to the observed signals and explaining the observed ratios of branching ratios to D^*K and DK final states. We point out that measuring the D_{sJ}^*(2860) spin can support or eliminate this explanation and that there are six excited D_s states in this mass region; the 2^3S_1, 2^1S_0, 1^3D_1, 1^3D_3 and two 1D_2 states. Observing some of the missing states would help confirm the nature of the D_{s1}^*(2710) and the D_...

  3. Theoretical study on S1(1B3u) state electronic structure and absorption spectrum of pyrazine

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Making use of a set of quantum chemistry methods, the harmonic potential surfaces of the ground state (S0(1Ag)) and the first (S1(1B3u)) excited state of pyrazine are investigated, and the electronic structures of the two states are characterized. In the present study, the conventional quantum mechanical method, taking account of the Born-Oppenheimer adiabatic approximation, is adopted to simulate the absorp-tion spectrum of S1(1B3u) state of pyrazine. The assignment of main vibronic transitions is made for S1(1B3u) state. It is found that the spectral profile is mainly described by the Franck-Condon progression of totally symmetric mode ν6a. For the five totally symmetric modes, the present calculations show that the frequency differences between the ground and the S1(1B3u) state are small. Therefore the displaced harmonic oscillator approximation along with Franck-Condon transition is used to simulate S1(1B3u) absorption spectra. The distortion effect due to the so-called quadratic coupling is demonstrated to be unimportant for the absorption spectrum, except the coupling mode ν10a. The calculated S1(1B3u) ab-sorption spectrum is in reasonable agreement with the experimental spectra.

  4. Molecular cloning and expression of an encoding galactinol synthase gene (AnGolS1) in seedling of Ammopiptanthus nanus

    Science.gov (United States)

    Liu, YuDong; Zhang, Li; Chen, LiJing; Ma, Hui; Ruan, YanYe; Xu, Tao; Xu, ChuanQiang; He, Yi; Qi, MingFang

    2016-01-01

    Based on the galactinol synthase (AnGolS1) fragment sequence from a cold-induced Suppression Subtractive Hybridization (SSH) library derived from Ammopiptanthus nanus (A. nanus) seedlings, AnGolS1 mRNA (including the 5′ UTR and 3′ UTR) (GenBank accession number: GU942748) was isolated and characterized by rapid amplification of cDNA ends polymerase chain reaction (RACE–PCR). A substrate reaction test revealed that AnGolS1 possessed galactinol synthase activity in vitro and could potentially be an early-responsive gene. Furthermore, quantitative real-time PCR (qRT-PCR) indicated that AnGolS1 was responded to cold, salts and drought stresses, however, significantly up-regulated in all origans by low temperatures, especially in plant stems. In addition, the hybridization signals in the fascicular cambium were strongest in all cells under low temperature. Thus, we propose that AnGolS1 plays critical roles in A. nanus low-temperature stress resistance and that fascicular cambium cells could be involved in AnGolS1 mRNA transcription, galactinol transportation and coordination under low-temperature stress. PMID:27786294

  5. Radiative and Pionic transitions from the $D_{s1}(2460)$ to the $D_{s0}^\\ast(2317)$

    CERN Document Server

    Xiao, cheng-Jian; Ma, Yong-Liang

    2016-01-01

    We estimate the partial widths for the radiative and pionic transitions from the $D_{s1}(2460)$ to the $D_{s0}(2317)$ in a molecule scenario, in which the $D_{s1}(2460)$ and $D_{s0}^\\ast(2317)$ are considered as hadronic molecule states of $DK$ and $D^\\ast K$, respectively. The partial widths for the $D_{s1}(2460) \\to D_{s0}^\\ast(2317) \\pi^0$ and $D_{s1}(2460) \\to D_{s0}^\\ast(2317) \\gamma$ are evaluated to be about $0.19 \\sim 0.22$ keV and $3.0 \\sim 3.1$ keV, respectively. In addition, the ratio of the $D_{s1}(2460) \\to D_{s0}(2317) \\gamma$ and $D_{s1}(2460) \\to D_{s}^\\ast \\pi^0$ is estimated to be about $(6.6\\sim 10.6) \\times 10^{-2}$, which is safely under the measured upper limit.

  6. A systematic methodology for large scale compound screening: A case study on the discovery of novel S1PL inhibitors.

    Science.gov (United States)

    Deniz, Utku; Ozkirimli, Elif; Ulgen, Kutlu O

    2016-01-01

    Decrease in sphingosine 1-phosphate (S1P) concentration induces migration of pathogenic T cells to the blood stream, disrupts the CNS and it is implicated in multiple sclerosis (MS), a progressive inflammatory disorder of the central nervous system (CNS), and Alzheimer's disease (AD). A promising treatment alternative for MS and AD is inhibition of the activity of the microsomal enzyme sphingosine 1-phosphate lyase (S1PL), which degrades intracellular S1P. This report describes an integrated systematic approach comprising virtual screening, molecular docking, substructure search and molecular dynamics simulation to discover novel S1PL inhibitors. Virtual screening of the ZINC database via ligand-based and structure-based pharmacophore models yielded 10000 hits. After molecular docking, common substructures of the top ranking hits were identified. The ligand binding poses were optimized by induced fit docking. MD simulations were performed on the complex structures to determine the stability of the S1PL-ligand complex and to calculate the binding free energy. Selectivity of the selected molecules was examined by docking them to hERG and cytochrome P450 receptors. As a final outcome, 15 compounds from different chemotypes were proposed as potential S1PL inhibitors. These molecules may guide future medicinal chemistry efforts in the discovery of new compounds against the destructive action of pathogenic T cells.

  7. The geometrical change and intramolecular energy transfer upon S1←S0 excitation in cyclopentanone

    Science.gov (United States)

    Wang, Yanmei; Liu, Zhiming; Xu, Yanqi; Zhang, Bing

    2015-08-01

    The ultrafast dynamics in vibrationally hot S1 electronic excited state in cyclopentanone molecule was discovered with time resolved spectroscopy. Investigation of the geometry change upon the S1←S0 excitation and D0←S1 ionization has shown that the dihedral angle between the C=O bond and the plane given by the carbonyl and the α-carbons is 180° either in S0 or D0 state and is reduced to 145.8° by out-out-plane deformation of the oxygen in S1 state according to the theoretical calculation. The time domain experiments with femtosecond resolution have given rich insights into the energy transfer of the cyclopentanone molecule. The molecules are excited to the vibrationally hot S1 (n, π∗) state following absorption of one 267-nm photon. It is found that the population of the S1 (n, π∗) state undergoes ultrafast internal conversion to the highly vibrationally hot S0 state within 80 fs and nonradiative deactivation by intersystem crossing to triplet T1 (n, π*) state occurring in 3.14 ps. Several Rydberg states have worked as stepping stones during the ionization. The available energy was distributed in the symmetric methylene group wagging and the symmetric skeletal ring breathing modes in D0 state.

  8. Theoretical study on S1(1B3u) state electronic structure and absorption spectrum of pyrazine

    Institute of Scientific and Technical Information of China (English)

    HE RongXing; ZHU ChaoYuan; CHIN Chih-Hao; LIN Sheng-Hsien

    2008-01-01

    Making use of a set of quantum chemistry methods, the harmonic potential surfaces of the ground state (S0(1Ag)) and the first (S1(1B3u)) excited state of pyrazine are investigated, and the electronic structures of the two states are characterized. In the present study, the conventional quantum mechanical method, taking account of the Born-Oppenheimer adiabatic approximation, is adopted to simulate the absorp-tion spectrum of S1(1B3u) state of pyrazine. The assignment of main vibronic transitions is made for S1(1B3u) state. It is found that the spectral profile is mainly described by the Franck-Condon progression of totally symmetric mode v6a. For the five totally symmetric modes, the present calculations show that the frequency differences between the ground and the S1(1B3u) state are small. Therefore the displaced harmonic oscillator approximation along with Franck-Condon transition is used to simulate S1(1B3u)absorption spectra. The distortion effect due to the so-called quadratic coupling is demonstrated to be unimportant for the absorption spectrum, except the coupling mode v10a. The calculated S1(1B3u) ab-sorption spectrum is in reasonable agreement with the experimental spectra.

  9. C4b-binding protein protects coagulation factor Va from inactivation by activated protein C

    NARCIS (Netherlands)

    van de Poel, RHL; Meijers, JCM; Rosing, J; Tans, G; Bouma, Bonno N.

    2000-01-01

    We investigated the effect of C4BP on APC-mediated inactivation of factor Va (FVa) in the absence and presence of protein S. FVa inactivation was biphasic (k(506) = 4.4 x 10(8) M-1 s(-1), k(306) = 2.7 x 10(7) M-1 s(-1)), and protein S accelerated Arg(306) cleavage approximately 10-fold.

  10. Observations of comet ISON (C/2012 S1) from Lowell observatory

    Energy Technology Data Exchange (ETDEWEB)

    Knight, Matthew M. [Lowell Observatory, 1400 W. Mars Hill Rd., Flagstaff, AZ 86001 (United States); Schleicher, David G., E-mail: knight@lowell.edu [Visiting Scientist at The Johns Hopkins University Applied Physics Laboratory, 11100 Johns Hopkins Rd., Laurel, MD 20723 (United States)

    2015-01-01

    We observed the dynamically new sungrazing comet ISON (C/2012 S1) extensively at Lowell Observatory throughout 2013 in order to characterize its behavior prior to perihelion. ISON had “typical” abundances for an Oort Cloud comet. Its dust production, as measured by Afρ, remained nearly constant during the apparition but its CN gas production increased by ∼50 ×. The minimum active area necessary to support observed water production rates exceeded the likely surface area of the nucleus and suggests a population of icy grains in the coma. Together with the flattening of the dust radial profile over time, this is consistant with ejection of a large quantity of slow moving dust and icy grains in the coma at large heliocentric distance. The dust morphology was dominated by the tail, but a faint sunward dust fan was detected in March, April, May, and September. We imaged multiple gas species in September, October, and November. All gas species were more extended than the dust coma, although only CN had sufficient signal-to-noise for detailed morphological study. Excess CN signal was observed in the sunward hemisphere in September and early October. In November the excess CN signal was in the tailward hemisphere and two faint CN features appeared approximately orthogonal to the tail with position angles varying by about ±20° from night to night. Using numerical modeling, we best reproduced the orientation and shape of these features as well as the bulk brightness with a pole oriented approximately toward the Sun and a single source located within ∼35° of the equator. Variations in position angle and relative brightness of the CN features from night to night suggest a rotation period shorter than 24 hr. The production rates and coma morphology suggest a nucleus that was active over nearly its entire sunward facing hemisphere in September and October but which underwent a significant mass loss event, potentially including fragmentation, shortly before November 1

  11. SUPPLEMENTARY COMPARISON: Final report on Supplementary Comparison APMP.M.H-S1

    Science.gov (United States)

    Kongkavitool, Rugkanawan; Hattori, Koichiro; Sanh, Vo; Yen, Lim Gin

    2007-01-01

    This report presents the results of supplementary comparison APMP.M.H-S1 among four national metrology institutes (NIMT, NMIJ/AIST, VMI and SPRING). The comparison was carried out during October 2004 to January 2005 in order to determine the capability of the primary Rockwell hardness standard, including standard conditions, of each participant, to confirm the accuracy of Rockwell hardness scale C measurement declared by the participant, which includes the effect of each participant's primary indenter and determine the degrees of equivalence of hardness scale measurement in the range 20 HRC to 60 HRC. Furthermore, the comparison was carried out a by common indenter, which was provided by the pilot institute, in order to determine the measurement capability of the participant's primary machine without the influence of the indenter, as a study of scientific purpose. The pilot institute was the National Institute of Metrology (Thailand), NIMT. There were two sets of artifacts for the comparison. Each set was composed of nine hardness blocks: 20 HRC, 25 HRC, 30 HRC, 35 HRC, 40 HRC, 45 HRC, 50 HRC, 55 HRC, 60 HRC. The verification of the participant's primary Rockwell hardness machine was carried out according to ISO6508-3 before making the measurement. The pilot institute made measurements at the beginning and the end of the comparison in order to monitor the stability of the artifacts. The degree of equivalence of each national primary hardness standard was expressed quantitatively by two terms, the deviation from KCRV and the uncertainty of this deviation at a 95% level of confidence. The En parameter was calculated to express the equivalence between the measurements of participants as well. The degree of equivalence between pairs of participating institutes was expressed by the difference of their deviations from the key comparison reference value and the uncertainty of this difference at the 95% level of confidence. Main text. To reach the main text of this paper

  12. HUBUNGAN INTELEGENSI DAN MOTIVASI DENGAN PRESTASI BELAJAR MAHASISWA S1 KEPERAWATAN STIKES YAYASAN RS ISLAM SURABAYA

    Directory of Open Access Journals (Sweden)

    Yanis Kartini

    2015-11-01

    Full Text Available There are many factors which affect the academic achievement: internal and external factors. The internal factors include the physical and psychological factors (interest, intelligence, motivation, attention, readiness, and maturity. In academic year of 2011/2012, STIKes Yarsis has added one test, the psychological test, to determine the candidates to pass the student’s admission test. So far, the data haven’t been managed as the important information for the educational management. Therefore, the purpose of this study was to find out the bivariate and multivariate correlation between intelligence and motivation toward the student’s academic achievement. The design of study was analytic-cross sectional. The population involved the students of Program of Study of S-1 in the academic year 2011/2012. 106 respondents were chosen as the samples by using simple random sampling technique. The independent variable was the level of intelligence and motivation, whereas the dependent variable was the academic achievement. The data collection was done by using secondary data, which were then analyzed by using simple and multiple linear regression tests. The result of study in bivariate correlation analysis showed that there was a correlation between intelligence and motivation toward the student’s academic achievement. The independent variable playing a role in predicting the GPA (grade-point average was motivation (p = 0.028. The value of R-Squared was 0.045 which meant that 4.5% of the academic achievement was affected by motivation, whereas the rest of them were affected by other factors. Moreover, the result of analysis described that GPA = 3.097 + 0.060 * motivation. In conclusion, in bivariate correlation analysis, intelligence and learning motivation had a correlation with academic achievement. In multivariate correlation analysis, intelligence didn’t have any correlation with academic achievement, whereas motivation had correlation with

  13. Mid-infrared observations of sungrazing comet C/2012 S1 (ISON) with the Subaru Telescope

    Science.gov (United States)

    Ootsubo, T.; Usui, F.; Takita, S.; Watanabe, J.; Yanamandra-Fisher, P.; Honda, M.; Kawakita, H.; Furusho, R.

    2014-07-01

    Comets are the frozen reservoirs of the early solar nebula and are made of ice and dust. The determination of the properties for cometary dust provides us insight into both the early-solar-nebula environment and the formation process of the planetary system. A silicate feature is often observed in comet spectra in the mid-infrared region and may be used for probing the early history of the solar system. In most cases, the feature shows the existence of crystalline silicate (for example, 11.3 microns) together with amorphous silicate [1,2]. Since the crystallization of silicates from amorphous ones generally requires high-temperature annealing above 800 K (e.g., [3,4]), it is believed that the crystalline silicate grains produced at the inner part of the disk were transported to the outer cold regions where the comet nuclei formed. Comet C/2012 S1 (ISON) is a long-period Oort Cloud comet, discovered in September 2012. In particular, comet ISON is a sungrazing comet, which was predicted to pass close by the Sun and the Earth and becoming a bright object. Mid-infrared observations of this new comet and investigation of the 10-micron silicate feature help us understand the formation of crystalline silicate grains in the early solar nebula. We conducted observations of comet ISON in the mid-infrared wavelength region with the Cooled Mid-Infrared Camera and Spectrometer (COMICS) on the Subaru Telescope on Mauna Kea, Hawaii [5,6,7]. The observation of comet ISON was carried out on 2013 October 19 and 21 UT. Since the weather conditions were not so good when we observed, we carried out N-band imaging observations (8.8 and 12.4 microns) and N-band low-resolution spectroscopy. The spectrum of comet ISON can be fit with the 260--265-K blackbody spectrum when we use the regions of 7.8--8.2 and 12.4--13.0 microns as the continuum. The spectrum has only a weak silicate excess feature, which may be able to attribute to small amorphous olivine grains. We could not detect a clear

  14. PENGARUH FAKTOR INTERNAL TERHADAP KEPUTUSAN PEMBELIAN BUKU PERKULIAHAN PADA MAHASISWA S1 STIE INDONESIA BANJARMASIN

    Directory of Open Access Journals (Sweden)

    Siti Munawaroh

    2016-08-01

    Full Text Available The book is an asset for a student to add insight and knowledge. A student can not just expect the  material of his teachers, but also must independently seek  lecture material to supplement and clarify the material received in class. One way is to buy a book of lectures. This study aimed to determine the effect of motivation and attitudes towards decisions to buy book of lectures on S1 students of STIE Indonesia Banjarmasin. This research is quantitative with descriptive analytic design. The population in this research is 246 students.  The  samples  are  152  students  were  taken  by  accidental  sampling.  Instruments  used  in  the  form  of  a  questionnaire.  Univariate  analysis  of  data  in  the form of a frequency distribution, and in multivariate linear regression. The  results  showed  that  students  were  motivated  moderate  (65.8%,  high  motivation (29.6% low motivation (4.6%. To the fact that most have a positive attitude (97.4%, negative  attitudes  (2.6%.  As  for  the  decision  to  buy  a  book  of  lectures  largely decided to buy  a book of  lectures (74.3% and decided  not to buy a  book of  lectures (25.7%. Simultaneous testing showed that Fcount = 19.278 >  Ftable = 3.06. Partial test for  motivation  variables  show  that  tcount  =  1.790   ttable = 1.976. The  conclusion  of  this  research  is  that  the  motivation  and  attitude  simultaneously influence on the decision to buy book of lectures. Partially, motivation does not affect on the decision to buy book of lectures, but attitudes influence on the decision to buy book of lectures. Keywords: motivation, attitudes, buying decisions

  15. POLIMORFISMO GENÉTICO DA αS1-CASEÍNA EM CABRAS DO SEMIÁRIDO DO NORDESTE BRASILEIRO

    Directory of Open Access Journals (Sweden)

    Eleonora de Figueiredo Moraes

    2010-10-01

    Full Text Available The population of native and mixed-breeds (MB goats from the Northeast of Brazil is little characterized, despite the importancegiven to studies of genetic resources in domestic animals. With the objective of studying the polymorphism of the αS1-casein gene in genomic DNA of Moxotó and mixed-breed goats from the semi-arid of Brazilian Northeast, by the PCR-RFLP (Polymerase Chain Reaction-Restriction Fragment Lenght Polymorfism technique,215 Moxotó and mixed-breeed goats, which came from the Brazilian states of Pernambuco, Paraíba, Rio Grande do Norte and Ceará, were used. Based on the allelic frequency from the breeds studied, there was no significant difference (p> 0.05 among the populations of each studied state and between Moxotó and mixed-breed animals. In face of the detection of a highest presence of allele B (strong from the αS1-casein gene in the animals studied, it is admitted the possibility that, phenotypically, these animals present the characteristic of a strong production of proteins, an important feature for the milk destined to cheese production, favoring the goat raising in the region.

  16. Two atomic constraints unambiguously position the S4 segment relative to S1 and S2 segments in the closed state of Shaker K channel.

    Science.gov (United States)

    Campos, Fabiana V; Chanda, Baron; Roux, Benoît; Bezanilla, Francisco

    2007-05-01

    It is now well established that the voltage-sensing S4 segment in voltage-dependent ion channels undergoes a conformational change in response to varying membrane potential. However, the magnitude of the movement of S4 relative to the membrane and the rest of the protein remains controversial. Here, by using histidine scanning mutagenesis in the Shaker K channel, we identified mutants I241H (S1 segment) and I287H (S2 segment) that generate inward currents at hyperpolarized potentials, suggesting that these residues are part of a hydrophobic plug that separates the water-accessible crevices. Additional experiments with substituted cysteine residues showed that, at hyperpolarized potentials, both I241C and I287C can spontaneously form disulphide and metal bridges with R362C, the position of the first charge-carrying residue in S4. These results constrain unambiguously the closed-state positions of the S4 segment with respect to the S1 and S2 segments, which are known to undergo little or no movement during gating. To satisfy these constraints, the S4 segment must undergo an axial rotation of approximately 180 degrees and a transmembrane (vertical) movement of approximately 6.5 A at the level of R362 in going from the open to the closed state of the channel, moving the gating charge across a focused electric field.

  17. Salmonella Typhi OmpS1 and OmpS2 porins are potent protective immunogens with adjuvant properties

    Science.gov (United States)

    Moreno-Eutimio, Mario A; Tenorio-Calvo, Alejandra; Pastelin-Palacios, Rodolfo; Perez-Shibayama, Christian; Gil-Cruz, Cristina; López-Santiago, Rubén; Baeza, Isabel; Fernández-Mora, Marcos; Bonifaz, Laura; Isibasi, Armando; Calva, Edmundo; López-Macías, Constantino

    2013-01-01

    Salmonella enterica serovar Typhi (S. Typhi) is the causal agent of typhoid fever, a disease that primarily affects developing countries. Various antigens from this bacterium have been reported to be targets of the immune response. Recently, the S. Typhi genome has been shown to encode two porins – OmpS1 and OmpS2 – which are expressed at low levels under in vitro culture conditions. In this study, we demonstrate that immunizing mice with either OmpS1 or OmpS2 induced production of specific, long-term antibody titres and conferred protection against S. Typhi challenge; in particular, OmpS1 was more immunogenic and conferred greater protective effects than OmpS2. We also found that OmpS1 is a Toll-like receptor 4 (TLR4) agonist, whereas OmpS2 is a TLR2 and TLR4 agonist. Both porins induced the production of tumour necrosis factor and interleukin-6, and OmpS2 was also able to induce interleukin-10 production. Furthermore, OmpS1 induced the over-expression of MHC II molecules in dendritic cells and OmpS2 induced the over-expression of CD40 molecules in macrophages and dendritic cells. Co-immunization of OmpS1 or OmpS2 with ovalbumin (OVA) increased anti-OVA antibody titres, the duration and isotype diversity of the OVA-specific antibody response, and the proliferation of T lymphocytes. These porins also had adjuvant effects on the antibody response when co-immunized with either the Vi capsular antigen from S. Typhi or inactivated 2009 pandemic influenza A(H1N1) virus [A(H1N1)pdm09]. Taken together, the data indicate that OmpS1 and OmpS2, despite being expressed at low levels under in vitro culture conditions, are potent protective immunogens with intrinsic adjuvant properties. PMID:23432484

  18. Salmonella Typhi OmpS1 and OmpS2 porins are potent protective immunogens with adjuvant properties.

    Science.gov (United States)

    Moreno-Eutimio, Mario A; Tenorio-Calvo, Alejandra; Pastelin-Palacios, Rodolfo; Perez-Shibayama, Christian; Gil-Cruz, Cristina; López-Santiago, Rubén; Baeza, Isabel; Fernández-Mora, Marcos; Bonifaz, Laura; Isibasi, Armando; Calva, Edmundo; López-Macías, Constantino

    2013-08-01

    Salmonella enterica serovar Typhi (S. Typhi) is the causal agent of typhoid fever, a disease that primarily affects developing countries. Various antigens from this bacterium have been reported to be targets of the immune response. Recently, the S. Typhi genome has been shown to encode two porins--OmpS1 and OmpS2--which are expressed at low levels under in vitro culture conditions. In this study, we demonstrate that immunizing mice with either OmpS1 or OmpS2 induced production of specific, long-term antibody titres and conferred protection against S. Typhi challenge; in particular, OmpS1 was more immunogenic and conferred greater protective effects than OmpS2. We also found that OmpS1 is a Toll-like receptor 4 (TLR4) agonist, whereas OmpS2 is a TLR2 and TLR4 agonist. Both porins induced the production of tumour necrosis factor and interleukin-6, and OmpS2 was also able to induce interleukin-10 production. Furthermore, OmpS1 induced the over-expression of MHC II molecules in dendritic cells and OmpS2 induced the over-expression of CD40 molecules in macrophages and dendritic cells. Co-immunization of OmpS1 or OmpS2 with ovalbumin (OVA) increased anti-OVA antibody titres, the duration and isotype diversity of the OVA-specific antibody response, and the proliferation of T lymphocytes. These porins also had adjuvant effects on the antibody response when co-immunized with either the Vi capsular antigen from S. Typhi or inactivated 2009 pandemic influenza A(H1N1) virus [A(H1N1)pdm09]. Taken together, the data indicate that OmpS1 and OmpS2, despite being expressed at low levels under in vitro culture conditions, are potent protective immunogens with intrinsic adjuvant properties.

  19. S1 satellite DNA repetitive units display identical structure and overall variability in all Anatolian brown frog taxa.

    Science.gov (United States)

    Picariello, Orfeo; Feliciello, Isidoro; Chinali, Gianni

    2016-02-01

    S1 satellite DNA from Palearctic brown frogs has a species-specific structure in all European species. We characterized S1 satellite DNA from the Anatolian brown frogs Rana macrocnemis, R. camerani, and R. holtzi in order to define their taxonomic rank and the structure of this satellite in this frog lineage. Southern blots of genomic DNA digested with KpnI, EcoRV, NdeI, NheI, or StuI produced the same pattern of satellite DNA bands. Moreover, quantitative dot blots showed that this satellite DNA accounts for 0.1 % of the genome in all taxa. Analysis of the overall genomic variability of the S1a repeat sequence in specimens from various populations demonstrated that this repetitive unit also has the same size (476 bp), the same most common sequence (MCS) and the same overall variability in all three taxa, and also in R. macrocnemis tavasensis. The S1a repetitive unit presents three deletions of 9, 8 and 1 bp compared to the 494-bp S1a repeat from European frogs. The S1a MCS has three variable positions (sequence WWTK in positions 183-186), due to the presence of two repeat subpopulations with motifs AATG and WWTT in all taxa. Unlike previously analyzed mitochondrial and nuclear sequences that show considerable variations among these taxa, no difference could be detected in the structure and variability of the S1 satellite repetitive units. This suggests that these taxa should belong to a single species. Our results indicate that this satellite DNA variety probably formed when the Anatolian lineage radiated from common ancestor about 4 mya, and since then has maintained its structure in all four taxa examined.

  20. GW-BSE approach on S1 vertical transition energy of large charge transfer compounds: A performance assessment.

    Science.gov (United States)

    Ziaei, Vafa; Bredow, Thomas

    2016-11-07

    In this work, we apply many-body perturbation theory (MBPT) on large critical charge transfer (CT) complexes to assess its performance on the S1 excitation energy. Since the S1 energy of CT compounds is heavily dependent on the Hartree-Fock (HF) exchange fraction in the reference density functional, MBPT opens a new way for reliable prediction of CT S1 energy without explicit knowledge of suitable amount of HF-exchange, in contrary to the time-dependent density functional theory (TD-DFT), where depending on various functionals, large errors can arise. Thus, simply by starting from a (semi-)local reference functional and performing update of Kohn-Sham (KS) energies in the Green's function G while keeping dynamical screened interaction (W(ω)) frozen to the mean-field level, we obtain impressingly highly accurate S1 energy at slightly higher computational cost in comparison to TD-DFT. However, this energy-only updating mechanism in G fails to work if the initial guess contains a fraction or 100% HF-exchange, and hence considerably inaccurate S1 energy is predicted. Furthermore, eigenvalue updating both in G and W(ω) overshoots the S1 energy due to enhanced underscreening of W(ω), independent of the (hybrid-)DFT starting orbitals. A full energy-update on top of HF orbitals even further overestimates the S1 energy. An additional update of KS wave functions within the Quasi-Particle Self-Consistent GW (QSGW) deteriorates results, in stark contrast to the good results obtained from QSGW for periodic systems. For the sake of transferability, we further present data of small critical non-charge transfer systems, confirming the outcomes of the CT-systems.

  1. Acylguanidine inhibitors of beta-secretase: optimization of the pyrrole ring substituents extending into the S1 and S3 substrate binding pockets.

    Science.gov (United States)

    Cole, Derek C; Stock, Joseph R; Chopra, Rajiv; Cowling, Rebecca; Ellingboe, John W; Fan, Kristi Y; Harrison, Boyd L; Hu, Yun; Jacobsen, Steve; Jennings, Lee D; Jin, Guixian; Lohse, Peter A; Malamas, Michael S; Manas, Eric S; Moore, William J; O'Donnell, Mary-Margaret; Olland, Andrea M; Robichaud, Albert J; Svenson, Kristine; Wu, JunJun; Wagner, Eric; Bard, Jonathan

    2008-02-01

    Proteolytic cleavage of amyloid precursor protein by beta-secretase (BACE-1) and gamma-secretase leads to formation of beta-amyloid (A beta) a key component of amyloid plaques, which are considered the hallmark of Alzheimer's disease. Small molecule inhibitors of BACE-1 may reduce levels of A beta and thus have therapeutic potential for treating Alzheimer's disease. We recently reported the identification of a novel small molecule BACE-1 inhibitor N-[2-(2,5-diphenyl-pyrrol-1-yl)-acetyl]guanidine (3.a.1). We report here the initial hit-to-lead optimization of this hit and the SAR around the aryl groups occupying the S(1) and S(2') pockets leading to submicromolar BACE-1 inhibitors.

  2. The first transmembrane domain (TM1) of β2-subunit binds to the transmembrane domain S1 of α-subunit in BK potassium channels

    Science.gov (United States)

    Morera, Francisco J.; Alioua, Abderrahmane; Kundu, Pallob; Salazar, Marcelo; Gonzalez, Carlos; Martinez, Agustin D.; Stefani, Enrico; Toro, Ligia; Latorre, Ramon

    2012-01-01

    The BK channel is one of the most broadly expressed ion channels in mammals. In many tissues, the BK channel pore-forming α-subunit is associated to an auxiliary β-subunit that modulates the voltage- and Ca2+-dependent activation of the channel. Structural components present in β-subunits that are important for the physical association with the α-subunit are yet unknown. Here, we show through co-immunoprecipitation that the intracellular C-terminus, the second transmembrane domain (TM2) and the extracellular loop of the β2-subunit are dispensable for association with the α-subunit pointing transmembrane domain 1 (TM1) as responsible for the interaction. Indeed, the TOXCAT assay for transmembrane protein–protein interactions demonstrated for the first time that TM1 of the β2-subunit physically binds to the transmembrane S1 domain of the α-subunit. PMID:22710124

  3. 中国百日咳鲍特菌ptxS1和prn基因多态性分析%Polymorphism of ptxS1 and prn Genes of Bordetella pertussis in China

    Institute of Scientific and Technical Information of China (English)

    张柳; 徐颖华; 赵建宏; 徐运强; 张庶民

    2010-01-01

    目的 分析我国近50年来分离的百日咳鲍特菌抗原百日咳毒素(Pertussis toxin,PT)S1亚基(ptxS1)和百日咳黏附素(Pertactin,prn)基因多态性.方法 收集85株百日咳杆菌,分别进行ptxS1和prn基因的PCR扩增和测序,并对序列进行比较分析.结果 共发现4个ptxS1基因型和6个prn基因型的百日咳杆菌.自20世纪60年代,非疫苗型ptxS1A菌株逐渐取代疫苗型菌株;含有prn2和prn3新基因型的菌株出现在2000年以后.基因的系统进化树显示,菌株ptxS1和prn基因型的核苷酸和氨基酸序列的同源性分别在97%以上.结论 我国近50年流行的百日咳临床分离菌株ptxSl和prn基因存在抗原漂移现象,本研究为加强我国百日咳的流行病学监控与新型无细胞百日咳疫苗的研发奠定了基础.

  4. Coexistence of qnrB4 and qnrS1 in a clinical strain of Klebsiella pneumoniae

    Institute of Scientific and Technical Information of China (English)

    Fu-pin HU; Xiao-gang XU; De-mei ZHU; Ming-gui WANG

    2008-01-01

    Aim:To identify the location and the relationship,and to analyze the genetic background of 2 plasmid-mediated quinolone resistance genes,qnrB4 and qnrS1,carried by a clinical strain of Klebsiella pneumoniae (Kpneumoniae).Methods:The plasmids carrying qnrB4 or qnrS1 were identified by Southern blotting.A HindIII fragment containing qnrB4 or qnrS1 was cloned into plasmid puc 18 and sequenced.Results:qnrB4 and qnrS1 were located on 2 different plasmids,pHS7 and pHSS,and were 180 and 45 kb in size,respectively.A transconjugant carrying plasmid pHS7 bearing qnrB4 and another transconjugant carrying pHS9 bearing qnrB4 and qnrS1 were obtained by conjugation.Plasmid pHS8 bearing qnrSl was also transferred to J53 by transformation.The ciprofloxacin minimal inhibitory concentrations (MIC) for J53 transconjugants or the transformant car-rying qnrB4 only,qnrS1 only,and both qnrB4 and qnrS1 were 0.19,0.25,and 0.25 mg/L,respectively,while the parent clinical strain of Kpneumoniae had a MIC of 0.75 mg/L.qnrB4 was located in a sull-type integron with blaDHA-1,ampR and psp genes in upstream and insertion sequence IS26,and sap genes in downstream of qnrB4,qnrS1 was not located in an integron,but IS26 was found both upstream and downstream,and IS2 was found directly upstream of qnrS1.Conclusion:qnrB and qnrS can be harbored simultaneously by a single clinical strain of K pneumoniae.These 2 genes are carried by 2 different plasmids and have different genetic environments in plasmid DNA structure.

  5. Retroperitoneal oblique corridor to the L2-S1 intervertebral discs in the lateral position: an anatomic study.

    Science.gov (United States)

    Davis, Timothy T; Hynes, Richard A; Fung, Daniel A; Spann, Scott W; MacMillan, Michael; Kwon, Brian; Liu, John; Acosta, Frank; Drochner, Thomas E

    2014-11-01

    Access to the intervertebral discs from L2-S1 in one surgical position can be challenging. The transpsoas minimally invasive surgical (MIS) approach is preferred by many surgeons, but this approach poses potential risk to neural structures of the lumbar plexus as they course through the psoas. The lumbar plexus and iliac crest often restrict the L4-5 disc access, and the L5-S1 level has not been a viable option from a direct lateral approach. The purpose of the present study was to investigate an MIS oblique corridor to the L2-S1 intervertebral disc space in cadaveric specimens while keeping the specimens in a lateral decubitus position with minimal disruption of the psoas and lumbar plexus. Twenty fresh-frozen full-torso cadaveric specimens were dissected, and an oblique anatomical corridor to access the L2-S1 discs was examined. Measurements were taken in a static state and with mild retraction of the psoas. The access corridor was defined at L2-5 as the left lateral border of the aorta (or iliac artery) and the anterior medial border of the psoas. The L5-S1 corridor of access was defined transversely from the midsagittal line of the inferior endplate of L-5 to the medial border of the left common iliac vessel and vertically to the first vascular structure that crosses midline. The mean access corridor diameters in the static state and with mild psoas retraction, respectively, were as follows: at L2-3, 18.60 mm and 25.50 mm; at L3-4, 19.25 mm and 27.05 mm; and at L4-5, 15.00 mm and 24.45 mm. The L5-S1 corridor mean values were 14.75 mm transversely, from midline to the left common iliac vessel and 23.85 mm from the inferior endplate of L-5 cephalad to the first midline vessel. The oblique corridor allows access to the L2-S1 discs while keeping the patient in a lateral decubitus position without a break in the table. Minimal psoas retraction without significant tendon disruption allowed for a generous corridor to the disc space. The L5-S1 disc space can be

  6. LHC constraints and prospects for S1 scalar leptoquark explaining the B ¯→D(*)τ ν ¯ anomaly

    Science.gov (United States)

    Dumont, Béranger; Nishiwaki, Kenji; Watanabe, Ryoutaro

    2016-08-01

    Recently, deviations in flavor observables of B ¯→D(*)τ ν ¯ have been shown between the predictions in the Standard Model and the experimental results reported by BABAR, Belle, and LHCb collaborations. One of the solutions to this anomaly is obtained in a class of leptoquark model with a scalar leptoquark boson S1, which is a S U (3 )c triplet and S U (2 )L singlet particle with -1 /3 hypercharge interacting with a quark-lepton pair. With well-adjusted couplings, this model can explain the anomaly and be compatible with all flavor constraints. In such a case, the S1 boson can be pair-produced at CERN's Large Hadron Collider (LHC) and subsequently decay as S1*→t τ , b ντ, and c τ . This paper explores the current 8 and 13 TeV constraints, as well as the detailed prospects at 14 TeV, of this flavor-motivated S1 model. From the current available 8 and 13 TeV LHC searches, we obtain constraints on the S1 boson mass for MS1<400 - 640 GeV depending on values of the leptoquark couplings to fermions. Then we study future prospects for this scenario at the 14 TeV LHC using detailed cut analyses and evaluate exclusion and discovery potentials for the flavor-motivated S1 leptoquark model from searches for the (b ν )(b ¯ν ¯) and (c τ )(c ¯τ ¯) final states. In the latter case, we consider several scenarios for the identification of charm jets. As a result, we find that the S1 leptoquark origin of the B ¯→D(*)τ ν ¯ anomaly can be probed with MS1≲600 /800 GeV at the 14 TeV LHC with L =300 /3000 fb-1 of accumulated data. One can also see that the 14 TeV LHC run II with L =300 fb-1 can exclude the S1 leptoquark boson up to MS1˜0.8TeV at 95% confidence level, whereas a future 14 TeV LHC with L =3000 fb-1 data has a potential to discover the S1 leptoquark boson with its mass up to MS 1˜1.1 TeV with over 5 σ significance, from the (b ν )(b ¯ν ¯) and/or (c τ )(c ¯τ ¯) searches.

  7. The Impact of Photon Flight Path on S1 Pulse Shape Analysis in Liquid Xenon Two-phase Detectors

    CERN Document Server

    Moongweluwan, M

    2015-01-01

    The LUX dark matter search experiment is a 350 kg dual-phase xenon time projection chamber located at the 4850 ft level of the Sanford Underground Research Facility in Lead, SD. The success of two-phase xenon detectors for dark matter searches relies on their ability to distinguish electron recoil (ER) background events from nuclear recoil (NR) signal events. Typically, the NR-ER discrimination is obtained from the ratio of the electroluminescence light (S2) to the prompt scintillation light (S1). Analysis of the S1 pulse shape is an additional discrimination technique that can be used to distinguish NR from ER. Pulse-shape NR-ER discrimination can be achieved based on the ratio of the de-excitation processes from singlet and triplet states that generate the S1. The NR S1 is dominated by the de-excitation process from singlet states with a time constant of about 3 ns while the ER S1 is dominated by the de-excitation process from triplet states with a time constant of about 24 ns. As the size of the detectors ...

  8. Continuation maintenance therapy with S-1 in chemotherapy-naïve patients with advanced squamous cell lung cancer.

    Science.gov (United States)

    Suzuki, Seiichiro; Karayama, Masato; Inui, Naoki; Fujisawa, Tomoyuki; Enomoto, Noriyuki; Nakamura, Yutaro; Kuroishi, Shigeki; Matsuda, Hiroyuki; Yokomura, Koshi; Koshimizu, Naoki; Toyoshima, Mikio; Imokawa, Shiro; Asada, Kazuhiro; Masuda, Masafumi; Yamada, Takashi; Watanabe, Hiroshi; Suda, Takafumi

    2016-08-01

    Objectives Maintenance therapy is a standard therapeutic strategy in non-squamous non-small-cell lung cancer. However, there is no consensus regarding the benefit of maintenance therapy for patients with squamous cell lung cancer. We assessed maintenance therapy with S-1, an oral fluoropyrimidine agent, following induction therapy with carboplatin and S-1 in patients with squamous cell lung cancer. Methods In this phase II trial, chemotherapy-naïve patients with squamous cell lung cancer were enrolled to induction therapy with four cycles of carboplatin (at an area under the curve of 5 on day 1) and S-1 (80 mg/m(2)/day on days 1-14) in a 28-day cycle. Patients who achieved disease control after induction therapy received maintenance therapy with S-1 in a 21-day cycle until disease progression or unacceptable toxicity. The primary endpoint was progression-free survival after administration of maintenance therapy. Results Fifty-one patients were enrolled in the study. The median progression-free survival from the start of maintenance therapy was 3.0 months (95 % confidence interval, 2.5-3.5). The most common toxicities associated with maintenance therapy were anemia, thrombocytopenia, and fatigue, but they were not severe. Conclusion S-1 maintenance therapy might be a feasible treatment option in patients with squamous cell lung cancer.

  9. A non-adiabatic dynamics study of octatetraene: the radiationless conversion from S2 to S1.

    Science.gov (United States)

    Qu, Zexing; Liu, Chungen

    2013-12-28

    Simulation of the excited state dynamics of all-trans-1,3,5,7-octatetraene has been performed to investigate the ultrafast radiationless S2 → S1 internal conversion process. Multireference configuration interaction with single excitation method has been employed to optimize the equilibrium structure of the excited states, as well as the S2/S1 conical intersection, and to investigate the non-adiabatic molecular dynamics of the S2/S1 state transition. At the conical intersection, the molecule is found to be distorted from the original planar trans structure to a nearly perpendicular conformation around C3-C4 bond, with the torsion angle being about 107°. Such structural change can result in mutual approaching of states S2 and S1 in energy, and drastically increase the nonadiabatic coupling between the two states by destroying the inter-state symmetry prohibition in the electronic wavefunctions. Surface-hopping molecular dynamics simulations are performed to describe the non-adiabatic process. Upon the Franck-Condon excitation to the S2 state, the molecule quickly twists its C3-C4 bond and approaches the conical intersection region, where it can undergo efficient internal conversion to S1. The decay time constant (τ) of S2 state is estimated to be around 251 fs by fitting the occupation number of average fraction of trajectories using an exponential damping function. This value is reasonably consistent with previous experimental measurements of around 300-400 fs.

  10. Construction and expression of nucleic acid vaccine pVAXl-h-alpha S1-14o coding human alpha-synuclein

    Institute of Scientific and Technical Information of China (English)

    Jiacai Wang; Yingsong Ouyang; Shaojun Wang; Guoguang Peng; Qin Luo; Side Jiang; Faxiang Wang

    2008-01-01

    BACKGROUND: The deposition of α-synuclein (α-syn) aggregates is a neuropathological feature of Parkinson's disease. It remains impossible to involve α-syn aggregation in the treatment of Parkinson's disease. A nucleic acid vaccine will provide a new pathway to immunotherapy for Parkinson's disease.OBJECTIVE: To construct a recombinant eukaryotic expression vector pVAX1 coding human α-syn and to observe its expression level in COS-7 cells.DESIGN AND SETTING: The present bioengineering and molecular biology experiment was performed at Department of Neurology, First Affiliated Hospital of Chongqing Medical University & Chongqing Key Laboratory of Neurology.MATERIALS: The eukaryotic expression plasmid pVAX1, human embryonic brain tissue, healthy human blood cells, and COS-7 cells were purchased from Promega Company, USA.METHODS: The full-length CDS sequence of the human α-syn gene was amplified by RT-PCR, which contained restriction sites for the enzymes Kpn I, Xba I and Kozak consensus sequence. Then the PCR products and eukaryotic expression vector pVAX1 were digested with Kpn I and Xba I simultaneously, and were extracted and ligated by T4 ligase. The recombinant constructs pVAXI-hα-S1-14o were transformed into competent E. coli TOP 10 cells and the positive clones were screened and selected using PCR analysis,restriction digestion analysis, and DNA sequencing. The constructs were then tested for protein expression in COS-7 cells by RT-PCR and Western blotting.MAIN OUTCOME MEASURES: Identification of an eukaryotic expression vector containing the human α-syn gene, pVAX1-hα-S1-140, and detection of the expression in mammalian cell COS-7.RESULTS: The pVAXi vector was successfully cloned with human a -syn in the correct orientation and in-frame. The DNA vaccine constructs pVAX1-hα-S1-140 with the human α-syn gene were shown to be expressed in COS-7 cells. Human α-syn was successfully expressed in the mammalian cell line and was detected by RT-PCR and western

  11. Video-assisted ALIF with cage and anterior plate fixation for L5-S1 spondylolisthesis.

    Science.gov (United States)

    Aunoble, Stephane; Hoste, David; Donkersloot, Peter; Liquois, Frederic; Basso, Yann; Le Huec, Jean-Charles

    2006-10-01

    Spondylolysis and spondylolisthesis grade 0, 1, and 2 are mainly asymptomatic but with aging process and different factors some back pain can occur and lead to chronic low back pain. The conservative treatment with physiotherapy and steroid injection is the gold standard but in some cases is not efficient enough and a surgical treatment is proposed. The goal of this study is to propose a new technique to treat grade 0, 1, and 2 spondylolisthesis with an anterior video-assisted fusion and stabilization. Twenty patients with chronic low back pain since more than 2 years and resistant to conservative therapy were included in this protocol. Clinical signs and radicular pain were noted. They were evaluated preoperatively and postoperatively until the last follow up using Oswestry score and visual analog score (VAS) for leg and back pain. X-rays showed grade 0 (8 cases), 1 (10 cases), and 2 (2 cases) spondylolisthesis according to Meyerding classification with disc collapse (bulging disc). MRI showed in all cases a disc degeneration with at least black disc and/or endplates changes with Modic I or II. All patients were operated using an anterior video-assisted retroperitoneal approach, with discectomy and fusion using an anterior impacted cage filled with autologous cancellous bone from the iliac crest and an anterior fixation with a triangular plate (Pyramid, Medtronic, Memphis). The follow up at 3, 6, 12, and 24 months was done with clinical and radiologic evaluation. In case of problem a computed tomography scan was performed. There were 11 women and 9 men, with and average age of 39 years old and a BMI of 25.6. All spondylolistheses occurred at level L5. The average slippage was 19%. All L5S1 discs were black, 8 had a Modic I changes in the endplates and 2 had Modic II. The shape of L5 vertebra was abnormal (trapezoidal) in 7 cases. All anterior approaches were performed without vascular, urologic, or digestive complication. Blood loss was inferior to 100 mL. All

  12. The study on the relativity among HBeAg, HBV-DNA and PreS1-antigen%乙型肝炎血清前S1抗原与HBV-DNA和HBeAg相关性分析

    Institute of Scientific and Technical Information of China (English)

    邓芝云; 董菊子; 朱发仁; 张方信

    2011-01-01

    Objective To study the clinical application value of Presl-antigen. Methods The HBV markers and Presl-antigen were detected by enzyme linked immunosorbent assay ( ELISA) and the HBV-DNA was detected by fluorescent quantitation poly-merase chain reaction (FQ-PCR) in 365 patients with hepatitis B. Results The positive rates of the HBV-DNA and Presl were 86.4% and 89.1% in 110 patients of HBsAg+ , HBeAg+ and HBcAb + ; 36.4% and 40.9% in 66 patients of HBsAg+ ,HBeAb + and HBcAb + ;32.4% and 41.7% in 37 patients of HBsAg + and HBcAb + ;15.4% and 15.4% in 39 patients of HeAg + and HBcAb + ;5.3% and 8.0% in 113 patients of HBsAb +. The positive rates of HBeAg and PreSlAg increased with increasing HBV-DNA, PreS1 Ag was increased significantly compared with HBeAg ( P < 0.05 ). Conclusion Presl and HBV-DNA are the sensitive index for HBV replication, though PreSlAg and HBeAg Presl increased with increasing HBV-DNA, PreSlAg is more sensitive than HBeAg, and it is valuable in clinical application.%目的 探讨乙型肝炎血清前S1抗原(PreS1Ag)临床应用的价值.方法 对365例乙型肝炎患者血清,采用酶联免疫吸附试验(ELISA)检测HBV血清标志物和PreS1 Ag,用荧光定量聚合酶链反应(FQ-PCR)方法 检测HBV-DNA.结果 HBV-DNA和PreS1Ag的阳性率在110例HBV大三阳中,分别为86.4%和89.1%;在66例HBV小三阳中,分别为36.4%和40.9%;在37例HBsAg、HBcAb中,分别为32.4%和41.7%;在39例HBeAg、HBcAb阳性中,分别为15.4%和15.4%;在113例HBsAb阳性中,分别为5.3%和8.0%.HBeAg、PreS1Ag阳性率随不同载量HBV-DNA升高而增高,但PreS1Ag比HBeAg增高更明显(P<0.05).结论 PreS1 Ag和HBV-DNA一样都是乙型肝炎病毒复制的敏感指标,虽然PreS1Ag和HBeAg都随HBV-DNA载量增加而升高,但PreS1Ag较HBeAg更能敏感,因此PreS1 Ag具有重要的临床应用价值.

  13. S1-ZGV Modes of a Linear and Nonlinear Profile for Functionally Graded Material Using Power Series Technique

    Directory of Open Access Journals (Sweden)

    M. Zagrouba

    2014-01-01

    Full Text Available The present work deals with functionally graded materials (FGM isotropic plates in the neighborhood of the first-order symmetric zero group velocity (S1-ZGV point. The mechanical properties of functionally graded material (FGM are assumed to vary continuously through the thickness of the plate and obey a power law of the volume fraction of the constituents. Governing equations for the problem are derived, and the power series technique (PST is employed to solve the recursive equations. The impact of the FGM basic materials properties on S1-ZGV frequency of FGM plate is investigated. Numerical results show that S1-ZGV frequency is comparatively more sensitive to the shear modulus. The gradient coefficient p does not affect the linear dependence of ZGV frequency fo as function of cut-off frequency fc; only the slope is slightly varied.

  14. Newly identified mutations at the CSN1S1 gene in Ethiopian goats affect casein content and coagulation properties of their milk.

    Science.gov (United States)

    Mestawet, T A; Girma, A; Adnøy, T; Devold, T G; Vegarud, G E

    2013-08-01

    Very high casein content and good coagulation properties previously observed in some Ethiopian goat breeds led to investigating the αs1-casein (CSN1S1) gene in these breeds. Selected regions of the CSN1S1 gene were sequenced in 115 goats from 5 breeds (2 indigenous: Arsi-Bale and Somali, 1 exotic: Boer, and 2 crossbreeds: Boer × Arsi-Bale and Boer × Somali). The DNA analysis resulted in 35 new mutations: 3 in exons, 3 in the 5' untranslated region (UTR), and 29 in the introns. The mutations in exons that resulted in an amino acid shift were then picked to evaluate their influence on individual casein content (αs1-, αs2-, β-, and κ-CN), micellar size, and coagulation properties in the milk from the 5 goat breeds. A mutation at nucleotide 10657 (exon 10) involved a transversion: CAG→CCG, resulting in an amino acid exchange Gln77→Pro77. This mutation was associated with the indigenous breeds only. Two new mutations, at nucleotide 6072 (exon 4) and 12165 (exon 12), revealed synonymous transitions: GTC→GTT in Val15 and AGA→AGG in Arg100 of the mature protein. Transitions G→A and C→T at nucleotides 1374 and 1866, respectively, occurred in the 5' UTR, whereas the third mutation involved a transversion T→G at nucleotide location 1592. The goats were grouped into homozygote new (CC), homozygote reference (AA), and heterozygote (CA) based on the nucleotide that involved the transversion. The content of αs1-CN (15.32g/kg) in milk samples of goats homozygous (CC) for this newly identified mutation, Gln77→Pro77 was significantly higher than in milks of heterozygous (CA; 9.05g/kg) and reference (AA; 7.61g/kg) genotype animals. The αs2-, β-, and κ-CN contents showed a similar pattern. Milk from goats with a homozygous new mutation had significantly lower micellar size. Milk from both homozygote and heterozygote new-mutation goats had significantly shorter coagulation rate and stronger gel than the reference genotype. Except the transversion, the

  15. Sequence Variation of the Pertussis Toxin S1 Subunit Encoding Gene in the Clinical Isolates of Bordetella pertussis in Iran

    Directory of Open Access Journals (Sweden)

    Hosseinpour

    2015-08-01

    Full Text Available Background Whooping cough (pertussis is an acute respiratory disease caused by Bordetella pertussis (B. pertussis. Pertussis toxin is an important virulence factor of B. pertussis and plays a major role in the immune and inflammatory responses. Likewise, allelic variations in the genes of virulence factors have led to the non-responsiveness of the new strains to both whole-cell and acellular vaccines. Given the importance of pertussis vaccine, we sought to address the lack of fundamental studies on the polymorphisms of the virulence genes of B. pertussis in Iran. Objectives The aim of this study was to identify the polymorphisms of the pertussis toxin S1 subunit (ptxS1 gene in the circulating strains and compare them to the vaccine strain. Patients and Methods In this study, 50 strains of B. pertussis isolated from patients with pertussis were investigated in the pertussis reference laboratory of Pasteur institute of Iran. Cultivation, biochemical tests, and the specific antisera were used to confirm B. pertussis. The sequencing of the polymerase chain reaction products was performed to determine the ptxS1 alleles, and B. pertussis 134 was studied as the vaccine strain. Results The results showed that all the strains had the dominant allele ptxS1A. There were differences between the alleles of the clinical strains and the vaccine strain. Conclusions In recent years, a significant increase in the incidence of pertussis has been reported worldwide. Our findings regarding the allelic shift of the ptxS1 gene are similar to those reported in many European and American countries showing the difference of the dominant allele of ptxS1 between the circulating isolates and the vaccine strains.

  16. New Wavelet Bases and Isometric Between Symbolic Operators Spaces OpS1,δm and Kernel Distributions Spaces

    Institute of Scientific and Technical Information of China (English)

    YANG Qi Xiang

    2002-01-01

    In the fifties, Calderón established a formal relation between symbol and kernel distribu-the C-Z operators, and Hormander, Kohn and Nirenberg, et al. studied the symbolic operators. Herewe apply a refinement of the Littlewood-Paley (L-P) decomposition, analyse under new wavelet bases,to characterize both symbolic operators spaces OpS1,δm and kernel distributions spaces with other spacescomposed of some almost diagonal matrices, then get an isometric between OpS1,δm and kernel distri-bution spaces

  17. Lipase immobilized on HOOC-MCF: A highly enantioselective catalyst for transesterification resolution of (R,S)-1-phenylethanol

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Pseudomonas cepacia lipase (PSL) immobilized on the carboxyl-functionalized meso-cellular foams (HOOC-MCF) was used for the transesterification resolution of (R,S)-1-phenylethanol in organic solvent. The results showed that the ee value of (S)-1-phenylethanol and (R)-1-phenylethyl acetate reached 99% with 50% conversion of 1-phenylethanol using toluene as solvent.Furthermore, it was found that PSL/HOOC-MCF exhibited high enantioselectivity in organic solvent with log P ≤ 2 such as toluene and hexane.

  18. Phase 1 study on S-1 and oxaliplatin therapy as an adjuvant after hepatectomy for colorectal liver metastases.

    Science.gov (United States)

    Takahashi, Michiro; Hasegawa, Kiyoshi; Oba, Masaru; Saiura, Akio; Arita, Junichi; Sakamoto, Yoshihiro; Shinozaki, Eiji; Mizunuma, Nobuyuki; Matsuyama, Yutaka; Kokudo, Norihiro

    2016-08-01

    of Background Data The effectiveness of adjuvant chemotherapy in patients with stage II/III colorectal cancer has been confirmed in various studies. However, no adjuvant chemotherapy for colorectal liver metastasis (CLM) classified to stage IV has been established. Objectives We conducted a phase 1 study of S-1 and oxaliplatin to determine the recommended dose (RD) in patients with CLM as adjuvant therapy in two institutes. Methods S-1 and oxaliplatin were administered from day 1 to day 14 of a 3-week cycle as a 2-h infusion every 3 weeks, respectively. The initial doses of S-1 and oxaliplatin were fixed to 80 mg/m(2) and 100 mg/m(2), respectively (level 1). We scheduled in the protocol a dose change of S-1 and oxaliplatin to level 2 (S-1: 80 mg/m(2) and oxaliplatin: 130 mg/m(2)) or level 0 (S-1: 65 mg/m(2) and oxaliplatin: 100 mg/m(2)) depending on the incidence of dose-limiting toxicity (DLT) at level 1 in six patients. Results Because DLT occurred in one among the initial six patients at level 1, the doses were increased to level 2 in the next six patients. At level 2, grade 3 leukopenia and neutropenia occurred in one (16.7 %) and two (33.3 %) patients, respectively, in the absence of non-hematological event. Because no DLT occurred at level 2, we suggest that the RD can be set to the level 2 dose. The median number of cycles delivered at RD was 8. The mean relative dose intensity of S-1 and oxaliplatin at RD was 0.90 and 0.63, respectively. Conclusion In a patient undergoing hepatectomy for CLM, 80 mg/m(2) of S-1 and 130 mg/m(2) of oxaliplatin are recommended as adjuvant therapy. A further study is required to confirm the efficacy and safety of this regimen on a larger scale.

  19. Quasi-1D s=1/2 antiferromagnet Cs2CuCl4 in a magnetic field

    DEFF Research Database (Denmark)

    Coldea, R.; Tennant, D.A.; Cowley, R.A.;

    1997-01-01

    Magnetic excitations of the quasi-1D S = 1/2 Heisenberg antiferromagnet (HAF) Cs2CuCl4 have beer measured as a function of magnetic field using neutron scattering. For T Fields greater than B-c = 1.66 T, but less...... than the field (similar or equal to 8 T) required to fully align the spins, are observed to decouple the chains, and the system enters a disordered intermediate-field phase (IFP). The IFP excitations are in agreement with the predictions of Muller et al. for the 1D S = 1/2 HAF, and Talstra and Haldane...

  20. S-1 Joint Cisplatin Cannot Improve Survival Advanced Gastric Carcinoma%S-1联合顺铂不能提高晚期胃癌的生存率

    Institute of Scientific and Technical Information of China (English)

    巴一; 马冬

    2011-01-01

    @@ 1 文献来源 Ajani JA,Rodriguez W,Bodoky G ,et al.Multicenter phase Ⅲ comparison of Cisplatin/S-1with Cisplatin/Infusional Fluorouracil in advanced gastric or gastroesophageal adenocarcinoma study:The FLAGS trial [J].J Clin Oncol,2010,28(9):1547-1553.

  1. Influence of fresh forage-based diets and αs₁-casein (CSN1S1) genotype on nutrient intake and productive, metabolic, and hormonal responses in milking goats.

    Science.gov (United States)

    Bonanno, A; Di Grigoli, A; Di Trana, A; Di Gregorio, P; Tornambè, G; Bellina, V; Claps, S; Maggio, G; Todaro, M

    2013-04-01

    Polymorphism at the αS1-casein locus (CSN1S1) in goats influences several milk production traits. Milk from goats carrying strong alleles, which are associated with high αS1-casein (αS1-CN) synthesis, has higher fat and casein contents, longer coagulation time and higher curd firmness than milk from goats with weak alleles linked to low αS1-CN content. Nutrition also affects these milk properties; therefore, it is important to better understand the interaction between dietary characteristics and the CSN1S1 genotype in goats. This study aimed to investigate the effect of fresh forage based diet or energy supplement on feeding behavior, milk production, and metabolic and hormonal parameters of Girgentana goats with different genotypes at CSN1S1 loci. From a group of goats genotyped by PCR at the DNA level, 12 were selected because they had the same genotype for αS2-CN, β-CN, and κ-CN but a different genotype for αS1-CN: 6 were homozygous for strong alleles at the CSN1S1 loci (AA) and 6 were heterozygous for a weak allele (AF). Goats of each genotype were allocated to 3 subgroups and fed 3 diets ad libitum in a 3×3 Latin square design. The diets were sulla (Hedysarum coronarium L.) fresh forage, sulla fresh forage plus 800 g/d of barley meal (SFB), and mixed hay plus 800 g/d of barley meal (MHB). Diet had a stronger effect than CSN1S1 genotype. The SFB diet led to the highest energy intake, dry matter (DM) digestibility, and milk yield. The fresh forage diets (SFF and SFB) increased DM and crude protein (CP) intake, CP digestibility, and milk CN compared with the MHB diet. The diets supplemented with energy (SFB, MHB) reduced milk fat and urea, improved CP utilization for casein synthesis, and limited body fat mobilization, in accordance with a lower level of nonesterified fatty acids and higher levels of glucose and IGF-1. With regard to CSN1S1 genotype, AA goats showed higher CP digestibility and lower free thyroxine hormone and cholesterol levels than AF

  2. Regulation by the extracellular matrix (ECM) of prolactin-induced alpha s1-casein gene expression in rabbit primary mammary cells: role of STAT5, C/EBP, and chromatin structure.

    Science.gov (United States)

    Jolivet, Geneviève; Pantano, Thaïs; Houdebine, Louis Marie

    2005-05-15

    The aim of the present study was to understand how the extracellular matrix (ECM) regulates at the gene level the prolactin (Prl)-induced signal transducer and activator of transcription 5 (STAT5)-dependent expression of the alpha s1-casein gene in mammary epithelial cells. CCAAT enhancer binding proteins (C/EBPs) are assumed regulators of beta-casein gene expression. Rabbit primary mammary cells express alpha s1-casein gene when cultured on collagen and not on plastic. Similar C/EBPbeta, C/EBPdelta, STAT5, and Prl-activated STAT5 were found under all culture conditions. Thus the ECM does not act through C/EBPs or STAT5. This was confirmed by transfections of rabbit primary mammary cells by a construct sensitive to ovine prolactin (oPrl) and ECM (6i TK luc) encompassing STAT5 and C/EBP binding sites. The mutation of C/EBPs binding sites showed that these sites were not mandatory for Prl-induced expression of the construct. Interestingly, chromatin immunoprecipitation by the anti-acetylhistone H4 antibody (ChIP) showed that the ECM (and not Prl) maintained a high amount of histone H4 acetylation upstream of the alpha s1-casein gene especially at the level of a distal Prl- and ECM-sensitive enhancer. Alpha6 integrin (a membrane receptor of laminin, the principal active component of the mammary ECM) was found at the surface of cells cultured on collagen but not on plastic. In cells cultured on collagen in the presence of anti-alpha6 integrin antibody, Prl-induced transcription of the endogenous alpha s1-casein gene was significantly reduced, without modifying C/EBPs and STAT5. Besides, histone H4 acetylation was reduced. Thus, we propose that the ECM regulates rabbit alpha s1-casein protein expression by local modification of chromatin structure, independently of STAT5 and C/EBPs.

  3. 2-Aryl(pyrrolidin-4-yl)acetic acids are potent agonists of sphingosine-1-phosphate (S1P) receptors.

    Science.gov (United States)

    Yan, Lin; Budhu, Richard; Huo, Pei; Lynch, Christopher L; Hale, Jeffrey J; Mills, Sander G; Hajdu, Richard; Keohane, Carol A; Rosenbach, Mark J; Milligan, James A; Shei, Gan-Ju; Chrebet, Gary; Bergstrom, James; Card, Deborah; Mandala, Suzanne M

    2006-07-01

    A series of 2-aryl(pyrrolidin-4-yl)acetic acids were synthesized and their biological activities were evaluated as agonists of S1P receptors. These analogs were able to induce lowering of lymphocyte counts in the peripheral blood of mice and were found to have good overall pharmacokinetic properties in rat.

  4. Direct search for Dirac magnetic monopoles in pp collisions at square root s = 1.96 TeV.

    Science.gov (United States)

    Abulencia, A; Acosta, D; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Bachacou, H; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Ben-Haim, E; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Bishai, M; Blair, R E; Blocker, C; Bloom, K; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Bourov, S; Boveia, A; Brau, B; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carlsmith, D; Carosi, R; Carron, S; Carter, A; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chapman, J; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Chu, P H; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Connolly, A; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Cruz, A; Cuevas, J; Culbertson, R; Cyr, D; DaRonco, S; D'Auria, S; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Demers, S; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Dionisi, C; Dittmann, J; DiTuro, P; Dörr, C; Dominguez, A; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Ebina, K; Efron, J; Ehlers, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Flores-Castillo, L R; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Fujii, Y; Furic, I; Gajjar, A; Gallinaro, M; Galyardt, J; Garcia, J E; Garcia Sciverez, M; Garfinkel, A F; Gay, C; Gerberich, H; Gerchtein, E; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Ginsburg, C; Giolo, K; Giordani, M; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Gotra, Y; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Grundler, U; da Costa, J Guimaraes; Haber, C; Hahn, S R; Hahn, K; Halkiadakis, E; Hamilton, A; Han, B-Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hatakeyama, K; Hauser, J; Hays, C; Hayward, H; Heijboer, A; Heinemann, B; Heinrich, J; Hennecke, M; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Huston, J; Ikado, K; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jones, M; Joo, K K; Jun, S Y; Junk, T R; Kamon, T; Kang, J; Karagoz-Unel, M; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, M S; Kim, S B; Kim, S H; Kim, Y K; Kirby, M; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kobayashi, H; Kondo, K; Kong, D J; Konigsberg, J; Kordas, K; Korytov, A; Kotwal, A V; Kovalev, A; Kraus, J; Kravchenko, I; Kreps, M; Kreymer, A; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kuhlmann, S E; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Lecci, C; LeCompte, T; Lee, J; Lee, J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Li, K; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Liss, T M; Lister, A; Litvintsev, D O; Liu, T; Liu, Y; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Maksimovic, P; Manca, G; Margaroli, F; Marginean, R; Marino, C; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McGivern, D; McIntyre, P; McNamara, P; McNulty, R; Mehta, A; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; von der Mey, M; Miao, T; Miladinovic, N; Miles, J; Miller, R; Miller, J S; Mills, C; Milnik, M; Miquel, R; Miscetti, S; Mitselmakher, G; Miyamoto, A; Moggi, N; Mohr, B; Moore, R; Morello, M; Fernandez, P Movilla; Mülmenstädt, J; Mukherjee, A; Mulhearn, M; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nahn, S; Nakano, I; Napier, A; Naumov, D; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O

    2006-05-26

    We search for pair-produced Dirac magnetic monopoles in 35.7 pb(-1) of proton-antiproton collisions at square root s = 1.96 TeV with the Collider Detector at Fermilab (CDF). We find no monopole candidates corresponding to a 95% confidence-level cross-section limit sigma 360 GeV/c2.

  5. Case Report of S1Q3T3 Electrocardiographic Abnormality in a Pregnant Asthmatic Patient During Acute Bronchospasm

    Science.gov (United States)

    Arshad, Hafiza; Khan, Rana Rahel; Khaja, Misbahuddin

    2017-01-01

    Patient: Female, 33 Final Diagnosis: S1Q3T3 electrocardiographic abnormality in a pregnant asthmatic during acute bronchospasm Symptoms: Cough • shortness of breath Medication: — Clinical Procedure: EKG Specialty: Pulmonology Objective: Rare co-existance of disease or pathology Background: Asthma is the most common chronic pulmonary disease during pregnancy. Several previous reports have documented reversible electrocardiographic changes during severe acute asthma attacks, including tachycardia, P pulmonale, right bundle branch block, right axis deviation, and ST segment and T wave abnormalities. Case Report: We present the case of a pregnant patient with asthma exacerbation in which acute bronchospasm caused S1Q3T3 abnormality on an electrocardiogram (ECG). The complete workup of ECG findings of S1Q3T3 was negative and correlated with bronchospasm. The S1Q3T3 electrocardiographic abnormality can be seen in acute bronchospasm in pregnant women. The other causes like pulmonary embolism, pneumothorax, acute lung disease, cor pulmonale, and left posterior fascicular block were excluded. Conclusions: Asthma exacerbations are of considerable concern during pregnancy due to their adverse effect on the fetus, and optimization of asthma treatment during pregnancy is vital for achieving good outcomes. Prompt recognition of electrocardiographic abnormality and early treatment can prevent adverse perinatal outcomes. PMID:28144025

  6. Near infrared rubidium 62P3/2,1/2→62S1/2 laser

    Science.gov (United States)

    Moran, Paul J.; Richards, Ryan M.; Rice, Christopher A.; Perram, Glen P.

    2016-09-01

    An optically pumped near infrared rubidium (Rb) pulsed, mirrorless laser has been demonstrated in a heat pipe along both the 62P3/2-62S1/2 transition at 2.73 μm and the 62P1/2-62S1/2 transition at 2.79 μm. The bleached limit, slope efficiency, and maximum laser output energy of the near infrared Rb laser scale linearly with increasing Rb density, contrary to prior results. Previously, a maximum output energy of ~5 nJ had been observed before a rollover occurred in the scaling of output energy with rubidium concentration. In this experiment, the maximum laser output energy observed was ~100 nJ, with no indication of any scaling limitation. A maximum slope efficiency of 1.7×10-4 was observed. A small percentage of the pump photons were absorbed even at the maximum Rb density attainable in the heat pipe, indicating that laser efficiency could be scaled to near the quantum efficiency. Additionally, the hyperfine structure and absorption spectral profile of the 52S1/2-62P1/2 and 52S1/2-62P3/2 (blue) pump transitions were studied using a cw pump source.

  7. Femtosecond dynamics of the S2 and S1 fluorescence of ionic styryl dyes in polar solvents

    NARCIS (Netherlands)

    H. Wang; W. Rettig; A.I. Tolmachev; M. Glasbeek

    2004-01-01

    Femtosecond fluorescence upconversion and picosecond time-correlated single-photon counting fluorescence experiments for bridged and unbridged ionic styryl dye compounds in polar solvents are reported. The measured fluorescence transients reveal S2 S1 internal conversion (IC) with a typical time of

  8. Search for excited electrons in p(p)over-bar collisions at root s=1.96 TeV

    NARCIS (Netherlands)

    Abazov, V.M.; et al., [Unknown; de Jong, S.J.; Demarteau, M.; Houben, P.; van den Berg, P.J.

    2008-01-01

    We present the results of a search for the production of an excited state of the electron, e(*), in proton-antiproton collisions at root s = 1.96 TeV. The data were collected with the D0 experiment at the Fermilab Tevatron Collider and correspond to an integrated luminosity of approximately 1 fb(-1)

  9. A combined search for the standard model Higgs boson at root s=1.96 TeV

    NARCIS (Netherlands)

    Abazov, V.M.; et al., [Unknown; de Jong, S.J.; Demarteau, M.; Houben, P.; van den Berg, P.J.

    2008-01-01

    We present new results of the search for WH --> lvb (b) over bar production in p (p) over bar collisions at a center-of-mass energy of root s = 1.96 TeV, based on a dataset with integrated luminosity of 0.44 fb(-1). We combine these new results with previously published searches by the DO collaborat

  10. Contralateral interlaminar approach for intraforaminal lumbar degenerative disease with special emphasis on L5-S1 level: A technical note

    Science.gov (United States)

    Zekaj, Edvin; Menghetti, Claudia; Saleh, Christian; Isidori, Alessandra; Bona, Alberto R.; Aimar, Enrico; Servello, Domenico

    2016-01-01

    Background: Intraforaminal disc herniations at the L5-S1 level are extremely surgically challenging lesions. Intracanal approaches frequently require partial or total facetectomy, which may lead to instability. Solely extraforaminal approaches may offer limited visualization of the more medial superiorly exiting and inferiorly exiting nerve roots; this approach is also more complicated at L5-S1 due to the often large L5 transverse process and the iliac wing. Methods: Nine patients with intraforaminal L5-S1 disc herniations, foraminal stenosis, or synovial cysts underwent contralateral interlaminar approaches for lesion resection. Preoperative and postoperative visual analog scale scores were evaluated, and complications were reviewed. Results: All 9 patients demonstrated immediate postoperative clinical improvement. None of the patients exhibited complications and none developed instability or neuropathic disorders. Conclusions: Although the number of cases in our sample was very small (9 in total), the contralateral interlaminar approach appeared to effectively address multiple degenerative L5-S1 foraminal pathologies. Large studies are needed to further evaluate the pros and cons of this approach. PMID:27713854

  11. Magnetic excitation spectrum of the square lattice S=1/2 Heisenberg antiferromagnet K2V3O8

    DEFF Research Database (Denmark)

    Lumsden, M.D.; Nagler, S.E.; Sales, B.C.;

    2006-01-01

    We have explored the magnetic excitation spectrum of the S=1/2 square lattice Heisenberg antiferromagnet, K2V3O8, using both triple-axis and time-of-flight inelastic neutron scattering. The long-wavelength spin waves are consistent with the previously determined Hamiltonian for this material...

  12. Large-scale response of the Eastern Mediterranean thermohaline circulation to African monsoon intensification during sapropel S1 formation

    Science.gov (United States)

    Tesi, T.; Asioli, A.; Minisini, D.; Maselli, V.; Dalla Valle, G.; Gamberi, F.; Langone, L.; Cattaneo, A.; Montagna, P.; Trincardi, F.

    2017-03-01

    The formation of Eastern Mediterranean sapropels has periodically occurred during intensification of northern hemisphere monsoon precipitation over North Africa. However, the large-scale response of the Eastern Mediterranean thermohaline circulation during these monsoon-fuelled freshening episodes is poorly constrained. Here, we investigate the formation of the youngest sapropel (S1) along an across-slope transect in the Adriatic Sea. Foraminifera-based oxygen index, redox-sensitive elements and biogeochemical parameters reveal - for the first time - that the Adriatic S1 was synchronous with the deposition of south-eastern Mediterranean S1 beds. Proxies of paleo thermohaline currents indicate that the bottom-hugging North Adriatic Dense Water (NAdDW) suddenly decreased at the sapropel onset simultaneously with the maximum freshening of the Levantine Sea during the African Humid Period. We conclude that the lack of the "salty" Levantine Intermediate Water hampered the preconditioning of the northern Adriatic waters necessary for the NAdDW formation prior to the winter cooling. Consequently, a weak NAdDW limited in turn the Eastern Mediterranean Deep Water (EMDWAdriatic) formation with important consequences for the ventilation of the Ionian basin as well. Our results highlight the importance of the Adriatic for the deep water ventilation and the interdependence among the major eastern Mediterranean water masses whose destabilization exerted first-order control on S1 deposition.

  13. P/2008 CL94 (Lemmon) and P/2011 S1 (Gibbs): comet-like activity at large heliocentric distances

    Science.gov (United States)

    Kulyk, I.; Korsun, P.; Rousselot, P.; Afanasiev, V.; Ivanova, O.

    2016-06-01

    Based on spectroscopic and photometric observations we analyzed the dust environment of two minor distant objects, P/2008 CL94 (Lemmon) and P/2011 S1 (Gibbs). Both targets demonstrated the comet-like activity beyond the "zone of water-ice sublimation". Meanwhile the spectrum of P/2008 CL94 (Lemmon) did not reveal molecular emission features above reflected continuum in a spectral region of 4100-6800Å. Reddening of the continuum is linear along the dispersion with the mean normalized reflectivity gradient equals to 2.0% ± 0.4%. The normalized reflectivity of P/2011 S1 (Gibbs) derived from the V-R and R-I color indices equals 11% ± 9% and 26% ± 6% respectively. Both objects have likely small nuclei (about 2 and 4 km in the radii for P/2008 CL94 and P/2011 S1 respectively), which are consistent with nucleus sizes of 'Jupiter-family' comets. The level of physical activity of P/2008 CL94 and S/2011 S1 is characterized by R-Afρ quantity of 106 ± 3 cm and 76 ± 8 cm respectively. The Afρ values are resulted in dust production rates of about 1-2 kg/s, assuming the average geometric albedo of grains of 0.1 and the dust outflow velocities between 1 and 10 m/s.

  14. Rigid Holography and Six-Dimensional N=(2,0) Theories on AdS_5 times S^1

    CERN Document Server

    Aharony, Ofer; Rey, Soo-Jong

    2015-01-01

    Field theories on anti-de Sitter (AdS) space can be studied by realizing them as low-energy limits of AdS vacua of string/M theory. In an appropriate limit, the field theories decouple from the rest of string/M theory. Since these vacua are dual to conformal field theories (CFTs), this relates some of the observables of these field theories on AdS to a subsector of the dual CFTs. We exemplify this `rigid holography' by studying in detail the 6d N=(2,0) A_{K-1} superconformal field theory (SCFT) on AdS_5xS^1, with equal radii for AdS_5 and for S^1. We choose specific boundary conditions preserving sixteen supercharges that arise when this theory is embedded into Type IIB string theory on AdS_5xS^5/Z_K. On R^{4,1}xS^1, this 6d theory has a 5(K-1)-dimensional moduli space, with unbroken 5d SU(K) gauge symmetry at (and only at) the origin. On AdS_5xS^1, the theory has a 2(K-1)-dimensional `moduli space' of supersymmetric configurations. We argue that in this case the SU(K) gauge symmetry is unbroken everywhere in...

  15. Molecular components in $\\mathbf{D_{s0}^{\\ast}(2317)}$ and $\\mathbf{D_{s1}(2460)}$ mesons

    CERN Document Server

    Ortega, Pablo G; Entem, David R; Fernández, Francisco

    2016-01-01

    Different experiments have confirmed that the $D_{s0}^{\\ast}(2317)$ and $D_{s1}(2460)$ mesons are very narrow states located, respectively, below the $DK$ and $D^{\\ast}K$ thresholds. This is markedly in contrast with the expectations of naive quark models and heavy quark symmetry. We address the mass shifts of the $c\\bar{s}$ ground states with quantum numbers $J^{P}=0^{+}$ ($D_{s0}^{\\ast}(2317)$) and $J^{P}=1^{+}$ ($D_{s1}(2460)$) using a nonrelativistic constituent quark model in which quark-antiquark and meson-meson degrees of freedom are incorporated. The quark model has been applied to a wide range of hadronic observables and thus the model parameters are completely constrained. We observe that the coupling of the $0^{+}$ $(1^{+})$ meson sector to the $DK$ $(D^{\\ast}K)$ threshold is a key feature in lowering the masses of the corresponding $D_{s0}^{\\ast}(2317)$ and $D_{s1}(2460)$ states predicted by the naive quark model, but also in describing the $D_{s1}(2536)$ meson as the $1^{+}$ state of the $j_{q}^{...

  16. Quantification of the beta-adrenoceptor ligand S-1'[F-18]fluorocarazolol in plasma of humans, rats and sheep

    NARCIS (Netherlands)

    vanWaarde, A; Posthumus, H; Elsinga, PH; Anthonio, RL; van Loenen - Weemaes, Anne-miek; Beaufort-Krol, Gertie C. M.; Paans, AMJ; Vaalburg, W; Visser, Thomas; Visser, Gerben

    1996-01-01

    Myocardial and pulmonary beta-adrenoceptors can be imaged with 2-(S)-(-)-(9H-carbazol-4-yl-oxy)-3-[1-(fluoromethyl)ethyl]amino-2-propanol (S-1'-[F-18]fluorocarazolol, I). Quantification of unmodified fluorocarazolol in plasma is necessary for analysis of PET images in terms of receptor densities. We

  17. Long-term results of definitive concurrent chemoradiotherapy using S-1 in the treatment of geriatric patients with esophageal cancer

    Directory of Open Access Journals (Sweden)

    Lv S

    2016-09-01

    Full Text Available Shiliang Lv, Min Fang, Jia Yang, Wenming Zhan, Yongshi Jia, Hong’en Xu, Tao Song Department of Radiotherapy, Zhejiang Provincial People’s Hospital, Hangzhou, Zhejiang, People’s Republic of China Objective: The aim of this study was to investigate the efficiency and safety of using S-1 as monotherapy and maintenance therapy combined with definitive concurrent radiotherapy for elderly patients with esophageal cancer.Patients and methods: From January 2009 to December 2010, 68 elderly patients were included. Radiotherapy was delivered with a daily fraction of 1.8–2.0 Gy to a total radiation dose of 54.0–60.0 Gy. Preplanned concurrent S-1 (80 mg/m2/d was given on days 1–14, every 3 weeks. After concurrent chemoradiotherapy, maintenance S-1 was repeated up to four cycles.Results: The median age of the enrolled patients was 76 years (range: 70–88 years, and the clinical stages were stage I (two patients, stage II (24 patients, stage III (28 patients, and stage IV (14 patients. A total of 51 (75.0% patients finished treatment on schedule, with a median of five cycles of S-1, in which 35 (51.5% patients achieved complete response. The median follow-up time was 42.7 months, and the median overall survival (OS and progression-free survival (PFS times were 25.7 months and 21.5 months, respectively. The 1-year, 3-year, and 5-year OS and PFS rates were 70.6%, 41.8%, and 25.9% and 68.1%, 32.9%, and 15.9%, respectively. Grade ≥3 neutropenia and leukopenia were found in 14 patients and 13 patients, respectively. The most common nonhematologic toxicity was esophagitis including six patients and one patient with grades 3 and 4, respectively. Multivariate analysis revealed that cycles of S-1 and complete response were strong factors for OS and PFS.Conclusion: For geriatric patients with esophageal cancer, S-1 as monotherapy and maintenance chemotherapy in combination with definitive concurrent radiation therapy yielded satisfactory

  18. Psoriasin: a novel chemotactic protein

    DEFF Research Database (Denmark)

    Jinquan, T; Vorum, H; Larsen, C G;

    1996-01-01

    calcium-binding protein (psoriasin, molecular mass 11,457 Da, pI 6.77) belonging to the S1OO family that is highly upregulated in psoriatic keratinocytes and whose expression patterns implied a role in the inflammatory response. Here we report that human psoriasin is a potent and selective chemotactic...... inflammatory protein for CD4+ T lymphocytes and neutrophils at concentrations of about 10(-11) M. Psoriasin is not structurally related to the alpha or the beta chemokine subfamilies or to lymphotactin, a member of a newly described class of chemokines. Thus, we have observed a chemotactic protein outside...

  19. Protein-protein interactions

    DEFF Research Database (Denmark)

    Byron, Olwyn; Vestergaard, Bente

    2015-01-01

    Responsive formation of protein:protein interaction (PPI) upon diverse stimuli is a fundament of cellular function. As a consequence, PPIs are complex, adaptive entities, and exist in structurally heterogeneous interplays defined by the energetic states of the free and complexed protomers....... The biophysical and structural investigations of PPIs consequently demand hybrid approaches, implementing orthogonal methods and strategies for global data analysis. Currently, impressive developments in hardware and software within several methodologies define a new era for the biostructural community. Data can...

  20. Excited-state kinetics of the carotenoid S//1 state in LHC II and two-photon excitation spectra of lutein and beta-carotene in solution Efficient Car S//1 yields Chl electronic energy transfer via hot S//1 states?

    CERN Document Server

    Walla, P J; Linden, Patricia A; Ohta, Kaoru

    2002-01-01

    The excited-state dynamics of the carotenoids (Car) in light- harvesting complex II (LHC II) of Chlamydomonas reinhardtii were studied by transient absorption measurements. The decay of the Car S //1 population ranges from similar to 200 fs to over 7 ps, depending on the excitation and detection wavelengths. In contrast, a 200 fs Car S//1 yields Chlorophyll (Chl) energy transfer component was the dominant time constant for our earlier two-photon fluorescence up- conversion measurements (Walla, P.J. ; et al. J. Phys. Chem. B 2000, 104, 4799-4806). We also present the two-photon excitation (TPE) spectra of lutein and beta-carotene in solution and compare them with the TPE spectrum of LHC II. The TPE-spectrum of LHC II has an onset much further to the blue and a width that is narrower than expected from comparison to the S//1 fluorescence of lutein and beta-carotene in solution. Different environments may affect the shape of the S//1 spectrum significantly. To explain the blue shift of the TPE spectrum and the d...

  1. The efficacy and safety of S-1-based regimens in the first-line treatment of advanced gastric cancer : a systematic review and meta-analysis

    NARCIS (Netherlands)

    Ter Veer, Emil; Mohammad, Nadia Haj; Lodder, Paul; Ngai, Lok Lam; Samaan, Mary; van Oijen, Martijn G H; van Laarhoven, Hanneke W M

    2016-01-01

    BACKGROUND: S-1 is first-line therapy for advanced gastric cancer in Asia and is used with increased frequency in Western counties. We conducted a meta-analysis to investigate the efficacy and toxicity of S-1-based therapy compared with 5-fluorouracil (5-FU)/capecitabine-based therapy and S-1-based

  2. Differential Effects of Long Term FTY720 Treatment on Endothelial versus Smooth Muscle Cell Signaling to S1P in Rat Mesenteric Arteries

    NARCIS (Netherlands)

    Shishavan, Mahdi Hamidi; Bidadkosh, Arash; Yazdani, Saleh; Lambooy, Sebastiaan; van den Born, Jacob; Buikema, Hendrik; Henning, Robert H.; Deelman, Leo E.

    2016-01-01

    The sphingosine-1-phosphate (S1P) analog FTY720 exerts pleiotropic effects on the cardiovascular system and causes down-regulation of S1P receptors. Myogenic constriction is an important mechanism regulating resistance vessel function and is known to be modulated by S1P. Here we investigated

  3. The promoter-terminator of chrysanthemunm rbcS1 directs very high expression levels in plants

    NARCIS (Netherlands)

    Outchkourov, N.S.; Peters, J.; Jong, de J.; Rademakers, W.; Ongsma, M.A.

    2003-01-01

    Transgenic plants are increasingly used as production platforms for various proteins, yet protein expression levels in the range of the most abundant plant protein, ribulose-1,5-bisphosphate carboxylase have not yet been achieved by nuclear transformation. Suitable gene regulatory 5' and 3' elements

  4. 棘阿米巴CB/S1内共生细菌的超微结构%Ultrastructure of Endosymbiont of Acanthamoeba sp.CB/S1 Isolated from Soil of China

    Institute of Scientific and Technical Information of China (English)

    延根; 郑善子; 玄英花

    2012-01-01

    目的:观察棘阿米巴内共生细菌的超微结构.方法:用地衣红-卡红染色确认棘阿米巴土壤分离株CB/S1内存在共生细菌,在透射电镜下观察其超微结构.结果:透射电镜下可见在棘阿米巴胞质内不规则分布的共生细菌,呈棒状,具有双层膜,膜外附着许多棘阿米巴宿主的核糖体.结论:内共生细菌的存在对宿主阿米巴的结构没有引起特殊的改变.%Objective: To observe the ultrastructure of bacterial endosymbiont of Acanthamoeba sp. CB/ SI. Methods; The endosymbionts of Acanthamoeba CB/S1 isolated from soil of China were characterized by orcein-stain under transmission electron microscopic examination. Results: Double membrane bound and rod-shaped endosymbionts were randomly distributed in trophozoites of Acanthamoeba isolate. The bacterial cell walls of endosymbionts of Acanthamoeba CB/S1 were studded with host ribosomes. Conclusion: Rode-shaped endosymbionts were randomly distributed within the cytoplasm of trophozoite of Acanthamoeba sp. CB/S1. The endosymbionts have double membranes, and the bacterial cell surfaces are studded with a number of host cell ribosomes. No specific feature could be observed within the amoeba.

  5. Investigation of two-color magneto-optical trap with cesium 6S1/2-6P3/2-7S1/2 ladder-type system

    CERN Document Server

    Wang, Jie; Yang, Baodong; He, Jun; Wang, Junmin

    2016-01-01

    A novel cesium (Cs) two-color magneto-optical trap (TC-MOT), which partially employs the optical radiation forces due to photon scattering of the 6P3/2 (F'=5) - 7S1/2 (F"=4) excited-state transition in the Cs 6S1/2 - 6P3/2 - 7S1/2 (852 + 1470 nm) ladder-type system, has been proposed and experimentally investigated. One of the three pairs of 852 nm cooling/trapping beams (CTBs) in a conventional Cs MOT is replaced with a pair of the 1470 nm CTBs (type-I) or with one 852 nm CTB plus another counter-propagating 1470 nm CTB (type-II). Both the type-I and type-II Cs TC-MOTs can cool and trap atoms on both the red- and blue-detuning sides of the two-photon resonance. The Cs TC-MOT demonstrated in this work may have applications in the background-free detection of cooled and trapped atoms, and the photon-pair sources compatible with the ensemble-based quantum memory and the long-distance quantum communication via optical fiber.

  6. Half-metallic properties of CoS2, doped CoN0.25S1.75 and CoP0.25S1.75

    Science.gov (United States)

    Zhao, Jin-Yang; Zhang, Jian-Min

    2017-08-01

    We use first-principles calculations to investigate the half-metallicity of pure \\text{Co}{{\\text{S}}2} , doped \\text{Co}{{\\text{N}}0.25}{{\\text{S}}1.75} and \\text{Co}{{\\text{P}}0.25}{{\\text{S}}1.75} systems. The results show that the conduction bands minimum (CBM) of pure \\text{Co}{{\\text{S}}2} is mainly contributed by the low intensity state of S \\text{pp}{σ\\ast} in the spin-down channel. The S \\text{pp}{σ\\ast} state extends below the Fermi level (E F) and destroys the half-metallicity of \\text{Co}{{\\text{S}}2} , rather than Co-{{e}\\text{g\\downarrow}} states proposed previously. Replacing sulfur (S) with nitrogen (N) reduces the bandwidth of the S (N) \\text{pp}{σ\\ast} bands and destroys the continuous S \\text{pp}{σ\\ast} network, as a result the bottom of the S \\text{pp}{σ\\ast} band shifts upward above the bottom of the Co-{{e}\\text{g\\downarrow}} band and makes the \\text{Co}{{\\text{N}}0.25}{{\\text{S}}1.75} a perfect half metal ferromagnet (HMF) and a promising candidate for spintronic devices.

  7. Metastatic triple-negative breast cancer is dependent on SphKs/S1P signaling for growth and survival.

    Science.gov (United States)

    Maiti, Aparna; Takabe, Kazuaki; Hait, Nitai C

    2017-04-01

    About 40,000 American women die from metastatic breast cancer each year despite advancements in treatment. Approximately, 15% of breast cancers are triple-negative for estrogen receptor, progesterone receptor, and HER2. Triple-negative cancer is characterized by more aggressive, harder to treat with conventional approaches and having a greater possibility of recurrence. Sphingosine-1-phosphate (S1P) is a bioactive sphingolipid signaling mediator has emerged as a key regulatory molecule in breast cancer progression. Therefore, we investigated whether cytosolic sphingosine kinase type 1 (SphK1) and nuclear sphingosine kinase type 2 (SphK2), the enzymes that make S1P are critical for growth and PI3K/AKT, ERK-MAP kinase mediated survival signaling of lung metastatic variant LM2-4 breast cancer cells, generated from the parental triple-negative MDA-MB-231 human breast cancer cell line. Similar with previous report, SphKs/S1P signaling is critical for the growth and survival of estrogen receptor positive MCF-7 human breast cancer cells, was used as our study control. MDA-MB-231 did not show a significant effect of SphKs/S1P signaling on AKT, ERK, and p38 pathways. In contrast, LM2-4 cells that gained lung metastatic phenotype from primary MDA-MB-231 cells show a significant effect of SphKs/S1P signaling requirement on cell growth, survival, and cell motility. PF-543, a selective potent inhibitor of SphK1, attenuated epidermal growth factor (EGF)-mediated cell growth and survival signaling through inhibition of AKT, ERK, and p38 MAP kinase pathways mainly in LM2-4 cells but not in parental MDA-MB-231 human breast cancer cells. Moreover, K-145, a selective inhibitor of SphK2, markedly attenuated EGF-mediated cell growth and survival of LM2-4 cells. We believe this study highlights the importance of SphKs/S1P signaling in metastatic triple-negative breast cancers and targeted therapies.

  8. Detection and phylogenetic analysis of porcine epidemic diarrhea virus in central China based on the ORF3 gene and the S1 gene.

    Science.gov (United States)

    Su, Yunfang; Liu, Yunchao; Chen, Yumei; Zhao, Baolei; Ji, Pengchao; Xing, Guangxu; Jiang, Dawei; Liu, Chang; Song, Yapeng; Wang, Guoqiang; Li, Dongliang; Deng, Ruiguang; Zhang, Gaiping

    2016-11-25

    Porcine epidemic diarrhea (PED) has increased in severity in China since 2010. To investigate further the infectivity, genetic diversity and molecular epidemiology of its causative agent, the porcine epidemic diarrhea virus (PEDV), we assessed 129 clinical samples, which were the intestinal tissue of piglets with severe diarrhea, from 17 cities in central China. Both the spike (S) glycoprotein (S1, 1-789 amino acids (aa)) and the full-length ORF3 gene of 21 representative field strains from 21 farms in 11 cities were sequenced and analysed. PEDV was detected by reverse transcription-polymerase chain reaction (RT-PCR), and S1 and ORF3 sequences were processed by the Clustal W method via DNAMAN 8 software, and phylogenetic trees were constructed by the neighbor-joining method using MEGA 6 software. The prevalence of PEDV was 92.25% and was detected in 119 of 129 samples, with 94.03% (63 of 67) of pig farms harbouring the disease. According to the phylogenetic analysis of the S1 genes, our isolates all fell into group G2 (variants) and showed a close relationship to isolates from Chinese (HN1303, CH/ZMDZY/11 and AJ1102), Korean (AD01), American (MN, IA1, IA2 and 13-019349) sources, and these isolates differed genetically from other Chinese (LZC, CH/HNZZ/2011 and SD-M) and Korean (SM98) strains as well Japanese (83-P5 and MK) strains. In addition, our isolates differed from attenuated vaccine strains, CV777 (used in China) and DR13 (used in Korea). According to our derived amino acid sequence analysis, we detected one novel variant PEDV, viz: CH/HNLY, with 4-aa insertion/deletion (RSSS/T) at position 375 and 1-aa (D) deletion at position 430 compared to the CV777 attenuated strain. These mutations were located on the receptor binding domain. Our ORF3 gene analyses showed that the prevalent PEDV isolates were variants, and the isolated strains differed genetically from the vaccine strains. These findings illustrated the existence of genetic diversity among

  9. Tumor suppressor PRSS8 targets Sphk1/S1P/Stat3/Akt signaling in colorectal cancer

    Science.gov (United States)

    Wang, Qian; Li, Zexin; Yang, Yiqiong; Chen, Zhiguo; Wang, Jianguo; Zhao, Weixing; Zhang, Huijuan; Chen, Jiwang; Dong, Huali; Shen, Kui; Diamond, Alan M.; Yang, Wancai

    2016-01-01

    PRSS8 is a membrane-anchored serine protease prostasin and has been shown an association with carcinogenesis. Herein we found that PRSS8 expression was significantly reduced in colorectal adenomas and adenocarcinomas. The decreased PRSS8 was well correlated with clinical stages, poor differentiation and shorter survival time of colorectal cancer. Furthermore, increase of PRSS8 led to the inhibition of colorectal cancer cell proliferation, knockdown of PRSS8 accelerated cell proliferation in vitro, and overexpressing PRSS8 retarded cancer cell growth in nude mice. Mechanistic studies revealed that PRSS8 inhibited Sphk1/S1P/Stat3/Akt signaling pathway, in terms of inverse association between PRSS8 and Sphk1 in human colorectal cancers and in Sphk1-/− mice. In conclusion, PRSS8 acts as a tumor suppressor by inhibiting Sphk1/S1P/Stat3/Akt signaling pathway, and could be used as a biomarker to monitor colorectal carcinogenesis and predict outcomes. PMID:27050145

  10. The analysis of spinopelvic parameters and stability following long fusions with S1, S2 or iliac fixation.

    Science.gov (United States)

    Baek, Seung-Wook; Park, Ye-Soo; Ha, Kee-Yong; Suh, Seung Woo; Kim, Cheol

    2013-10-01

    The purpose of this study was to analyse changes of spinopelvic parameters and stability in the treatment of degenerative lumbar deformity. A retrospective review was carried out on 70 cases of degenerative lumbar deformity treated by long fusion with uni-cortical S1 fixation alone (US1F group, n = 20), bi-cortical S1 fixation alone (BS1F group, n = 20), additional diagonal S2 fixation (DS2F group, n = 14), and additional iliac fixation (ILF group, n = 16) from July 2003 to April 2010. The sagittal vertical axis (SVA), lumbar lordosis (LL), sacral slope (SS), pelvic tilt (PT), pelvic incidence (PI), and stability were used to evaluate radiologic outcomes. The clinical outcome was evaluated using the Oswestry Disability Index (ODI). In all groups, the LL was significantly increased at three months (p stability compared to US1F and BS1F (p stability of distal instruments.

  11. Synthesis and coloring properties of Cd(S1-xSex)pigments by precipitate-hydrothermal method

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Cd(S1-xSex) pigments (red to yellow) were synthesized by precipitate-hydrothermal method.The structure,morphology and hue of the powder were characterized by X-ray diffractometry (XRD),scanning electron microscopy (SEM),energy dispersive X-ray spectroscopy (EDAX) and CIE chromaticity.The optimum synthesis conditions were obtained and reaction mechanism was further analyzed as well.The results show that molar ratio of S to Se,pH value and hydrothermal reaction conditions have great effects on the hues of the pigments.Pigments with vivid hues are obtained under the conditions that pH value is about 13.0,hydrothermal reaction condition is at 140 ℃ for 4 h or at 160 ℃ for 6 h.The reaction mechanism is that Se2- of Cd(S1-xSex)substitutes S2- of CdS and then forms a continuous solid solution.

  12. S-Rich CdS1−yTey Thin Films Produced by the Spray Pyrolysis Technique

    Directory of Open Access Journals (Sweden)

    Shadia J. Ikhmayies

    2016-03-01

    Full Text Available Understanding the properties of CdSTe ternary alloys is important because they always form at the interface between the CdS window layer and CdTe absorber layer in CdS/CdTe solar cells due to the intermixing. This interdiffusion is necessary because it improves the device performance. Experimental work has been devoted to studying Te rich p-type CdSxTe1−x alloys, but there is a lack of studies on S-rich n-type CdS1−yTey solid solutions. In this work, a review of the structure, morphology, and optical properties of the S-rich n-type CdS1−yTey thin films produced by the spray pyrolysis technique on glass substrates is presented.

  13. Forward Muon Production in $p\\bar{p}$ Collisions at $\\sqrt{s}$ = 1.8-TeV

    Energy Technology Data Exchange (ETDEWEB)

    Skarha, John Erwin [Univ. of Wisconsin, Madison, WI (United States)

    1989-01-01

    Results of the analysis of forward-produced (1.95 < $\\mid \\eta \\mid$ < 2.80) muons from $\\bar{p}p$ collisions at $\\sqrt{s}$ = 1.8 Te V are presented. The data sample was collected during the 1987 run of the CDF detector at the Fermilab Tevatron collider and corresponds to an integrated luminosity of 0.80 $nb^{-1}$. The inclusive forward muon PT spectrum is measured and compared to backgrounds. Several muon+jet events, consistent with the weak decay of the bottom quark, were found. In addition, from a luger data sample of 24.2 $nb^{-1}$, a candidate event for the first observation at $\\sqrt{s}$ = 1.8 TeV of the process $Z^O \\to \\mu^+ \\mu^-$ was discovered, where $Z^O$ is the uncharged mediator of the weak interaction.

  14. Search for first-generation scalar leptoquarks in ppbar collisions at $\\sqrt{s}$=1.96 TeV

    CERN Document Server

    Abazov, V M; Abolins, M; Acharya, B S; Adams, D L; Adams, M; Adams, T; Agelou, M; Agram, J L; Ahmed, S N; Ahn, S H; Alexeev, G D; Alkhazov, G; Alton, A; Alverson, G; Alves, G A; Anderson, S; Andrieu, B; Arnoud, Y; Askew, A; Åsman, B; Autermann, C; Avila, C; Babukhadia, L; Bacon, Trevor C; Baden, A; Baffioni, S; Baldin, B Yu; Balm, P W; Banerjee, S; Barberis, E; Bargassa, P; Baringer, P; Barnes, C; Barreto, J; Bartlett, J F; Bassler, U; Bauer, D; Bean, A; Beauceron, S; Beaudette, F; Begel, M; Beri, S B; Bernardi, G; Bertram, I; Besançon, M; Besson, A; Beuselinck, R; Bezzubov, V A; Bhat, P C; Bhatnagar, V; Bhattacharjee, M; Binder, M; Bischoff, A; Black, K M; Blackler, I; Blazey, G; Blekman, F; Bloch, D; Blumenschein, U; Böhnlein, A; Bolton, T; Bonamy, P; Borcherding, F; Borissov, G; Bos, K; Bose, T; Boswell, C; Brandt, A; Briskin, G; Brock, R; Brooijmans, G; Bross, A; Buchholz, D; Bühler, M; Büscher, V; Burdin, S; Burnett, T H; Busato, E; Butler, J M; Bystrický, J; Canelli, F; Carvalho, W; Casey, B C K; Casey, D; Cason, N M; Castilla-Valdez, H; Chakrabarti, S; Chakraborty, D; Chan, K M; Chandra, A; Chapin, D; Charles, F; Cheu, E; Chevalier, L; Cho, D K; Choi, S; Chopra, S; Christiansen, T; Christofek, L; Claes, D; Clark, A R; Clément, C; Coadou, Y; Colling, D J; Coney, L; Connolly, B; Cooper, W E; Coppage, D; Corcoran, M; Coss, J; Cothenet, A; Cousinou, M C; Crepe-Renaudin, S; Cristetiu, M; Cummings, M A C; Cutts, D; Da Motta, H; Davies, B; Davies, G; Davis, G A; De, K; de Jong, P; De Jong, S J; De La Cruz-Burelo, E; De Oliveira Martins, C; Dean, S; Del Signore, K; Déliot, F; Delsart, P A; Demarteau, M; Demina, R; Demine, P; Denisov, D; Denisov, S P; Desai, S; Diehl, H T; Diesburg, M; Doidge, M; Dong, H; Doulas, S; Duflot, L; Dugad, S R; Duperrin, A; Dyer, J; Dyshkant, A; Eads, M; Edmunds, D; Edwards, T; Ellison, J; Elmsheuser, J; Eltzroth, J T; Elvira, V D; Eno, S; Ermolov, P; Eroshin, O V; Estrada, J; Evans, D; Evans, H; Evdokimov, A; Evdokimov, V N; Fast, J; Fatakia, S N; Fein, D; Feligioni, L; Ferbel, T; Fiedler, F; Filthaut, F; Fisk, H E; Fleuret, F; Fortner, M; Fox, H; Freeman, W; Fu, S; Fuess, S; Galea, C F; Gallas, E; Galyaev, E; Gao, M; García, C; García-Bellido, A; Gardner, J; Gavrilov, V; Gelé, D; Gelhaus, R; Genser, K; Gerber, C E; Gershtein, Yu; Geurkov, G; Ginther, G; Goldmann, K S; Golling, T; Gómez, B; Gounder, K; Goussiou, A; Graham, G; Grannis, P D; Greder, S; Green, J A; Greenlee, H; Greenwood, Z D; Gregores, E M; Grinstein, S; Grivaz, J F; Groer, L S; Grünendahl, S; Grünewald, M W; Gu, W; Gurzhev, S N; Gutíerrez, G; Gutíerrez, P; Haas, A; Hadley, N J; Haggerty, H; Hagopian, S L; Hall, I; Hall, R E; Han, C; Han, L; Hanagaki, K; Hanlet, P; Harder, K; Hauptman, J M; Hauser, R; Hays, C; Hays, J; Hebert, C; Hedin, D; Heinmiller, J M; Heinson, A P; Heintz, U; Hensel, C; Hesketh, G; Hildreth, M D; Hirosky, R; Hobbs, J D; Hoeneisen, B; Hohlfeld, M; Hong, S J; Hooper, R; Hou, S; Hu, Y; Huang, J; Huang, Y; Iashvili, I; Illingworth, R; Ito, A S; Jabeen, S; Jaffré, M; Jain, S; Jain, V; Jakobs, K; Jenkins, A; Jesik, R; Jiang, Y; Johns, K; Johnson, M; Johnson, P; Jonckheere, A; Jonsson, P; Jöstlein, H; Juste, A; Kado, M; Käfer, D; Kahl, W; Kahn, S; Kajfasz, E; Kalinin, A M; Kalk, J; Karmanov, D; Kasper, J; Kau, D; Ke, Z; Kehoe, R; Kermiche, S; Kesisoglou, S; Khanov, A; Kharchilava, A I; Kharzheev, Yu M; Kim, K H; Klima, B; Klute, M; Kohli, J M; Kopal, M; Korablev, V; Kotcher, J; Kothari, B; Kotwal, A V; Koubarovsky, A; Kouchner, A; Kuznetsov, O; Kozelov, A V; Kozminski, J; Krane, J; Krishnaswamy, M R; Krzywdzinski, S; Kubantsev, M A; Kuleshov, S; Kulik, Y; Kunori, S; Kupco, A; Kurca, T; Kuznetsov, V E; Lager, S; Lahrichi, N; Landsberg, G L; Lazoflores, J; Le Bihan, A C; Lebrun, P; Lee, S W; Lee, W M; Leflat, A; Leggett, C; Lehner, F; Leonidopoulos, C; Lewis, P; Li, J; Li, Q Z; Li, X; Lima, J G R; Lincoln, D; Linn, S L; Linnemann, J T; Lipton, R; Lobo, L; Lobodenko, A A; Lokajícek, M; Lounis, A; Lü, J; Lubatti, H J; Lucotte, A; Lueking, L H; Luo, C; Lynker, M; Lyon, A L; Maciel, A K A; Madaras, R J; Magnan, A M; Maity, M; Mal, P K; Malik, S; Malyshev, V L; Manankov, V; Mao, H S; Maravin, Y; Marshall, T; Martens, M; Martin, M I; Mattingly, S E K; Mayorov, A A; McCarthy, R; McCroskey, R; McMahon, T; Meder, D; Melanson, H L; Melnitchouk, A S; Meng, X; Merkin, M; Merritt, K W B; Meyer, A; Miao, C; Miettinen, H; Mihalcea, D; Mishra, C S; Mitrevski, J; Mokhov, N V; Molina, J; Mondal, N K; Montgomery, H E; Moore, R W; Mostafa, M A; Muanza, G S; Mulders, M; Mutaf, Y D; Nagy, E; Nang, F; Narain, M; Narasimham, V S; Naumann, N A; Neal, H A; Negret, J P; Nelson, S; Neustroev, P; Nöding, C; Nomerotski, A; Novaes, S F; Nunnemann, T; Nurse, E; O'Dell, V; O'Neil, D C; Oguri, V; Oliveira, N; Olivier, B; Oshima, N; Oteroy-Garzon, G J; Padley, P; Papageorgiou, K; Parashar, N; Park, J; Park, S K; Parsons, J; Partridge, R; Parua, N; Patwa, A; Perea, P M; Pérez, E; Peters, O; Petroff, P; Petteni, M; Phaf, L K; Piegaia, R; Podesta-Lerma, P L M; Podstavkov, V M; Pope, B G; Popkov, E; Prado da Silva, W L; Prosper, H B; Protopopescu, S D; Przybycien, M B; Qian, J; Quadt, A; Quinn, B; Rani, K J; Rapidis, P A; Ratoff, P N; Reay, N W; Renardy, J F; Reucroft, S; Rha, J; Ridel, M; Rijssenbeek, M; Ripp-Baudot, I; Rizatdinova, F K; Royon, C; Rubinov, P; Ruchti, R; Sabirov, B M; Sajot, G; Sánchez-Hernández, A; Sanders, M P; Santoro, A F S; Savage, G; Sawyer, L; Scanlon, T; Schamberger, R D; Schellman, H; Schieferdecker, P; Schmitt, C; Schukin, A; Schwartzman, A; Schwienhorst, R; Sen-Gupta, S; Shabalina, E; Shary, V; Shephard, W D; Shpakov, D; Sidwell, R A; Simák, V; Sirotenko, V I; Skow, D; Slattery, P F; Smith, R P; Smolek, K; Snow, G R; Snow, J; Snyder, S; Söldner-Rembold, S; Song, X; Song, Y; Sonnenschein, L; Sopczak, A; Sorin, V; Sosebee, M; Soustruznik, K; Souza, M; Stanton, N R; Stark, J; Steele, J; Steinbruck, G; Stevenson, K; Stolin, V; Stone, A; Stoyanova, D A; Strandberg, J; Strang, M A; Strauss, M; Ströhmer, R; Strovink, M; Stutte, L; Sznajder, A; Talby, M; Tamburello, P; Taylor, W; Telford, P; Temple, J; Tentindo-Repond, S; Thomas, E; Thooris, B; Tomoto, M; Toole, T; Torborg, J; Towers, S; Trefzger, T; Trincaz-Duvoid, S; Trippe, T G; Tuchming, B; Turcot, A S; Tuts, P M; Uvarov, L; Uvarov, S; Uzunyan, S; Vachon, B; Van Kooten, R; Van Leeuwen, W M; Varelas, N; Varnes, E W; Vasilyev, I; Verdier, P; Vertogradov, L S; Verzocchi, M; Villeneuve-Séguier, F; Vlimant, J R; Von Törne, E; Vreeswijk, M; Vu-Anh, T; Wahl, H D; Walker, R; Wallace, N; Wang, Z M; Warchol, J; Warsinsky, M; Watts, G; Wayne, M; Weber, M; Weerts, H; Wegner, M; White, A; White, V; Whiteson, D; Wicke, D; Wijngaarden, D A; Wilson, G W; Wimpenny, S J; Wittlin, J; Wlodek, T; Wobisch, M; Womersley, J; Wood, D R; Wu, Z; Wyatt, T R; Xu, Q; Xuan, N; Yamada, R; Yasuda, T; Yatsunenko, Y A; Yen, Y; Yip, K; Youn, S W; Yu, J; Yurkewicz, A; Zabi, A; Zatserklyaniy, A; Zdrazil, M; Zeitnitz, C; Zhang, B; Zhang, D; Zhang, X; Zhao, T; Zhao, Z; Zheng, H; Zhou, B; Zhou, Z; Zhu, J; Zielinski, M; Zieminska, D; Zieminski, A; Zitoun, R; Zutshi, V; Zverev, E G; Zylberstejn, A

    2004-01-01

    We report on a search for pair production of first-generation scalar leptoquarks (LQ) in ppbar collisions at $\\sqrt{s}$=1.96 TeV using an integrated luminosity of 252pb-1 collected at the Fermilab Tevatron collider by the D0 detector. We observe no evidence for LQ production in the topologies arising from LQLQbar->eqeq and LQLQbar->eqnuq, and derive 95% C.L. lower limits on the LQ mass as a function of beta, where beta is the branching fraction for LQ->eq. The limits are 241 and 218 GeV/c2 for beta=1 and 0.5, respectively. These results are combined with those obtained by D0 at $\\sqrt{s}$=1.8 TeV, which increases these LQ mass limits to 256 and 234 GeV/c2.

  15. Reduced Dimension DVR Study of cis-trans Isomerization in the S_1 State of C_2H_2

    CERN Document Server

    Baraban, Joshua H; Steeves, Adam H; Stanton, John F; Field, Robert W

    2011-01-01

    Isomerization between the cis and trans conformers of the S1 state of acetylene is studied using a reduced dimension DVR calculation. Existing DVR techniques are combined with a high accuracy potential energy surface and a kinetic energy operator derived from FG theory to yield an effective but simple Hamiltonian for treating large amplitude motions. The spectroscopic signatures of the S1 isomerization are discussed, with emphasis on the vibrational aspects. The presence of a low barrier to isomerization causes distortion of the trans vibrational level structure and the appearance of nominally electronically forbidden \\~A1A2 \\leftarrow X 1{\\Sigma}+g transitions to vibrational levels of the cis conformer. Both of these effects are modeled in agreement with experimental results, and the underlying mechanisms of tunneling and state mixing are elucidated by use of the calculated vibrational wavefunctions.

  16. S1pr2/Gα13 signaling regulates the migration of endocardial precursors by controlling endoderm convergence.

    Science.gov (United States)

    Xie, Huaping; Ye, Ding; Sepich, Diane; Lin, Fang

    2016-06-15

    Formation of the heart tube requires synchronized migration of endocardial and myocardial precursors. Our previous studies indicated that in S1pr2/Gα13-deficient embryos, impaired endoderm convergence disrupted the medial migration of myocardial precursors, resulting in the formation of two myocardial populations. Here we show that endoderm convergence also regulates endocardial migration. In embryos defective for S1pr2/Gα13 signaling, endocardial precursors failed to migrate towards the midline, and the presumptive endocardium surrounded the bilaterally-located myocardial cells rather than being encompassed by them. In vivo imaging of control embryos revealed that, like their myocardial counterparts, endocardial precursors migrated with the converging endoderm, though from a more anterior point, then moved from the dorsal to the ventral side of the endoderm (subduction), and finally migrated posteriorly towards myocardial precursors, ultimately forming the inner layer of the heart tube. In embryos defective for endoderm convergence due to an S1pr2/Gα13 deficiency, both the medial migration and the subduction of endocardial precursors were impaired, and their posterior migration towards the myocardial precursors was premature. This placed them medial to the myocardial populations, physically blocking the medial migration of the myocardial precursors. Furthermore, contact between the endocardial and myocardial precursor populations disrupted the epithelial architecture of the myocardial precursors, and thus their medial migration; in embryos depleted of endocardial cells, the myocardial migration defect was partially rescued. Our data indicate that endoderm convergence regulates the medial migration of endocardial precursors, and that premature association of the endocardial and myocardial populations contributes to myocardial migration defects observed in S1pr2/Gα13-deficient embryos. The demonstration that endoderm convergence regulates the synchronized

  17. A Multicenter Phase II Trial of S-1 With Concurrent Radiation Therapy for Locally Advanced Pancreatic Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Ikeda, Masafumi, E-mail: masikeda@east.ncc.go.jp [Division of Hepatobiliary and Pancreatic Oncology, National Cancer Center Hospital East, Chiba (Japan); Ioka, Tatsuya [Department of Hepatobiliary and Pancreatic Oncology, Osaka Medical Center for Cancer and Cardiovascular Diseases, Osaka (Japan); Ito, Yoshinori [Department of Radiation Oncology, National Cancer Center Hospital, Tokyo (Japan); Yonemoto, Naohiro [Department of Epidemiology and Biostatistics, Translational Medical Center, National Center of Neurology and Psychiatry, Tokyo (Japan); Nagase, Michitaka [Department of Clinical Oncology, Jichi Medical University, Tochigi (Japan); Yamao, Kenji [Department of Gastroenterology, Aichi Cancer Center Hospital, Nagoya (Japan); Miyakawa, Hiroyuki [Department of Gastroenterology, Sapporo Kosei General Hospital, Sapporo (Japan); Ishii, Hiroshi [Hepatobiliary and Pancreatic Division, Cancer Institute Hospital, Tokyo (Japan); Furuse, Junji [Department of Internal Medicine, Medical Oncology School of Medicine, Kyorin University, Tokyo (Japan); Sato, Keiko [Kyoto Unit Center, Japan Environment and Children' s Study, Kyoto University Graduate School of Medicine, Kyoto (Japan); Sato, Tosiya [Department of Biostatistics, Kyoto University School of Public Health, Kyoto (Japan);