WorldWideScience

Sample records for sardinops sagax sebastes

  1. Annual ring validation of the south african sardine Sardinops sagax ...

    African Journals Online (AJOL)

    A total of 21 sardine Sardinops sagax otoliths, collected in winter and spring 1994, were examined with a scanning electron microscope to validate growth zones using daily growth increments. Increment numbers and widths for the first, second and third annual growth zones served to back-calculate hatching dates and to ...

  2. Characterisation of purified parvalbumin from five fish species and nucleotide sequencing of this major allergen from Pacific pilchard, Sardinops sagax.

    Science.gov (United States)

    Beale, Janine E; Jeebhay, Mohamed F; Lopata, Andreas L

    2009-09-01

    IgE-mediated allergic reaction to seafood is a common cause of food allergy including anaphylactic reactions. Parvalbumin, the major fish allergen, has been shown to display IgE cross-reactivity among fish species consumed predominantly in Europe and the Far East. However, cross-reactivity studies of parvalbumin from fish species widely consumed in the Southern hemisphere are limited as is data relating to immunological and molecular characterisation. In this study, antigenic cross-reactivity and the presence of oligomers and isomers of parvalbumin from five highly consumed fish species in Southern Africa were assessed by immunoblotting using purified parvalbumin and crude fish extracts. Pilchard (Sardinops sagax) parvalbumin was found to display the strongest IgE reactivity among 10 fish-allergic consumers. The cDNA sequence of the beta-form of pilchard parvalbumin was determined and designated Sar sa 1.0101 (accession number FM177701 EMBL/GenBank/DDBJ databases). Oligomeric forms of parvalbumin were observed in all fish species using a monoclonal anti-parvalbumin antibody and subject's sera. Isoforms varied between approximately 10-13 kDa. A highly cross-reactive allergenic isoform of parvalbumin was identified and sequenced, providing a successful primary step towards the generation of a recombinant form that could be used for diagnostic and potential therapeutic use in allergic individuals.

  3. Worldwide, where anchovies Engraulis spp. and sardine Sardinops ...

    African Journals Online (AJOL)

    spamer

    sardine Sardinops sagax co-occur, the two species alternate in relative ... of extinction in the wild within 100 years (Croxall et al. 1996). This paper ... Abundance of this fish decreased in the 1960s and early 1970s and it was replaced by ...

  4. Anchovy Engraulis capensis and sardine Sardinops sagax currently ...

    African Journals Online (AJOL)

    spamer

    Recruitment is thought to be determined largely by ... for forecasting recruitment strength. ..... In March and April, sustained upwelling wind events ... 2 Assumes average current velocities of 10–15 cm.s–1 in a west-north-westerly direction ...

  5. Although South African sardine (or pilchard, Sardinops sagax) were ...

    African Journals Online (AJOL)

    spamer

    was based on assumed reliability of the hydroacoustic estimates of ... of uncertainties about the value of natural mortality) .... TAC only) also to the estimate of sardine recruitment from the ... of sardine recruitment from that survey: rev ad rev.

  6. The southern African sardine Sardinops sagax (also known as ...

    African Journals Online (AJOL)

    denise

    CHANGES IN ABUNDANCE OF THE NORTHERN BENGUELA SARDINE STOCK. DURING THE ... date of young fish, using standard growth rates, indi- ... and catch per unit effort (cpue) is recognized to be a ... is developed, age-based assessment models cannot be ... The methods are described in various cruise reports.

  7. The southern African sardine Sardinops sagax supports major purse ...

    African Journals Online (AJOL)

    spamer

    be caused by environmental factors such as light level and currents, as well as by ... 2 Marine & Coastal Management, Department of Environmental Affairs and Tourism, Private Bag X2, Rogge Bay 8012, Cape Town,. South Africa. 3 Institut de ..... An impression, but one that was difficult to quantify, was that the detection rate ...

  8. The 2012 Joint U.S.-Canada Integrated Acoustic and Trawl Survey of Pacific Hake (Merluccius productus) and Pacific Sardine (Sardinops sagax) (SH1204, ME70)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Scientists from the Fishery Resource Analysis and Monitoring (FRAM) division at the NOAA Fisheries Northwest Fisheries Science Center (NWFSC), the Fishery Resources...

  9. 2012 Joint U.S.-Canada Integrated Acoustic and Trawl Survey of Pacific Hake (Merluccius productus) and Pacific Sardine (Sardinops sagax) (SH1204, EK60)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Scientists from the Fishery Resource Analysis and Monitoring (FRAM) division at the NOAA Fisheries Northwest Fisheries Science Center (NWFSC), the Fishery Resources...

  10. Costos metabólicos de Engraulis ringens y Sardinops sagax en relación al peso, temperatura y el nivel de actividad

    OpenAIRE

    Villavicencio R., Zoila; Muck, Peter

    1983-01-01

    El metabolismo estándar de la anchoveta es más alto que el de la sardina; en .las larvas por un factor promedio de 2.3 y por 2.1 en juveniles y adultos en el rango de temperaturas de 14-20ºC. Lo opuesto sucede en el metabolismo activo: para una velocidad de natación de un cuerpo por segundo( =metabolismo de rutina), la anchoveta adulta con un peso mayor de 20 g a 20ºC y mayor de 50 g a 14ºC gasta menos energía que la sardina de tamaños similares; incrementándose la velocidad a 3 c.p .seg a ...

  11. Cryptic Sebastes norvegicus species in Greenland waters revealed by microsatellites

    DEFF Research Database (Denmark)

    Saha, Atal; Hauser, Lorenz; Hedeholm, Rasmus

    2017-01-01

    Identification of cryptic species can have profound implications in fishery management, conservation and biodiversity contexts. In the North Atlantic, the genus Sebastes is currently represented by four species, although additional cryptic species have been assumed. The connectivity of the gene...

  12. JST Thesaurus Headwords and Synonyms: Sardinops melanostictus [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term Sardinops melanostictus 名詞 一般 * *... * * マイワシ マイワシ マイワシ Thesaurus2015 200906029174264192 C LS05 UNKNOWN_2 Sardinops melanostictus

  13. AFSC/ABL: Rockfish allozyme species identification (Sebastes aleutianus and borealis)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Rougheye rockfish (Sebastes aleutianus) and shortraker rockfish (Sebastes borealis) were collected from the Washington coast, the Gulf of Alaska, the southern Bering...

  14. A new trichosomoidid from the skin of Sebastes spp. (Pisces) from British Columbia, Canada

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Conboy, G. A.; Speare, D. J.

    2005-01-01

    Roč. 91, č. 2 (2005), s. 411-414 ISSN 0022-3395 R&D Projects: GA AV ČR IAA6022201 Institutional research plan: CEZ:AV0Z60220518 Keywords : Huffmanela * Sebastes * Canada Subject RIV: EA - Cell Biology Impact factor: 1.524, year: 2005

  15. Movements of blue rockfish (Sebastes mystinus off central California with comparisons to similar species.

    Directory of Open Access Journals (Sweden)

    Kristen M Green

    Full Text Available Olive (Sebastes serranoides, black (Sebastes melanops, and blue rockfish (Sebastes mystinus are all common inhabitants of nearshore ecosystems on the West coast of North America and important components of the recreational fishery off California. Acoustic monitoring studies indicate that olive rockfish are highly residential and that black rockfish are capable of long migrations and have less site fidelity; yet little is known about the long-term movements of blue rockfish. External tag-recapture studies indicate that blue rockfish may have intermediate movements relative to these congener nearshore species. To better understand the site fidelity, and daily and seasonal movements of blue rockfish over long (>1-year time scales, we placed acoustic transmitters into 21 adult blue rockfish (30-41 cm total length in Carmel Bay, California. Blue rockfish displayed intermediate movement patterns and residency relative to other similar kelp forest rockfish species. Two-thirds of tagged blue rockfish (13 fish exhibited high residency to the study area (>12 mo. When in residence, mean home range of blue rockfish was 0.23 km2, however as many as 30% of tagged blue rockfish shifted their core home range area during the study. Most shifts in home range occurred during upwelling season, and tagged fish moved up to 3.1 km when in residence. Blue rockfish with short residence times were last detected in the study area in late winter and early spring. Blue rockfish were observed at shallower depths during day than night, likely indicative of diurnal feeding. However, over longer time scales, blue rockfish were detected at deeper depths during upwelling periods and with increased wave heights. Daily and seasonal vertical movements of blue rockfish may be influenced by upwelling conditions and local prey abundance.

  16. Stomach Chitinase from Japanese Sardine Sardinops melanostictus: Purification, Characterization, and Molecular Cloning of Chitinase Isozymes with a Long Linker

    Directory of Open Access Journals (Sweden)

    Satoshi Kawashima

    2016-01-01

    Full Text Available Fish express two different chitinases, acidic fish chitinase-1 (AFCase-1 and acidic fish chitinase-2 (AFCase-2, in the stomach. AFCase-1 and AFCase-2 have different degradation patterns, as fish efficiently degrade chitin ingested as food. For a comparison with the enzymatic properties and the primary structures of chitinase isozymes obtained previously from the stomach of demersal fish, in this study, we purified chitinase isozymes from the stomach of Japanese sardine Sardinops melanostictus, a surface fish that feeds on plankton, characterized the properties of these isozymes, and cloned the cDNAs encoding chitinases. We also predicted 3D structure models using the primary structures of S. melanostictus stomach chitinases. Two chitinase isozymes, SmeChiA (45 kDa and SmeChiB (56 kDa, were purified from the stomach of S. melanostictus. Moreover, two cDNAs, SmeChi-1 encoding SmeChiA, and SmeChi-2 encoding SmeChiB were cloned. The linker regions of the deduced amino acid sequences of SmeChi-1 and SmeChi-2 (SmeChi-1 and SmeChi-2 are the longest among the fish stomach chitinases. In the cleavage pattern groups toward short substrates and the phylogenetic tree analysis, SmeChi-1 and SmeChi-2 were classified into AFCase-1 and AFCase-2, respectively. SmeChi-1 and SmeChi-2 had catalytic domains that consisted of a TIM-barrel (β/α8–fold structure and a deep substrate-binding cleft. This is the first study showing the 3D structure models of fish stomach chitinases.

  17. Effects of dietary chromium exposure to rockfish, Sebastes schlegelii are ameliorated by ascorbic acid.

    Science.gov (United States)

    Kim, Jun-Hwan; Kang, Ju-Chan

    2017-05-01

    Juvenile rockfish Sebastes schlegelii (mean length 10.8±1.4cm, and mean weight 31.7±3.6g) were exposed for 4 weeks with the different levels of dietary chromium (Cr 6+ ) at 0, 120 and 240mg/L and ascorbic acids (AsA) at 100, 200 and 400mg/L. Significant accumulation occurred in specific tissues and hematological parameters were altered: red blood cell count, hematocrit, and hemoglobin increased; plasma components were altered including calcium, glucose, cholesterol, total protein, glutamic oxalate transaminase, and glutamic pyruvate transaminase. However, magnesium and alkaline phosphatase concentrations were unchanged. Ascorbic acids reduced both chromium uptake into tissues and altered hematological parameters. Copyright © 2017. Published by Elsevier Inc.

  18. Characteristics of pathogenic Vibrio sp. isolated from the rockfish, Sebastes schlegeli

    International Nuclear Information System (INIS)

    Kim, Jong Hwa

    1995-02-01

    At the summer time, an infectious bacterial disease occurs and damages the net cage farms of rockfish (Sebastes schlegeli) at the western coast of Korea. The symptoms of this disease include darkness of body color, ulceration of skin, anemia of gill-filaments, and congestion of operculum. In order to know the attributes of pathogenicity of this disease, the study is performed with isolated bacteria from the rockfish sampled at the fish farm, located at Taean-gun Chungcheongnam-do, from June to September in 1994. The pathogenic bacteria cna be isolated from dermal lesion, kidney, liver, and spleen of the sick fish, and classified as Vibrio sp. based on the morphological, biological, and biochemical examinations. These isolates are proliferated in BTB teepol, TCBS, TSA, XA, BHIA, media, not in SS and MacConkey media, and the optimal growth conditions for NaCl concentration, pH, and temperature are 3%, 7∼8, and 25∼30 .deg. C, respectively. They turn out to be sensitive to three chemicals such as SXT (sulfamethoxazol + trimethoprim), nalidixic acid, and tetracycline, but resistant to ampicillin and penicillin G. Finally, the virulence of infectious bacteria is appeared at both 20 .deg. C and 27 .deg. C when isolated pathogenic strains are injected into the muscle of healthy rockfish

  19. Daily growth increments in otoliths of juvenile black rockfish, Sebastes melanops: an evaluation of autoradiography as a new method of validation

    International Nuclear Information System (INIS)

    Anon.

    1988-01-01

    This study evaluates the commonly used oxytetracycline hydrochloride (OTC) and an alternate chemical, the radioisotope calcium-45, in terms of their success as time-markers to validate daily growth increment formation in the otoliths of juvenile black rockfish, Sebastes melanops

  20. An integrative mating system assessment of a nonmodel, economically important Pacific rockfish (Sebastes melanops) reveals nonterritorial polygamy and conservation implications for a large species flock

    OpenAIRE

    Karageorge, Kurt W.; Wilson, Raymond R.

    2017-01-01

    Abstract Characterizing the mating systems of long‐lived, economically important Pacific rockfishes comprising the viviparous Sebastes species flock is crucial for their conservation. However, direct assignment of mating success to sires is precluded by open, offshore populations and high female fecundity. We addressed this challenge by integrating paternity‐assigned mating success of females with the adult sex ratio (ASR) of the population, male evolutionary responses to receptive females, a...

  1. Age validation of canary rockfish (Sebastes pinniger) using two independent otolith techniques: lead-radium and bomb radiocarbon dating.

    Energy Technology Data Exchange (ETDEWEB)

    Andrews, A H; Kerr, L A; Cailliet, G M; Brown, T A; Lundstrom, C C; Stanley, R D

    2007-11-04

    Canary rockfish (Sebastes pinniger) have long been an important part of recreational and commercial rockfish fishing from southeast Alaska to southern California, but localized stock abundances have declined considerably. Based on age estimates from otoliths and other structures, lifespan estimates vary from about 20 years to over 80 years. For the purpose of monitoring stocks, age composition is routinely estimated by counting growth zones in otoliths; however, age estimation procedures and lifespan estimates remain largely unvalidated. Typical age validation techniques have limited application for canary rockfish because they are deep dwelling and may be long lived. In this study, the unaged otolith of the pair from fish aged at the Department of Fisheries and Oceans Canada was used in one of two age validation techniques: (1) lead-radium dating and (2) bomb radiocarbon ({sup 14}C) dating. Age estimate accuracy and the validity of age estimation procedures were validated based on the results from each technique. Lead-radium dating proved successful in determining a minimum estimate of lifespan was 53 years and provided support for age estimation procedures up to about 50-60 years. These findings were further supported by {Delta}{sup 14}C data, which indicated a minimum estimate of lifespan was 44 {+-} 3 years. Both techniques validate, to differing degrees, age estimation procedures and provide support for inferring that canary rockfish can live more than 80 years.

  2. Osteological development of wild-captured larvae and a juvenile Sebastes koreanus (Pisces, Scorpaenoidei from the Yellow Sea

    Directory of Open Access Journals (Sweden)

    Hyo Jae Yu

    2016-06-01

    Full Text Available Abstract The osteological development in Sebastes koreanus is described and illustrated on the basis of 32 larvae [6.11–11.10 mm body length (BL] and a single juvenile (18.60 mm BL collected from the Yellow Sea. The first-ossified skeletal elements, which are related to feeding, swimming, and respiration, appear in larvae of 6.27 mm BL; these include the jaw bones, palatine, opercular, hyoid arch, and pectoral girdle. All skeletal elements are fully ossified in the juvenile observed in the study. Ossification of the neurocranium started in the frontal, pterotic, and parietal regions at 6.27 mm BL, and then in the parasphenoid and basioccipital regions at 8.17 mm BL. The vertebrae had started to ossify at ~7.17 mm BL, and their ossification was nearly complete at 11.10 mm BL. In the juvenile, although ossification of the pectoral girdle was fully complete, the fusion of the scapula and uppermost radial had not yet occurred. Thus, the scapula and uppermost radial fuse during or after the juvenile stage. The five hypurals in the caudal skeleton were also fused to form three hypural elements. The osteological results are discussed from a functional viewpoint and in terms of the comparative osteological development in related species.

  3. Feasibility of partial replacement of fishmeal with proteins from different sources in diets of Korean rockfish ( Sebastes schlegeli)

    Science.gov (United States)

    Yan, Quangen; Zhu, Xiaoming; Yang, Yunxia; Han, Dong; Xie, Shouqi

    2014-12-01

    An 8-week feeding experiment was conducted in an indoor recirculation seawater system to investigate the effects of partial replacement of dietary fishmeal with proteins from five sources on the growth performance and feed utilization of Sebastes schlegeli. Six isonitrogenous and isoenergetic diets were formulated using fishmeal (FM, the control) as sole protein source, or proteins from five sources including poultry by-product meal (PBM), meat and bone meal (MBM), soybean meal (SBM), cottonseed meal (CSM) and canola meal (CNM). Fifteen percent of the crude protein provided by fish meal was replaced, respectively. The results showed that the differences in specific growth rate (SGR) and survival rate (SR) among fish fed PBM, MBM, SBM, CSM and whole FM diets were not significant. However, SGR and SR of fish fed CNM diet was significantly lower than that of other treatments. Feeding rate, feed conversion, nutrient retention showed similar patterns to that of growth. Fish fed CSM and CNM showed significantly lower apparent digestibility coefficient (ADC) of dry matter and gross energy than those fed others while fish fed CNM showed lower ADC of crude protein than those fed others ( Preplacement with CNM reduced fish growth and feed utilization.

  4. Toxic effects on bioaccumulation and hematological parameters of juvenile rockfish Sebastes schlegelii exposed to dietary lead (Pb) and ascorbic acid.

    Science.gov (United States)

    Kim, Jun-Hwan; Kang, Ju-Chan

    2017-06-01

    Juvenile rockfish, Sebastes schlegelii (mean length 11.3 ± 1.2 cm, and mean weight 32.5 ± 4.1 g) were exposed for four weeks to dietary lead (Pb 2+ ) at 0, 120, and 240 mg/L and ascorbic acid (AsA) at 100, 200, and 400 mg/L. The exposure concentrations and duration of significant Pb-induced accumulations in specific tissues of S. schlegelii were assessed. High levels of ascorbic acid significantly attenuated accumulations following exposure to dietary Pb. Dietary Pb exposure caused a significant increase in blood Pb concentrations, whereas red blood cell (RBC) count, hematocrit, and hemoglobin were significantly decreased. Notable changes were also observed in plasma calcium, magnesium, glucose, cholesterol, glutamic oxaloacetic transaminase (GOT), and glutamic pyruvate transaminase (GPT). The growth performance of S. schlegelii was significantly decreased. High doses AsA supplemention were effective in attenuating the changes brought about by dietary Pb exposure. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Examining the utility of bulk otolith δ13C to describe diet in wild-caught black rockfish Sebastes melanops

    Science.gov (United States)

    von Biela, Vanessa; Newsome, Seth D.; Zimmerman, Christian E.

    2015-01-01

    Otolith carbon isotope δ13C values may provide temporally resolved diet proxies in fish. If otolith δ13C values reflect diet, isotope values from recent otolith and muscle tissue should correlate and known ontogenetic diet shifts should be reflected in comparisons between otolith material deposited during different life history stages. We analyzed paired otolith and muscle samples for δ13C from black rockfish Sebastes melanops to examine the potential of otoliths to reflect diet in small (200-299 mm fork length) and large (≥300 mm) fish. We found a significant positive regression between δ13C values from recent (~12 mo) otolith material and muscle in large fish, but not in small fish. Within individual otoliths, δ13C values were enriched by ~3‰ in recent otolith edge material compared to age-0 otolith core material and were consistent with known nearshore-offshore gradients in δ13C values at the base of the food web. Bulk otolith δ13C appeared to provide a broad indicator of dietary carbon sources, but variation in metabolism and dissolved inorganic carbon δ13C among and within individuals likely influences otolith δ13C as well and limits precision. Nevertheless, the results are promising and bulk otolith δ13C may be an appropriate tool to examine large trophic and ecosystem level shifts that have occurred concurrently with changes in habitat, commercial fishing, invasive species, climate change, and other direct or indirect human impacts using historic or ancient otoliths. Future studies should continue to consider the utility of bulk otolith δ13C to describe diet in other marine fish using this simple approach.

  6. The effects of temperature and water concentration on the otolith incorporation of barium and manganese in black rockfish Sebastes melanops.

    Science.gov (United States)

    Miller, J A

    2009-07-01

    Observations of multiple years of geographic variation in [Ba:Ca](otolith) and [Mn:Ca](otolith) in black rockfish Sebastes melanops prompted this study to examine the effects of temperature and water concentration on the otolith incorporation of Ba and Mn in this wholly marine species. The replicated experiment design consisted of two water temperatures (7.4 and 13.0 degrees C) and four water concentrations of Ba:Ca and Mn:Ca. A positive, linear relationship between [Ba:Ca](water) and [Ba:Ca](otolith) was observed at both temperatures. A positive temperature effect was also observed with mean partition coefficients for Ba (D(Ba)) greater in the 13 degrees C than in the 7.4 degrees C treatments (mean = 0.061 and 0.048, respectively). There was no relationship between [Mn:Ca](water) and [Mn:Ca](otolith) although a negative temperature effect was observed. Mean partition coefficients for Mn (D(Mn)) were lower in the 13 degrees C than in the 7.4 degrees C treatments (mean = 0.027 and 0.036, respectively). The data presented support the assumption of a positive, linear relationship between water and otolith Metal:Ca concentrations for Ba:Ca but not for Mn:Ca. Thus, although indicative of residence in distinct water masses, observed variation in [Metal:Ca](otolith) may not reflect variation in water concentration and can be affected by temperature. Caution should be applied in the interpretation of geographic variation of [Mn:Ca](otolith) until the mechanisms regulating its incorporation are more fully understood.

  7. Isolation and expression analysis of FTZ-F1 encoding gene of black rock fish ( Sebastes schlegelii)

    Science.gov (United States)

    Shafi, Muhammad; Wang, Yanan; Zhou, Xiaosu; Ma, Liman; Muhammad, Faiz; Qi, Jie; Zhang, Quanqi

    2013-03-01

    Sex related FTZ-F1 is a transcriptional factor regulating the expression of fushi tarazu (a member of the orphan nuclear receptors) gene. In this study, FTZ-F1 gene ( FTZ-F1) was isolated from the testis of black rockfish ( Sebastes schlegeli) by homology cloning. The full-length cDNA of S. schlegeli FTZ-F1 ( ssFTZ-F1) contained a 232bp 5' UTR, a 1449bp ORF encoding FTZ-F1 (482 amino acid residules in length) with an estimated molecular weight of 5.4kD and a 105bp 3' UTR. Sequence, tissue distribution and phylogenic analysis showed that ssFTZ-F1 belonged to FTZ group, holding highly conserved regions including I, II and III FTZ-F1 boxes and an AF-2 hexamer. Relatively high expression was observed at different larva stages. In juveniles (105 days old), the transcript of ssFTZ-F1 can be detected in all tissues and the abuncance of the gene transcript in testis, ovary, spleen and brain was higher than that in other tissues. In mature fish, the abundance of gene transcript was higher in testis, ovary, spleen and brain than that in liver (trace amount), and the gene was not transcribed in other tissues. The highest abundance of gene transcript was always observed in gonads of both juvenile and mature fish. In addition, the abundance of gene transcript in male tissues were higher than that in female tissue counterparts ( P<0.05).

  8. Comparative analysis of two thioredoxin-like genes in black rockfish Sebastes schlegelii and their possible involvement in redox homeostasis and innate immune responses.

    Science.gov (United States)

    Kugapreethan, Roopasingam; Umasuthan, Navaneethaiyer; Wan, Qiang; Thulasitha, William Shanthakumar; Kim, Chul; Lee, Jehee

    2017-02-01

    Elevated levels of ROS can cause serious intracellular damages by reacting readily with nucleic acids, proteins and lipids, thus triggering tissue damage and cell death. Thioredoxin system is one of the principal factors that maintain the intracellular redox balance via its antioxidant property. In this study, we characterized two new thioredoxin isoforms (SsTXN-like 1 and SsMtTXN-like) from black rockfish, Sebastes schlegelii. The molecular and structural characteristics, as well as the evolutionary relationships of SsTXN-like 1 and SsMtTXN-like confirmed that they belong to the thioredoxin superfamily. A classical thioredoxin domain was found in both proteins with a conserved redox-active site CXYC, however, only the precursor of SsMtTXN-like protein possessed a mitochondrial targeting signal. The results from insulin disulfide reduction activity assay demonstrated that their recombinant proteins are capable of reducing the disulfide bonds of oxidatively damaged proteins via their oxidoreductase activities. The free radical scavenging activity assay revealed the prominent hydroxyl and DPPH scavenging activities of rSsTXN-like 1 and rSsMtTXN-like in a dose-dependent manner. Transcriptional studies showed a broad distribution of SsTXN-like 1 and SsMtTXN-like transcripts in all the examined tissues. Significant (p immune-related tissues after LPS, poly I:C and Streptococcus iniae challenges reflect their critical role in redox homeostasis in black rockfish. Taken together, SsTXN-like 1 and SsMtTXN-like, as two active members of thioredoxin superfamily, have significant antioxidant properties to housekeep the redox potential during various stress conditions and innate immune response of Sebastes schlegelii. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. An integrative mating system assessment of a nonmodel, economically important Pacific rockfish (Sebastes melanops) reveals nonterritorial polygamy and conservation implications for a large species flock.

    Science.gov (United States)

    Karageorge, Kurt W; Wilson, Raymond R

    2017-12-01

    Characterizing the mating systems of long-lived, economically important Pacific rockfishes comprising the viviparous Sebastes species flock is crucial for their conservation. However, direct assignment of mating success to sires is precluded by open, offshore populations and high female fecundity. We addressed this challenge by integrating paternity-assigned mating success of females with the adult sex ratio (ASR) of the population, male evolutionary responses to receptive females, and reproductive life history traits-in the framework of sexual selection theory-to assess the mating system of Sebastes melanops . Microsatellite parentage analysis of 17 pregnant females, 1,256 of their progeny, and 106 adults from the population yielded one to four sires per brood, a mean of two sires, and a female mate frequency distribution with a truncated normal (random) pattern. The 11 multiple paternity broods all contained higher median allele richness than the six single paternity broods (Wilcoxon test: W  = 0, p  distributions that distinguish polygynandry and polyandrogyny mating systems, that is, variations of polygamy, but not polyandry. Inference for polygamy is consistent with weak premating sexual selection on males, expected in mid-water, schooling S. melanops , owing to polyandrous mating, moderately aggregated receptive females, an even ASR, and no territories and nests used for reproduction. Each of these characteristics facilitates more mating males and erodes conspicuous sexual dimorphism. Evaluation of male evolutionary responses of demersal congeners that express reproductively territorial behavior revealed they have more potential mechanisms for producing premating sexual selection, greater variation in reproductive success, and a reduced breeding effective population size of adults and annual effective size of a cohort, compared to S. melanops modeled with two mates per adult. Such divergence in behavior and mating system by territorial species may

  10. Characterising and comparing the spawning habitats of anchovy ...

    African Journals Online (AJOL)

    The spawning habitats of anchovy Engraulis encrasicolus and sardine Sardinops sagax in the southern Benguela upwelling ecosystem were characterised by comparing their egg abundances with environmental variables measured concomitantly during two different survey programmes: the South African Sardine and ...

  11. Variable spatial structure of schooling pelagic fish off Namibia ...

    African Journals Online (AJOL)

    Schools of horse mackerel Trachurus trachurus capensis, sardine Sardinops sagax and round herring Etrumeus whiteheadi were surveyed by conventional echo-integration along systematic transects. The transects were surveyed twice, in opposite directions. Clupeoid biomass was concentrated in a few dense ...

  12. Breeding success of African penguins Spheniscus demersus at ...

    African Journals Online (AJOL)

    The reproductive success of African penguins Spheniscus demersus at Dassen Island from 1994 to 2000 was variable, but much higher than previously reported figures for the species. Breeding success was positively related to the abundance of anchovy Engraulis encrasicolus and sardine Sardinops sagax, and the high ...

  13. A model of trophic flows in the northern Benguela upwelling system ...

    African Journals Online (AJOL)

    Ultimately, this type of model may form a basis for multispecies management approaches in the region. By the 1980s, sardine Sardinops sagax and hake Merluccius spp. stocks in the northern Benguela had both undergone a decline, yet were still heavily fished. Horse mackerel Trachurus trachurus capensis had increased ...

  14. Comparison of trends in abundance of guano-producing seabirds in ...

    African Journals Online (AJOL)

    The abundant guano-producing seabirds in Peru and southern Africa feed mainly on the large populations of anchovy Engraulis spp. and sardine Sardinops sagax supported by the Humboldt and Benguela upwelling systems. Numbers of guanay cormorants Phalacrocorax bougainvillii in Peru and the breeding population ...

  15. Influence of oceanographic fronts and low oxygen on the distribution ...

    African Journals Online (AJOL)

    The horizontal and vertical distributions of eggs and larvae of sardine Sardinops sagax, anchovy Engraulis encrasicolus and horse mackerel Trachurus trachurus capensis were examined in relation to distribution patterns of temperature, salinity and dissolved oxygen. Samples were collected during February–March 2002 ...

  16. Spatial variability in branchial basket meristics and morphology of ...

    African Journals Online (AJOL)

    We examined spatial variability in meristic and morphological characteristics of the branchial basket of sardine Sardinops sagax collected from four geographical regions around the southern African coast, namely Namibia and the South African west, south and east coasts. Our analysis tested the hypothesis of three putative ...

  17. The importance of lipid-rich fish prey for Cape gannet chick growth : are fishery discards an alternative?

    NARCIS (Netherlands)

    Mullers, Ralf H. E.; Navarro, Rene A.; Crawford, Robert J. M.; Underhill, Les G.

    2009-01-01

    A recent decline in population numbers of Cape gannets (Morus capensis) breeding off the west coast of South Africa coincided with decreased availability of lipid-rich fish prey: anchovy (Engraulis encrasicolus) and sardine (Sardinops sagax). Seabirds can use fishery discards as an alternative, but

  18. Tropical South-East Atlantic response to ENSO as an ecosystem ...

    African Journals Online (AJOL)

    Cases were selected based on indices of Pacific sea surface temperature and South-East African rainfall. ... an El Niño event, and higher sardine Sardinops sagax catches tend to follow a La Niña event, through the northward and southward shift respectively of the South Atlantic anticyclone and attendant coastal upwelling.

  19. Ecosystem considerations of the KwaZulu-Natal sardine run ...

    African Journals Online (AJOL)

    The annual winter sardine run along the South African east coast impacts the KwaZulu-Natal (KZN) coastal system in a variety of ways. These include ecological impacts, such as enrichment of a largely oligotrophic environment, competition between migrant sardine Sardinops sagax, other migrant and resident small ...

  20. Revised estimates of abundance of South African sardine and ...

    African Journals Online (AJOL)

    Hydro-acoustic surveys have been used to provide annual estimates of May recruitment and November spawner biomass of the South African sardine Sardinops sagax and anchovy Engraulis encrasicolus resources since 1984. These time-series of abundance estimates form the backbone of the assessment of these ...

  1. The application of stereo-video technology for the assessment on population change of black rockfish Sebastes schlegeli in a vessel reef area in Haizhou Bay, China

    Science.gov (United States)

    Liu, Hui; Xu, Qiang; Xu, Qinzeng; Zhang, Yingqiu; Yang, Hongsheng

    2015-01-01

    The assessment of population structure and abundance of fish assemblages associated with artificial reefs (ARs) is an important aspect of AR management. In the present study, we used a Dive-Operated Stereo Video (stereo-DOV) technique to assess the population structure and abundance of Sebastes schlegeli associated with two metallic, and three wooden, vessel reefs in Haizhou Bay during 2012 and 2013. The study used video systems to obtain length measurements and estimates of abundance. The size composition of S. schlegeli differed among reefs and individuals around vessel reefs were all adults, with total lengths (TL) of >20 cm. Juvenile fish were encountered by divers in a rocky area near the island away from the vessel reefs. The largest individual S. schlegeli (with the highest TL) among five reefs were found around a metallic vessel reef in both 2012 and 2013. TL of S. s chlegeli from all reefs increased by an average of 3.2 cm ( P<0.05) from 2012 to 2013, with an estimated mean weight increase of 250.4 g ( P<0.05). The video survey also indicated a decrease in the biomass of schools near two metallic vessels between the years. Stereo-video technology was found to be suitable for rockfish surveys around the reefs.

  2. Parasites as Biological Tags for Stock Discrimination of Beaked Redfish (Sebastes mentella: Parasite Infra-Communities vs. Limited Resolution of Cytochrome Markers.

    Directory of Open Access Journals (Sweden)

    Regina Klapper

    Full Text Available The use of parasites as biological tags for discrimination of fish stocks has become a commonly used approach in fisheries management. Metazoan parasite community analysis and anisakid nematode population genetics based on a mitochondrial cytochrome marker were applied in order to assess the usefulness of the two parasitological methods for stock discrimination of beaked redfish Sebastes mentella of three fishing grounds in the North East Atlantic. Multivariate, model-based approaches demonstrated that the metazoan parasite fauna of beaked redfish from East Greenland differed from Tampen, northern North Sea, and Bear Island, Barents Sea. A joint model (latent variable model was used to estimate the effects of covariates on parasite species and identified four parasite species as main source of differences among fishing grounds; namely Chondracanthus nodosus, Anisakis simplex s.s., Hysterothylacium aduncum, and Bothriocephalus scorpii. Due to its high abundance and differences between fishing grounds, Anisakis simplex s.s. was considered as a major biological tag for host stock differentiation. Whilst the sole examination of Anisakis simplex s.s. on a population genetic level is only of limited use, anisakid nematodes (in particular, A. simplex s.s. can serve as biological tags on a parasite community level. This study confirmed the use of multivariate analyses as a tool to evaluate parasite infra-communities and to identify parasite species that might serve as biological tags. The present study suggests that S. mentella in the northern North Sea and Barents Sea is not sub-structured.

  3. Prevalence and spatial distribution of intraerythrocytic parasite(s) in Puget Sound rockfish (Sebastes emphaeus) from the San Juan Archipelago, Washington (USA)

    Science.gov (United States)

    Van Der Straaten, N.; Jacobson, A.; Halos, D.; Hershberger, P.; Kocan, A.A.; Kocan, R.

    2005-01-01

    Two morphologically distinct forms of an intraerythrocytic parasite(s) were detected by microscopic observation of Giemsa-stained blood films in 45.7% of 119 rockfish (Sebastes emphaeus) from the San Juan Archipelago (Washington State, U.S.A.). Infection prevalence for both forms was 53% in males, 44% in females, and 33% in fish of undetermined gender. A binucleate "ring-stage" was present at all 4 geographic sites, with a mean prevalence of 45.7%, while mean prevalence of a larger gamont-like form from the same sites was 5.1%. The relationship of the 2 forms to each other could not be determined. Neither schizogony nor binary fission was evident in any of the infected erythrocytes and the parasites contained no obvious pigment. The possibility of the 2 morphologic forms being 2 distinct species is supported by the observation that no difference in parasitemia was seen in the binucleate form among sites (1.6-1.9%), while parasitemia of the gamont-like form varied significantly among sites, ranging from a high of 4% to a low of 0.1%. Taxonomic status of either form could not be determined at this time based on limited existing morphologic data. ?? American Society of Parasitologists 2005.

  4. Long-term variation in a central California pelagic forage assemblage

    Science.gov (United States)

    Ralston, Stephen; Field, John C.; Sakuma, Keith M.

    2015-06-01

    A continuous 23 year midwater trawl survey (1990-2012) of the epipelagic forage assemblage off the coast of central California (lat. 36°30‧-38°20‧ N) is described and analyzed. Twenty taxa occurred in ≥ 10% of the 2037 trawls that were completed at 40 distinct station locations. The dominant taxa sampled by the 9.5 mm mesh net included a suite of young-of-the-year (YOY) groundfish, including rockfish (Sebastes spp.) and Pacific hake (Merluccius productus), two clupeoids (Engraulis mordax and Sardinops sagax), krill (Euphausiacea), cephalopods (Doryteuthis opalescens and Octopus sp.), and a variety of mesopelagic species, i.e., Diaphus theta, Tarltonbeania crenularis, "other" lanternfish (Myctophidae), deep-sea smelts (Bathylagidae), and sergestid shrimp. Annual abundance estimates of the 20 taxa were obtained from analysis of variance models, which included year and station as main effects. Principal components analysis of the abundance estimates revealed that 61% of assemblage variance was explained by the first three components. The first component revealed a strong contrast in the abundance of: (a) YOY groundfish, market squid (D. opalescens), and krill with (b) mesopelagics and clupeoids; the second component was associated with long-term trends in abundance. An evaluation of 10 different published oceanographic data sets and CTD data collected during the survey indicated that seawater properties encountered each year were significantly correlated with abundance patterns, as were annual sea-level anomalies obtained from an analysis of AVISO satellite information. A comparison of our findings with several other recent studies of biological communities occurring in the California Current revealed a consistent structuring of forage assemblages, which we conjecture is primarily attributable to large-scale advection patterns in the California Current ecosystem.

  5. anchovy Engraulis capensis, sardine Sardinops sa

    African Journals Online (AJOL)

    spamer

    rates ranged between 0.05 and 0.29.h-1, with mean values of 0.09 and 0.27.h-1 for fish fed zooplankton and phytoplankton ... Linear, square root, and exponential func- tions were ...... Far Eastern sardine and their implication in the fluctuation.

  6. Relaciones tróficas, espectro alimentario y ración de alimentación de las principales especies pelágicas en el verano 1996

    OpenAIRE

    Alamo, Alejandro; Navarro, Iván; Espinoza, Pepe; Zubiate, Patricia

    1996-01-01

    Se analiza la dieta de Engraulis ringens, Sardinops sagax sagax, Trachurus picturatus murphyi, Scomber japonicus peruanus durante el verano de 1996. La ración diaria se determinó mediante el modelo de SAINSBURY (1986), utilizando el Software MAXIMS y el espectro alimentario siguiendo lo descrito por HYSLOP (1980). En la anchoveta y sardina los items presa estuvieron compuestos por copépodos de los géneros Centropages, Oncaea, Eucalanus y el crustáceo planctónico Euphausia mucronata entre los ...

  7. 一株许氏平鲉(Sebastes schlegelii)肠道乳酸菌的分离鉴定及特性分析%IDENTIFICATION AND CHARACTERISTICS OF A LACTIC ACID BACTERIA ASSOCIATED FROM INTESTINE OF BLACK ROCKFISH SEBASTES SCHLEGELII

    Institute of Scientific and Technical Information of China (English)

    王腾腾; 韦秀梅; 常城; 韩慧宗; 姜海滨

    2017-01-01

    为筛选具有广谱抑菌活性的乳酸菌用于微生态制剂开发,本研究自野生许氏平鲉肠道内共分离出35株细菌,从中筛选出1株乳酸菌YH1,其革兰氏染色呈阳性,且可发酵脱脂乳产生凝固、无气泡、呈酸性现象,基于形态学观察、生理生化和16S rDNA序列鉴定乳酸菌YH1为食窦魏斯氏菌.分析了酸碱度、温度和NaC1含量对食窦魏斯氏菌YH1生长的影响;选取金黄色葡萄球菌、嗜水气单胞菌、溶藻弧菌、副溶血弧菌、迟钝爱德华氏菌、鳗弧菌、假交替单胞菌和哈维氏弧菌等多种病原指示菌,以琼脂扩散法测定YH1培养12h产物的抑菌活性;并采用肌肉注射和腹腔注射两种方式对YH1的动物安全性进行检测.实验结果显示,食窦魏斯氏菌YH1适宜的生长条件为pH5.7-8.8、温度20-40℃,最适生长条件为pH7.2-8.4,温度35℃,在MRS培养基中添加NaC1会抑制YH1的生长;食窦魏斯氏菌YH1的无菌培养产物可显著抑制金黄色葡萄球菌、嗜水气单胞菌、溶藻弧菌、副溶血弧菌、迟钝爱德华氏菌、鳗弧菌、假交替单胞菌、哈维氏弧菌等病原指示菌的生长;食窦魏斯氏菌YH1在108CFU/mL及以下浓度对许氏平鲉是相对安全的.以上研究表明了食窦魏斯氏菌YH1具有广谱抑菌性和动物安全性,为其应用于水产养殖业奠定了理论基础.%To screen wide-spectrum bacteriostatic activity for probiotics application,a lactic acid bacteria strain Weissella cibaria YH1 was recognized among 35 bacterial strains isolated from the intestine of wild Sebastes schlegelii.Morphological observation,physiological and biochemical characteristic analyses,and 16S rDNA sequencing were applied.Skim milk was fermented into coagulation with this gram-positive YH1 without bubbling,and the supernatant was acidic.The effects of pH,temperature,and NaC1 content on the growth of strain YH1 were analyzed.Some indicator pathogens(Staphylococcus aureus

  8. Task 1: Whole-body concentrations of elements in kelp bass (Paralabrax clathratus), kelp rockfish (Sebastes atrovirens), and Pacific sanddab (Citharichthys sordidus) from offshore oil platforms and natural areas in the Southern California Bight

    Science.gov (United States)

    Love, Milton S.

    2009-01-01

    Resource managers are concerned that offshore oil platforms in the Southern California Bight may be contributing to environmental contaminants accumulated by marine fishes. To examine this possibility, 18 kelp bass (Paralabrax clathratus), 80 kelp rockfish (Sebastes atrovirens), and 98 Pacific sanddab (Citharichthys sordidus) were collected from five offshore oil platforms and 10 natural areas during 2005-2006 for whole-body analysis of 63 elements. The natural areas, which served as reference sites, were assumed to be relatively uninfluenced by contaminants originating from platforms. Forty-two elements were excluded from statistical comparisons for one of three reasons: they consisted of major cations that were unlikely to accumulate to potentially toxic concentrations under ambient exposure conditions; they were not detected by the analytical procedures; or they were detected at concentrations too low to yield reliable quantitative measurements. The remaining 21 elements consisted of aluminum, arsenic, barium, cadmium, chromium, cobalt, copper, gallium, iron, lead, lithium, manganese, mercury, nickel, rubidium, selenium, strontium, tin, titanium, vanadium, and zinc. Statistical comparisons of these 21 elements indicated that none consistently exhibited higher concentrations at oil platforms than at natural areas. Eight comparisons yielded significant interaction effects between total length (TL) of the fish and the two habitat types (oil platforms and natural areas). This indicated that relations between certain elemental concentrations (i.e., copper, rubidium, selenium, tin, titanium, and vanadium) and habitat type varied by TL of affected fish species. To better understand these interactions, we examined elemental concentrations in very small and very large individuals of affected species. Although significant interactions were detected for rubidium, tin, and selenium in kelp rockfish, the concentrations of these elements did not differ significantly between

  9. A fuzzy-logic tool for multi-criteria decision making in fisheries: the case of the South African pelagic fishery

    DEFF Research Database (Denmark)

    Paterson, B.; Jarre, Astrid; Moloney, C.L.

    2007-01-01

    The present study presents an electronic decision-support tool that uses a fuzzy-logic model of expert knowledge to assist in multi-criteria decision-making in the context of an Ecosystem Approach to Fisheries (EAF). The prototype model integrates the multiple goals and objectives related...... to the evaluation of the ecosystem performance of the South African sardine Sardinops sagax fishery into a NetWeaver knowledge base and provides intuitive visual outputs to communicate results to managers and stakeholders. The software tool was developed in a consultative process with key experts and follows...... on expert opinion. Results show that the model is robust and conservative. The strength of the approach lies in the ability to include variables that are difficult to measure. It provides a means of rendering value judgements explicit and transparent. The tool synthesises a large amount of information...

  10. Phenological and distributional shifts in ichthyoplankton associated with recent warming in the northeast Pacific Ocean.

    Science.gov (United States)

    Auth, Toby D; Daly, Elizabeth A; Brodeur, Richard D; Fisher, Jennifer L

    2018-01-01

    Understanding changes in the migratory and reproductive phenology of fish stocks in relation to climate change is critical for accurate ecosystem-based fisheries management. Relocation and changes in timing of reproduction can have dramatic effects upon the success of fish populations and throughout the food web. During anomalously warm conditions (1-4°C above normal) in the northeast Pacific Ocean during 2015-2016, we documented shifts in timing and spawning location of several pelagic fish stocks based on larval fish samples. Total larval concentrations in the northern California Current (NCC) during winter (January-March) 2015 and 2016 were the highest observed since annual collections first occurred in 1998, primarily due to increased abundances of Engraulis mordax (northern anchovy) and Sardinops sagax (Pacific sardine) larvae, which are normally summer spawning species in this region. Sardinops sagax and Merluccius productus (Pacific hake) exhibited an unprecedented early and northward spawning expansion during 2015-16. In addition, spawning duration was greatly increased for E. mordax, as the presence of larvae was observed throughout the majority of 2015-16, indicating prolonged and nearly continuous spawning of adults throughout the warm period. Larvae from all three of these species have never before been collected in the NCC as early in the year. In addition, other southern species were collected in the NCC during this period. This suggests that the spawning phenology and distribution of several ecologically and commercially important fish species dramatically and rapidly changed in response to the warming conditions occurring in 2014-2016, and could be an indication of future conditions under projected climate change. Changes in spawning timing and poleward migration of fish populations due to warmer ocean conditions or global climate change will negatively impact areas that were historically dependent on these fish, and change the food web structure

  11. Population Consequences of Age-Dependent Maternal Effects in Rockfish (Sebastes spp.)

    OpenAIRE

    Lucero, Yasmin

    2007-01-01

    I present a model of the early life history of a rockfish that includes an age-dependent maternal effect. The model is designed to accurately reflect the diverse uncertainties we have about early life history processes. The first portion of this thesis is devoted to an analytical treatment of the deterministic early life history model. I emphasize uncertainty about the functional form of density-dependent processes in the juvenile stage. The remainder of the thesis is devoted to demonstrating...

  12. An Empty Donut Hole: the Great Collapse of a North American Fishery

    Directory of Open Access Journals (Sweden)

    Kevin M. Bailey

    2011-06-01

    Full Text Available Walleye pollock (Theragra chalcogramma is North America's most abundant and lucrative natural fishery, and is the world's largest fishery for human food. The little-known demise of the "Donut Hole" stock of pollock in the Aleutian Basin of the central Bering Sea during the 1980s is the most spectacular fishery collapse in North American history, dwarfing the famous crashes of the northern cod and Pacific sardine (Sardinops sagax. This collapse has received scant recognition and became evident only in 1993 when fishing was banned by an international moratorium; nearly 20 years later it has not recovered. The history of fishing in the North Pacific Ocean after World War II offers some insights into how the Donut Hole pollock fishery developed, and the societal and economic pressures behind it that so influenced the stock's fate. Overfishing was, without a doubt, the greatest contributor to the collapse of the Aleutian Basin pollock fishery, but a lack of knowledge about population biocomplexity added to the confusion of how to best manage the harvest. Unfortunately, the big scientific questions regarding the relationship of Donut Hole fish to other stocks are still unanswered.

  13. A WELL PRESERVED SKELETON OF THE FOSSIL SHARK COSMOPOLITODUS HASTALIS FROM THE LATE MIOCENE OF PERU, FEATURING FISH REMAINS AS FOSSILIZED STOMACH CONTENTS

    Directory of Open Access Journals (Sweden)

    ALBERTO COLLARETA

    2017-01-01

    Full Text Available Both the preservation of the poorly mineralized skeleton of sharks and the preservation of stomach contents are rarely observed in the fossil record. Here we report on a partial skeleton of a lamniform shark, including portions of the visceral arches and the anterior segment of the vertebral column, collected from the late Miocene beds of the Pisco Formation exposed at Cerro Yesera (Ica Desert, South Peru. Based on the morphology of the preserved teeth, this specimen was determined as a juvenile of the extinct lamnid species Cosmopolitodus hastalis. The shark skeleton includes remains of fish (featuring a pilchard determined as Sardinops sp. cf. S. sagax in the abdominal region. These fish remains are interpreted herein as the fossilized stomach contents of the shark. For the first time, piscivory is demonstrated in a juvenile individual of Cosmopolitodus hastalis. This result is consistent with the current knowledge about the feeding habits of immature individuals of extant lamniform shark species (including Carcharodon carcharias and Isurus oxyrinchus. Our report further outlines the fundamental role of schooling pilchards in the late Miocene trophic chains of the highly productive coastal waters off present South Peru. Moreover, the find of this well preserved shark skeleton strengthens the qualification of the Pisco Formation as a Fossil-Lagerstätte, and emphasizes the role of early mineralization processes in cases of exceptional preservation.

  14. Macro-Scale Patterns in Upwelling/Downwelling Activity at North American West Coast.

    Directory of Open Access Journals (Sweden)

    Romeo Saldívar-Lucio

    Full Text Available The seasonal and interannual variability of vertical transport (upwelling/downwelling has been relatively well studied, mainly for the California Current System, including low-frequency changes and latitudinal heterogeneity. The aim of this work was to identify potentially predictable patterns in upwelling/downwelling activity along the North American west coast and discuss their plausible mechanisms. To this purpose we applied the min/max Autocorrelation Factor technique and time series analysis. We found that spatial co-variation of seawater vertical movements present three dominant low-frequency signals in the range of 33, 19 and 11 years, resembling periodicities of: atmospheric circulation, nodal moon tides and solar activity. Those periodicities might be related to the variability of vertical transport through their influence on dominant wind patterns, the position/intensity of pressure centers and the strength of atmospheric circulation cells (wind stress. The low-frequency signals identified in upwelling/downwelling are coherent with temporal patterns previously reported at the study region: sea surface temperature along the Pacific coast of North America, catch fluctuations of anchovy Engraulis mordax and sardine Sardinops sagax, the Pacific Decadal Oscillation, changes in abundance and distribution of salmon populations, and variations in the position and intensity of the Aleutian low. Since the vertical transport is an oceanographic process with strong biological relevance, the recognition of their spatio-temporal patterns might allow for some reasonable forecasting capacity, potentially useful for marine resources management of the region.

  15. Metals and metalloids in Little Penguin (Eudyptula minor) prey, blood and faeces.

    Science.gov (United States)

    Finger, Annett; Lavers, Jennifer L; Dann, Peter; Kowalczyk, Nicole D; Scarpaci, Carol; Nugegoda, Dayanthi; Orbell, John D

    2017-04-01

    Piscivorous species like the Little Penguin (Eudyptula minor) are particularly at risk of being negatively impacted by pollution due to their heightened exposure through aquatic food chains. Therefore, determining the concentration of heavy metals in the fish prey of seabirds is an essential component of assessing such risk. In this study, we report on arsenic, cadmium, mercury, lead and selenium concentrations in three fish species, which are known to comprise a substantial part of the diet of Little Penguins at the urban colony of St Kilda, Melbourne, Australia. Metal concentrations in the fish sampled were generally within the expected limits, however, arsenic and mercury were higher than reported elsewhere. Anchovy (Engraulis australis) and sandy sprat (Hyperlophus vittatus) contained higher Hg concentrations than pilchard (Sardinops sagax), while sandy sprat and pilchard contained more selenium. We present these findings together with metal concentrations in Little Penguin blood and faeces, sampled within weeks of the fish collection. Mercury concentrations were highest in the blood, while faeces and fish prey species contained similar concentrations of arsenic and lead, suggesting faeces as a primary route of detoxification for these elements. We also investigated paired blood - faecal samples and found a correlation for selenium only. Preliminary data from stable isotope ratios in penguin blood indicate that changes in penguin blood mercury concentrations cannot be explained by trophic changes in their diet alone, suggesting a variation of bioavailable Hg within this semi-enclosed bay. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Larval fish variability in response to oceanographic features in a nearshore nursery area.

    Science.gov (United States)

    Pattrick, P; Strydom, N A

    2014-09-01

    The influence of oceanographic features on ichthyoplankton assemblages in the warm temperate nearshore region of Algoa Bay, South Africa, was assessed. The nearshore ichthyoplankton comprised 88 taxa from 34 families. Samples were collected at six stations between August 2010 and July 2012 using a plankton ring net of 750 mm diameter and 500 µm mesh aperture. The majority of larvae collected were in a preflexion stage, indicating the potential importance of the nearshore for newly hatched larvae. Engraulidae dominated the catch (38·4%), followed by Cynoglossidae (28·1%) and Sparidae (8·4%). Larval fish abundance was highest during austral spring and summer (September to February). Unique patterns in responses of each dominant fish species to oceanographic features in the nearshore indicate the sensitivity of the early developmental stage to environmental variables. Using generalized linear models, ichthyoplankton abundance responded positively to upwelling and when warm water plumes originating from an Agulhas Current meander entered Algoa Bay. Highest abundances of Engraulis encrasicolus and Sardinops sagax were observed during Agulhas Plume intrusions into Algoa Bay. When a mixed and stratified water column persisted in the nearshore region of Algoa Bay, larval fish abundance decreased. The nearshore region of Algoa Bay appears to serve as a favourable environment for the accumulation of ichthyoplankton. © 2014 The Fisheries Society of the British Isles.

  17. Characteristic ichthyoplankton taxa in the separation zone of the East Australian Current: Larval assemblages as tracers of coastal mixing

    Science.gov (United States)

    Syahailatua, Augy; Roughan, Moninya; Suthers, Iain M.

    2011-03-01

    Ichthyoplankton assemblages were compared between regions dominated by the oligotrophic East Australian Current (EAC) and the inner-shelf waters off southeastern Australia, to determine if the early life history of fish was related to the separation of the EAC from the coast, producing different water masses as well as characteristic taxa. Samples were collected at the surface and in sub-surface waters, at 50 and 100 m isobath stations, during two summer research voyages in November 1998 and January 1999. On both voyages the study region was characterized by coastal and EAC waters in the north (˜31°S), and in the south by topographically induced upwelling (˜31°S), associated with narrowing of the continental shelf and separation of the EAC from the coast. Among the 111 families of larval fish, we observed distinctive assemblages of ichthyoplankton associated with the two different water masses. A greater abundance of the Carangidae, Labridae, Lutjanidae, Microcanthidae, Myctophidae and Scombridae was associated with the nutrient poor EAC water mass, while the Callionymidae, Clupeidae, Platycephalidae and Sillaginidae were mostly found in the cooler and/or fresher inner-shelf water mass. We assessed these patterns with opportunistic samples from an unusual, wind-driven upwelling event in the north (˜31°S) earlier in the November voyage. The relative abundance of these 10 characteristic families distinguished this wind-driven upwelling event from the subsequent relaxation and predominance of the EAC assemblage at this location just 6 d later. Distinctive and abundant families such as larval clupeids, relative to larval carangids, could be a useful marker of inner-shelf, EAC and mixed water masses in the absence of robust hydrographic data. This and related studies indicate contrast in early life histories of Sardinops sagax and Trachurus spp., which appear to spawn respectively in the inner-shelf and outer-shelf waters. The post-flexion stages of S. sagax

  18. Deep Transcriptomic Analysis of Black Rockfish (Sebastes schlegelii) Provides New Insights on Responses to Acute Temperature Stress.

    Science.gov (United States)

    Lyu, Likang; Wen, Haishen; Li, Yun; Li, Jifang; Zhao, Ji; Zhang, Simin; Song, Min; Wang, Xiaojie

    2018-06-14

    In the present study, we conducted an RNA-Seq analysis to characterize the genes and pathways involved in acute thermal and cold stress responses in the liver of black rockfish, a viviparous teleost that has the ability to cope with a wide range of temperature changes. A total of 584 annotated differentially expressed genes (DEGs) were identified in all three comparisons (HT vs NT, HT vs LT and LT vs NT). Based on an enrichment analysis, DEGs with a potential role in stress accommodation were classified into several categories, including protein folding, metabolism, immune response, signal transduction, molecule transport, membrane, and cell proliferation/apoptosis. Considering that thermal stress has a greater effect than cold stress in black rockfish, 24 shared DEGs in the intersection of the HT vs LT and HT vs NT groups were enriched in 2 oxidation-related gene ontology (GO) terms. Nine important heat-stress-reducing pathways were significantly identified and classified into 3 classes: immune and infectious diseases, organismal immune system and endocrine system. Eight DEGs (early growth response protein 1, bile salt export pump, abcb11, hsp70a, rtp3, 1,25-dihydroxyvitamin d(3) 24-hydroxylase, apoa4, transcription factor jun-b-like and an uncharacterized gene) were observed among all three comparisons, strongly implying their potentially important roles in temperature stress responses.

  19. Coupling between the environment and the pelagic resources exploited off northern Chile: ecosystem indicators and a conceptual model Acoplamiento entre el ambiente y los recursos pelágicos explotados en el norte de Chile: un modelo conceptual

    Directory of Open Access Journals (Sweden)

    Eleuterio Yáñez

    2008-01-01

    Full Text Available The eastern boundary of the Chile-Peru Current System constitutes one of the most biologically productive ecosystems in the world, due largely to coastal upwelling and the horizontal advection of nutrients. In this ecosystem, El Niño events are of great importance in the interannual variability of the environment. A change was observed in the environmental regime at the beginning of the 1970s with the onset of the 1972-1973 El Niño, marking an important decrease in the anchovy fishery (Engraulis ringens. After the mid-1970s, sardine (Sardinops sagax landings increased noticeably. A second regime shift at the end of the 1980s was seen mostly in the noticeable recovery of anchovy and the decline of sardine. Herein, we present an integrated conceptual model of the different local and large-scale phenomena that affect the marine environment off northern Chile and the distribution and abundance of pelagic resources. The model considers an analysis of environmental and bio-fishery data on different scales and describes how the interdecadal (associated with re-gime shifts and interannual (associated with El Niño events fluctuations in the Equatorial Pacific are mani-fested in the eastern South Pacific and, therefore, in the northern zone off Chile, affecting the annual eyele, the dynamic of the coastal trapped waves, and coastal upwelling. In this framework, interdecadal fluctuations play an important role in the anchovy-sardine-anchovy replacement sequence.El borde oriental del Sistema de Corrientes de Chile-Perú constituye uno de los ecosistemas de mayor productividad biológica del mundo, debido principalmente a la surgencia costera y advección horizontal de nutrientes. En este ecosistema, los eventos El Niño son de mayor importancia en la variabilidad interanual del ambiente. No obstante, un cambio de régimen ambiental es observado a inicio de los 70's el que hubiera comenzado con El Niño 1972-73 y que marca la gran disminución de la

  20. Quantifying mercury isotope dynamics in captive Pacific bluefin tuna (Thunnus orientalis

    Directory of Open Access Journals (Sweden)

    Sae Yun Kwon

    2016-02-01

    Full Text Available Abstract Analyses of mercury (Hg isotope ratios in fish tissues are used increasingly to infer sources and biogeochemical processes of Hg in natural aquatic ecosystems. Controlled experiments that can couple internal Hg isotope behavior with traditional isotope tracers (δ13C, δ15N can improve the applicability of Hg isotopes as natural ecological tracers. In this study, we investigated changes in Hg isotope ratios (δ202Hg, Δ199Hg during bioaccumulation of natural diets in the pelagic Pacific bluefin tuna (Thunnus orientalis; PBFT. Juvenile PBFT were fed a mixture of natural prey and a dietary supplement (60% Loligo opalescens, 31% Sardinops sagax, 9% gel supplement in captivity for 2914 days, and white muscle tissues were analyzed for Hg isotope ratios and compared to time in captivity and internal turnover of δ13C and δ15N. PBFT muscle tissues equilibrated to Hg isotope ratios of the dietary mixture within ∼700 days, after which we observed a cessation in further shifts in Δ199Hg, and small but significant negative δ202Hg shifts from the dietary mixture. The internal behavior of Δ199Hg is consistent with previous fish studies, which showed an absence of Δ199Hg fractionation during Hg bioaccumulation. The negative δ202Hg shifts can be attributed to either preferential excretion of Hg with higher δ202Hg values or individual variability in captive PBFT feeding preferences and/or consumption rates. The overall internal behavior of Hg isotopes is similar to that described for δ13C and δ15N, though observed Hg turnover was slower compared to carbon and nitrogen. This improved understanding of internal dynamics of Hg isotopes in relation to δ13C and δ15N enhances the applicability of Hg isotope ratios in fish tissues for tracing Hg sources in natural ecosystems.

  1. Biomasa acústica y distribución del jurel Trachurus murphyien el Perú

    Directory of Open Access Journals (Sweden)

    Marceliano Segura

    2013-10-01

    Full Text Available Se analizan los resultados de las evaluaciones hidroacústicas del recurso jurel Trachurus murphyi Nichols 1920 realizadas en aguas peruanas entre 1983 – 2012. Desde 1983 se incluyó al T. murphyicomo especie de estudio durante los cruceros de evaluación de recursos pelágicos ejecutados por el Instituto del Mar del Perú. Debido al énfasis en la estimación de biomasa de la anchoveta Engraulis ringens y de la sardina Sardinops sagax cuando esta última es más abundante, los cruceros se llevan a cabo durante el verano austral y las áreas de evaluación están circunscritas a las zonas más costeras hasta 100 mn, con sólo algunas exploraciones en otras estaciones y hasta 200 millas. El máximo valor de biomasa de 8.51 millones de toneladas de T. murphyien aguas peruanas estimado con las evaluaciones hidroacústicas fue encontrado durante el crucero realizado en otoño (marzo-mayo de 1983. En los años siguientes los estimados de biomasa acústica fluctuaron entre 180 mil toneladas en 1985 y otro máximo de 8.47 millones de toneladas en 1993, para luego disminuir gradualmente hasta un mínimo de 1239 t en 2010, con una ligera recuperación en los años 2011 y 2012. El área de distribución de T. murphyifue muy fluctuante en todo el periodo observado.

  2. Managing small-scale commercial fisheries for adaptive capacity: insights from dynamic social-ecological drivers of change in Monterey Bay.

    Science.gov (United States)

    Aguilera, Stacy E; Cole, Jennifer; Finkbeiner, Elena M; Le Cornu, Elodie; Ban, Natalie C; Carr, Mark H; Cinner, Joshua E; Crowder, Larry B; Gelcich, Stefan; Hicks, Christina C; Kittinger, John N; Martone, Rebecca; Malone, Daniel; Pomeroy, Carrie; Starr, Richard M; Seram, Sanah; Zuercher, Rachel; Broad, Kenneth

    2015-01-01

    Globally, small-scale fisheries are influenced by dynamic climate, governance, and market drivers, which present social and ecological challenges and opportunities. It is difficult to manage fisheries adaptively for fluctuating drivers, except to allow participants to shift effort among multiple fisheries. Adapting to changing conditions allows small-scale fishery participants to survive economic and environmental disturbances and benefit from optimal conditions. This study explores the relative influence of large-scale drivers on shifts in effort and outcomes among three closely linked fisheries in Monterey Bay since the Magnuson-Stevens Fisheries Conservation and Management Act of 1976. In this region, Pacific sardine (Sardinops sagax), northern anchovy (Engraulis mordax), and market squid (Loligo opalescens) fisheries comprise a tightly linked system where shifting focus among fisheries is a key element to adaptive capacity and reduced social and ecological vulnerability. Using a cluster analysis of landings, we identify four modes from 1974 to 2012 that are dominated (i.e., a given species accounting for the plurality of landings) by squid, sardine, anchovy, or lack any dominance, and seven points of transition among these periods. This approach enables us to determine which drivers are associated with each mode and each transition. Overall, we show that market and climate drivers are predominantly attributed to dominance transitions. Model selection of external drivers indicates that governance phases, reflected as perceived abundance, dictate long-term outcomes. Our findings suggest that globally, small-scale fishery managers should consider enabling shifts in effort among fisheries and retaining existing flexibility, as adaptive capacity is a critical determinant for social and ecological resilience.

  3. Immunological cross-reactivity between four distant parvalbumins-Impact on allergen detection and diagnostics.

    Science.gov (United States)

    Sharp, Michael F; Stephen, Juan N; Kraft, Lukas; Weiss, Thomas; Kamath, Sandip D; Lopata, Andreas L

    2015-02-01

    Fish are the largest and most diverse group of vertebrates. Fish are also a part of the eight food groups that cause the majority of IgE mediated food reactions. Detection tools for fish allergens are however limited due to the great diversity of fish species, despite fish allergy and its major allergen parvalbumin being well documented. The most commonly studied fish are frequently consumed in North America and Europe. However, much less is known about fish allergens in the Australasian region although fish is widely consumed in this region. A comprehensive phylogenetic analysis was performed of known parvalbumin amino acid sequences to determine possible candidate antigens for new cross-reactive antibodies to be used to detect most fish parvalbumins. Polyclonal rabbit antibodies were raised against parvalbumins from frequently consumed barramundi (Lates calcarifer), basa (Pangasius bocourti), pilchard (Sardinops sagax) and Atlantic salmon (Salmo salar). These were evaluated for cross-reactivity against a panel of 45 fish extracts (raw, heated and canned fish). Anti-barramundi parvalbumin proved to be the most cross-reactive antibody, detecting 87.5% of the 40 species analyzed, followed by anti-pilchard and anti-basa antibody. In contrast the anti-salmon antibody was very specific and only reacted to salmonidae and a few other fish. All analyzed fish species, except mahi mahi, swordfish, yellowfin tuna and all 5 canned fish had parvalbumin detected in raw extracts. However antibody reactivity to many fish was heat liable or susceptible to denaturation, demonstrating that some parvalbumins have most likely conformational epitopes, which lose antibody reactivity after heat treatment. We have demonstrated the generation of highly cross-reactive anti-parvalbumin antibodies that could be used for the detection of allergenic fish parvalbumin in contaminated food products. This cross-reactivity study thus shows processing of fish, especially canning, can have on impact

  4. Medidas de conservación y ordenación pesquera del jurel Trachurus murphyien el Perú

    Directory of Open Access Journals (Sweden)

    Jorge Zuzunaga

    2013-10-01

    Full Text Available Las pesquerías peruanas como actividades realizadas sobre recursos naturales renovables son reguladas por un marco jurídico, cuyo objetivo es asegurar su conservación y uso sostenible. La Ley General de Pesca (DL N°. 25977 señala que para cada tipo de pesquería y según la situación del recurso explotado debe establecerse un sistema de ordenamiento que concilie el principio de sostenibilidad de los recursos pesqueros o conservación en el largo plazo, con la obtención de los mayores beneficios económicos y sociales. En el ordenamiento pesquero del jurel Trachurus murphyi, las medidas incluyen entre otras, el régimen de acceso constituido por las autorizaciones de incremento de flota y permisos de pesca, que se otorgan solo a los buques cuyas capturas son destinadas únicamente para el consumo humano directo, de acuerdo a lo dispuesto en el Reglamento de Ordenamiento Pesquero (DS N.° 011-2007-PRODUCE. La obligación de destinar los recursos sardina Sardinops sagax, jurel T. murphyiy caballa Scomber japonicus al consumo humano directo rige desde septiembre 2002 (DS N°. 001-2002-PRODUCE. Otras medidas vigentes restringen el tamaño mínimo de malla de las redes, prohíben la captura de ejemplares menores de 31 cm de longitud total, determinan el inicio y cierre de las temporadas de pesca, los límites de captura o cuotas anuales. Estas disposiciones son complementadas por medidas de seguimiento, control y vigilancia para la efectiva conservación y uso sostenido del recurso.

  5. Dicty_cDB: Contig-U05475-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 44 5.3 1 ( GE816148 ) EST_scau_evk_967301 scauevk mixed_tissue Sebastes... 44 5...1904 srasevg mixed_tissue Sebastes... 44 5.3 1 ( EW980904 ) EST_sras_evg_781520 srasevg mixed_tissue Sebaste...s... 44 5.3 1 ( EW979029 ) EST_sras_evg_780173 srasevg mixed_tissue Sebastes... 4

  6. The chromium accumulation and its physiological effects in juvenile rockfish, Sebastes schlegelii, exposed to different levels of dietary chromium (Cr(6+)) concentrations.

    Science.gov (United States)

    Kim, Jun-Hwan; Kang, Ju-Chan

    2016-01-01

    Juvenile rockfish (mean length 13.7±1.7 cm, and mean weight 55.6±4.8 g) were exposed for 4 weeks with the different levels of dietary chromium (Cr(6+)) at 0, 30, 60, 120 and 240 mg/kg. The profile of chromium in the tissues of rockfish is dependent on the exposure periods and chromium concentration. After 4 weeks, the order of chromium accumulation in tissues was liver>kidney>spleen>intestine>gill>muscle. The dietary chromium exposure decreased the growth rate and hepatosomatic index of rockfish. The major hematological findings were significant decrease in the red blood cell (RBC) count, hematocrit (Ht) value, and hemoglobin (Hb) concentration exposed to ≥120 mg/kg chromium concentrations. The dietary chromium exposure (≥120 mg/kg) led to notable increase in glucose, cholesterol, glutamic oxalate transaminase (GOT), and glutamic pyruvate transaminase (GPT) in plasma, whereas there was no considerable change in calcium, magnesium, total protein, and alkaline phosphatase (ALP). The results indicated that the dietary chromium exposure to rockfish can induce significant chromium accumulation in the specific tissues, inhibition of growth, and hematological alterations. Copyright © 2015 Elsevier B.V. All rights reserved.

  7. Impact of El Niño events on pelagic fisheries in Peruvian waters

    Science.gov (United States)

    Ñiquen, Miguel; Bouchon, Marilú

    2004-03-01

    Using data from stock assesment surveys on pelagic resources during El Niño events of 1972/73, 1982/83, 1997/98, we analyze biological changes on pelagic ecosystems and pelagic fisheries during different stages of development of El Niño phenomenon: emergence, full, final and post-Niño. Results indicate changes in spatial distribution of resources, their concentration and size structure. In anchovy (Engraulis ringens) a decrease in biomass was observed, which was estimated at 1.2 million tons in September 1998, the lowest throughout the 1990s. This resource showed an asymmetric distribution towards the south of Peru. Other pelagic resources increased their biomass during or after Niño events, primarily sardine (Sardinops sagax), jack mackerel (Trachurus murphyi), pacific mackerel (Scomber japonicus), and longnose anchovy (Anchoa nasus). At the end of the El Niño phenomenon we found less productivity but more diversity in the pelagic ecosystem. During the 1997/98 El Niño, the diversity index (Manual de Ecologia, 1a Edition, Editorial Trillas, Mexico, 267pp) increased from 0.87 to 1.23-1.70. In both the emergence stage and fully developed stages of El Niño we found large numbers of sardine and longnose anchovy present simultaneously. Size structure of sardine, jack mackerel, and pacific mackerel showed an increase in juveniles. Anchovy during El Niño showed a single modal group composed of adults, but the post-Niño phase indicated an increase in juveniles with an average length of 6-7 cm. In El Niño conditions spawning among anchovy was low, but among sardine and pacific mackerel it was high. We observed, for the first time during full spawning, juvenile sardines with a total length of 18-20 cm. The anchovy spawning season during the post-Niño phase was considerably lengthened, from April to December 1998. Drastic change occurred in fisheries when monospecific fisheries, based on anchovy before El Niño, became multispecific fisheries based on sardine, jack

  8. Dicty_cDB: Contig-U05027-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available au_evk_975886 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE814922 ) EST_scau_e...vk_965902 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE812759 ) EST_scau_evk_973993 scauevk mixed_tissue Sebaste...s... 60 1e-04 1 ( GE812758 ) EST_scau_evk_963625 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE8089...60 ) EST_scau_evk_977800 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE808959 )... EST_scau_evk_962440 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE806311 ) EST_scau_evk_971428 scauevk mixed_tissue Sebaste

  9. Dicty_cDB: Contig-U04429-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BP230009B10H9 Soares normalized bovine placenta B... 46 2.4 1 ( EW982243 ) EST_sras_evg_774543 srasevg mixed_tissue Sebaste...s... 46 2.4 1 ( EW982242 ) EST_sras_evg_774159 srasevg mixed_tissue Sebastes... 46 2.4 1 ( C

  10. Trends in spatio-temporal distribution of Peruvian anchovy and other small pelagic fish biomass from 1966-2009 Tendencias espacio-temporales en la distribución de la biomasa de anchoveta peruana y de otros peces pelágicos pequenos entre 1966 y 2009

    Directory of Open Access Journals (Sweden)

    Mariano Gutiérrez

    2012-09-01

    Full Text Available Changes in abundance and distribution of anchovy and other species of pelagic fish of the Northern Humboldt Current System (NHCS are driven by environmental forcing variations in different time and spatial scales between the coastal 'cold' ecosystem and the 'warm' oceanic one. Data to study these fluctuations have come mostly from the fishery to show how anchovy (Engraulis ringens increases when sardine (Sardinops sagax declines and vice versa. However, using acoustic data on latitudinal biomass we show that other species as mackerel (Scomber japonicus and jack mackerel (Trachurus murphyi also follow the same opposed trend, then the fishery data hides the true dimension of the balance of abundance among species. Based on Hovmoller diagrams we scrutinized the changes in interannual latitudinal acoustic biomass, landings and influence of El Nino events from 1966 to 2009 in order to describe: 1 how the anchovy decadal distribution pattern moved from south to north since the 1960's; 2 how there have been produced concomitant changes in the latitudinal abundance and distribution of other species such as sardine, jack mackerel and mackerel before, during and after El Nino events; and 3 what was the overall effect of the succession of El Nino events on all these pelagic species. We concluded that: a every El Nino event has had an effect on the expansion or contraction of pelagic species distribution and abundance, with different latitudinal effects; and b the El Nino 1997-98 did not trigger but accelerated a decline phase on the abundance of sardine, jack mackerel and mackerel by a reduction of their ideal habitat due to an expansion of the coastal ecosystem caused by a shallower location of the upper limit of the Oxygen Minimum Zone (OMZ These findings observed using past data might be taken into consideration for fishery management purposes when considering future scenarios.Los cambios en la abundancia y distribución de anchoveta y de otras especies

  11. Preservación y abundancia de escamas de peces en sedimentos del margen continental de Chile (21-36° S Fish scale preservation and abundance in sediments from the continental margin off Chile (21-36° S

    Directory of Open Access Journals (Sweden)

    JAVIER A DÍAZ-OCHOA

    2008-12-01

    Full Text Available Con el objetivo de evaluar la relación entre la preservación de escamas de peces y las variaciones en las condiciones redox en sedimentos del margen continental de Chile, este trabajo presenta recuentos de escamas de peces y concentraciones normalizadas de elementos redox sensibles (Mo/Al, S/Al, Fe/Al en ocho testigos de sedimento recolectados en la zona de minimo oxígeno frente a Chile (Iquique: 20°15' S, bahía de Mejillones: 23° S y Concepción: 36° S. En el norte de Chile (Iquique y Mejillones predominan las escamas de anchoveta (Engraulis ringens y de peces de la familia Myctophidae (media = 90 y 120 escamas 1.000 cm-3, respectivamente mientras que en Chile centro-sur (Concepción son más abundantes las escamas de jurel (Trachurus murphy; media = 140 escamas 1.000 cm-3. La abundancia de escamas de merluza común (Merluccius gayi gayi y de sardina (Sardinops sagax es aproximadamente un orden de magnitud más baja que la de anchoveta o jurel. En general, los valores más altos y los rangos más amplios de variación en las razones Mo/Al, S/Al y Fe/Al se encuentran en Mejillones (Mo/Al ~0,8-12 mg g-1, S/Al 0,2-4,6 g g-1, Fe/Al 0,3-0,7 g g-1 seguidos por Iquique (Mo/Al -0,2-1,8; S/Al 0,2-0,7, Fe/Al 0,5-0,8, mientras que Concepción revela valores más bajos y poco variables (Mo/Al ~0,07, S/Al ~0,15 y Fe/Al ~0,5. La razón Mo/Al, utilizada como indicador de paleo-oxigenación, permite inferir condiciones reductoras relativamente más intensas en los sedimentos de la Bahía de Mejillones e Iquique que en Concepción. En las tres localidades de muestreo se evidencia una asociación estadísticamente significativa entre la abundancia de escamas de anchoveta y el logaritmo de la razón Mo/Al (r²= 0,46; P 1 mg g-1.The relationship between fish scale preservation and variations in the sediment redox conditions on Chile's continental shelf are evaluated herein through fish scale counts and normalized concentrations of redox sensitive elements

  12. Dicty_cDB: Contig-U04940-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iscoideum chromosome 2 map 3622643... 32 0.081 12 ( GE806545 ) EST_scau_evk_971547 scauevk mixed_tissue Sebaste...s... 40 0.092 2 ( EW978238 ) EST_sras_evg_777463 srasevg mixed_tissue Sebastes... 40 0.093 2 ( EW984986 )... EST_sras_evg_777879 srasevg mixed_tissue Sebastes... 40 0.095 2 ( EW985351 ) EST..._sras_evg_778065 srasevg mixed_tissue Sebastes... 40 0.096 2 ( AC116305 ) Dictyostelium discoideum chromosom

  13. Dicty_cDB: Contig-U04780-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Ancylostoma ceylanicum L3 Ancylostoma ... 44 6.7 1 ( GE813038 ) EST_scau_evk_974138 scauevk mixed_tissue Sebaste...s... 44 6.7 1 ( GE802768 ) EST_scau_evk_897256 scauevk mixed_tissue Sebastes... 44 6.7 1 ( GE802767 ) ES...T_scau_evk_896872 scauevk mixed_tissue Sebastes... 44 6.7 1 ( GE800881 ) EST_scau..._evk_891797 scauevk mixed_tissue Sebastes... 44 6.7 1 ( FD779328 ) NADG-aaa04h04.g1 Rhodnius_prolixus_EST_NA

  14. AFSC/ABL: Gulf of Alaska Diel Trawl Survey, 2005-2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Diel epipelagic sampling for juvenile Pacific salmon (Oncorhynchus spp.), rockfish (Sebastes spp.), sablefish (Anoplopoma fimbria), and associated species was...

  15. Marine and Anadromous Fish :: NOAA Fisheries

    Science.gov (United States)

    Conservation Commission bocaccio Bocaccio (Sebastes paucispinis) Photo: NOAA sand tiger shark Sand Tiger Shark Updated: June 29, 2017 Fisheries Service Home Information Quality Exit Disclaimer Linking Policy Privacy

  16. Dicty_cDB: Contig-U01585-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA, clone: ARN01A01NGRM0003_F0... 54 0.010 1 ( GE817509 ) EST_scau_evk_969928 scauevk mixed_tissue Sebaste...s... 54 0.010 1 ( GE798818 ) EST_scau_evk_889236 scauevk mixed_tissue Sebastes... 54 0.010 1 ( FK742846 ) av...Mus musculus NOD-derived CD11c +ve dendritic cell... 52 0.038 1 ( GE798817 ) EST_scau_evk_887700 scauevk mixed_tissue Sebaste

  17. Dicty_cDB: Contig-U04933-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available scauevk mixed_tissue Sebastes... 44 7.6 1 ( GE817117 ) EST_scau_evk_970879 scauevk mixed_tissue Sebastes... ...44 7.6 1 ( GE813196 ) EST_scau_evk_963850 scauevk mixed_tissue Sebastes... 44 7.6... 1 ( EW983400 ) EST_sras_evg_775142 srasevg mixed_tissue Sebastes... 44 7.6 1 ( CP001287 ) Cyanothece sp. PC...( BM514186 ) kx97c10.y1 Parastrongyloides trichosuri PA SL1 TO... 44 7.6 1 ( GE819488 ) EST_scau_evk_964044

  18. Dicty_cDB: Contig-U12374-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 372F20, 5'... 48 0.38 1 ( EW983915 ) EST_sras_evg_776173 srasevg mixed_tissue Sebastes... 48 0.38 1 ( EW9839...14 ) EST_sras_evg_775789 srasevg mixed_tissue Sebastes... 48 0.38 1 ( CP000382 ) Clostridium novyi NT, compl

  19. Dicty_cDB: Contig-U16210-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available omic DNA, comple... 38 7.6 3 ( EW976837 ) EST_sras_evg_784027 srasevg mixed_tissue Sebaste... ) EST_sras_evg_783643 srasevg mixed_tissue Sebastes... 32 8.7 2 ( CR382400 ) Plasmodium falciparum chromoso

  20. Dicty_cDB: Contig-U04374-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Anolis sagre... 46 1.6 1 ( GE801267 ) EST_scau_evk_891626 scauevk mixed_tissue Sebastes... 46 1.6 1 ( GE80...1266 ) EST_scau_evk_892010 scauevk mixed_tissue Sebastes... 46 1.6 1 ( FG735927 ) G1145P337RE22.T0 Anolis ca

  1. Dicty_cDB: Contig-U01337-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sophila willi... 34 5.4 2 ( GE797277 ) EST_scau_evk_889972 scauevk mixed_tissue Sebastes... 34 5.4 2 ( AC123...888797 ) CeleSEQ6116 Cunninghamella elegans pBluescript (E... 38 5.5 2 ( GE797278 ) EST_scau_evk_888052 scauevk mixed_tissue Sebaste

  2. AcEST: DK950544 [AcEST

    Lifescience Database Archive (English)

    Full Text Available some 3 SCAF14756, whole genome shot... 77 3e-13 tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste...|A8IF50_9PERC Intestinal peptide transporter OS=Sebastes nebulosus GN=SLC15A1 PE=2 SV=1 Length = 742 Score =

  3. Dicty_cDB: Contig-U14789-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available srasevg mixed_tissue Sebastes... 58 2e-04 1 ( EW978379 ) EST_sras_evg_773311 srasevg mixed_tissue Sebaste...FC752071 ) CBBI6157.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 58 2e-04 1 ( EW978380 ) EST_sras_evg_777535

  4. Dicty_cDB: Contig-U14691-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available eus mitochondrial gene for 16S... 34 0.077 3 ( EW986758 ) EST_sras_evg_779179 srasevg mixed_tissue Sebastes...... 38 0.079 2 ( EW986759 ) EST_sras_evg_779563 srasevg mixed_tissue Sebastes... 38 0.079 2 ( CP001078 ) Clos

  5. AcEST: DK951699 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8IF50_9PERC Intestinal peptide transporter OS=Sebaste... 93 8e-18 tr|A7ST97|A7ST97_NEMVE Predicted protein (...++D +L KY TI+YLS+ Y Sbjct: 66 ALCYLTPILGAIVADSWLGKYKTIVYLSIVY 96 >tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste

  6. Dicty_cDB: Contig-U00298-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available OK001788... 44 3.8 1 ( GE818144 ) EST_scau_evk_967951 scauevk mixed_tissue Sebaste...ras_evg_778912 srasevg mixed_tissue Sebastes... 44 3.8 1 ( BA000032 ) Vibrio parahaemolyticus RIMD 2210633 D

  7. AFSC/ABL: Rockfish Habitat Dive Video Transects

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Many species of commercially valuable rockfish (Sebastes spp.) inhabit waters on the outer continental shelf in the Gulf of Alaska typically between depths of...

  8. AFSC/ABL: Rockfish Barotrauma

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Because rockfish (Sebastes spp.) are physoclystic, i.e. their gas bladders are closed off from the gut, they often suffer internal injuries from rapid, internal air...

  9. AFSC/RACE/GAP/Conrath: Reproduction of Groundfish

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data are currently limited or lacking for several federally managed rockfish species of the genus Sebastes found within the Gulf of Alaska. This project is related...

  10. DNA data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Raw DNA chromatogram data produced by the ABI 373, 377, 3130 and 3730 automated sequencing machines in ABI format. These are from fish (primarily Sebastes spp.,...

  11. AFSC/ABL: Juvenile rockfish DNA species identification

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Many pelagic juvenile rockfish (Sebastes) were collected in juvenile salmonid surveys in the Gulf of Alaska (GOA) from 1998 to 2002. Often species identification of...

  12. Fish age validation study with bomb-produced radiocarbon (14C) conducted on yellowfin sole (Limanda aspera) and northern rockfish (Sebastes polyspinis) by Alaska Fisheries Science Center, Fisheries Monitoring and Analysis division from 1987-01-01 to 2004-01-01 (NCEI Accession 0134853)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish age validation with bomb-produced radiocarbon (14C) requires a known-age Delta14C reference chronology spanning the era of a marine increase in bomb-produced...

  13. The Benguela upwelling ecosystem lies adjacent to the south ...

    African Journals Online (AJOL)

    denise

    increase, but it is still below the levels of the early ... variability but no trends in either subsystem, and the seasonal pattern was similar for both ..... good spatial coverage of sardine landings, with a sig- ..... periods of simultaneous change in environmental pa- ..... monotypic sardines, Sardina and Sardinops: their taxonomy,.

  14. Redescription of the Indo-Pacific scorpionfish Scorpaenodes guamensis (Quoy & Gaimard 1824) (Scorpaenidae), a senior synonym of seven nominal species.

    Science.gov (United States)

    Motomura, Hiroyuki; Causse, Romain; Struthers, Carl D

    2016-01-21

    The Indo-Pacific scorpionfish, Scorpaenodes guamensis (Quoy & Gaimard 1824), is redescribed on the basis of 137 specimens, including types, from a wide geographic range in the Indo-Pacific. Seven nominal species, Scorpaena rubropunctata Cuvier in Cuvier & Valenciennes 1829, Sebastes minutus Cuvier in Cuvier & Valenciennes 1829, Scorpaena chilioprista Rüppell 1838, Scorpaena polylepis Bleeker 1851, Centropogon echinatus Macleay 1881, Scorpaena erinacea Garman 1903, and Scorpaenopsis quiescens Seale 1906, are regarded here as junior synonyms of S. guamensis. The type status of these nominal species is discussed, and lectotypes of Scorpaena guamensis, Scorpaena rubropunctata, Sebastes minutus, and Scorpaena polylepis are herein designated. Validity of Scorpaenopsis scaber (Ramsay & Ogilby 1886) is also discussed.

  15. Influence of on-board irradiation on the shelflife of redfish

    International Nuclear Information System (INIS)

    Reinacher, E.; Ehlermann, D.

    1978-01-01

    Continuing former investigations during two voyages of the RV 'Anton Dohrn' redfish (Sebastes marinus) was irradiated on board and stored under different conditions, wrapped and unwrapped under melting ice. A part of the irradiated, unwrapped samples was stored under irradiated ice. As in the former investigations the irradiation treatment effected no prolongation of shelflife in the range of marketable quality. (orig.) [de

  16. Dicty_cDB: Contig-U05126-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CP000939 ) Clostridium botulinum B1 str. Okra, complete genome. 34 2.5 18 ( GE803619 ) EST_scau_evk_893885 ...scauevk mixed_tissue Sebastes... 32 2.6 3 ( AM462416 ) Vitis vinifera contig VV78X219254.19, whole genom...

  17. Dicty_cDB: VHH251 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available srasevg mixed_tissue Sebastes... 32 0.80 2 dna update 2008.11. 7 Homology vs Protein Score E Sequences prod...( AM954142 ) Sparus aurata EST, clone cDN02P0004P17, 5'-end se... 32 0.80 2 ( EW981227 ) EST_sras_evg_782073

  18. Dicty_cDB: Contig-U04690-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available scauevk mixed_tissue Sebastes... 34 9.9 2 >( AU071707 ) Dictyostelium discoideum slug cDNA, clone SSC319. L... ( AP006852 ) Candida albicans genomic DNA, chromosome 7, compl... 32 9.3 2 ( GE799624 ) EST_scau_evk_888927

  19. Novel biodiversity baselines outpace models of fish distribution in Arctic waters

    DEFF Research Database (Denmark)

    Christiansen, Jørgen Schou; Bonsdorff, Erik; Byrkjedal, Ingvar

    2016-01-01

    During a recent marine biological expedition to the Northeast Greenland shelf break (latitudes 74–77 °N), we made the first discovery of Atlantic cod (Gadus morhua), beaked redfish (Sebastes mentella) and capelin (Mallotus villosus). Our novel observations shift the distribution range of Atlantic...

  20. Strontium-90 and cesium-137 in sea fish from Nov. 1983 to Jun. 1984

    International Nuclear Information System (INIS)

    1984-01-01

    Sr-90 and Cs-137 in sea fish were determined using radiochemical analysis. Seven species of fish (Branchiostegus sp., Katsuwonus pelamis, Limanda herzensteini, Sillago sihama, Pneumatophorus japonicus, Caesio chrysozonus cuvier, and Sebastes Inermis) were collected during the fishing season from 8 sampling locations. Only the edible part was used in case of larger sized fish, and the whole part was used in case of smaller ones. Each sample was weighed and placed in a stainless steel pan or a porcelain dish. After carbonized, the sample was ashed in an electric muffle furnace. The maximum values of Sr-90 was 1.0+-0.25 pCi/kg in Sebastes Inermis collected from Yamaguchi in April 1984; the maximum value of Cs-137 was 14.0+-0.60 pCi/kg in Katsuwonus pelamis collected from Kochi in May 1984. (Namekawa, K.)

  1. Otolith shape lends support to the sensory drive hypothesis in rockfishes.

    Science.gov (United States)

    Tuset, V M; Otero-Ferrer, J L; Gómez-Zurita, J; Venerus, L A; Stransky, C; Imondi, R; Orlov, A M; Ye, Z; Santschi, L; Afanasiev, P K; Zhuang, L; Farré, M; Love, M S; Lombarte, A

    2016-10-01

    The sensory drive hypothesis proposes that environmental factors affect both signalling dynamics and the evolution of signals and receivers. Sound detection and equilibrium in marine fishes are senses dependent on the sagittae otoliths, whose morphological variability appears intrinsically linked to the environment. The aim of this study was to understand if and which environmental factors could be conditioning the evolution of this sensory structure, therefore lending support to the sensory drive hypothesis. Thus, we analysed the otolith shape of 42 rockfish species (Sebastes spp.) to test the potential associations with the phylogeny, biological (age), ecological (feeding habit and depth distribution) and biogeographical factors. The results showed strong differences in the otolith shapes of some species, noticeably influenced by ecological and biogeographical factors. Moreover, otolith shape was clearly conditioned by phylogeny, but with a strong environmental effect, cautioning about the use of this structure for the systematics of rockfishes or other marine fishes. However, our most relevant finding is that the data supported the sensory drive hypothesis as a force promoting the radiation of the genus Sebastes. This hypothesis holds that adaptive divergence in communication has significant influence relative to other life history traits. It has already been established in Sebastes for visual characters and organs; our results showed that it applies to otolith transformations as well (despite the clear influence of feeding and depth), expanding the scope of the hypothesis to other sensory structures. © 2016 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2016 European Society For Evolutionary Biology.

  2. Using RAD-seq to recognize sex-specific markers and sex chromosome systems.

    Science.gov (United States)

    Gamble, Tony

    2016-05-01

    Next-generation sequencing methods have initiated a revolution in molecular ecology and evolution (Tautz et al. ). Among the most impressive of these sequencing innovations is restriction site-associated DNA sequencing or RAD-seq (Baird et al. ; Andrews et al. ). RAD-seq uses the Illumina sequencing platform to sequence fragments of DNA cut by a specific restriction enzyme and can generate tens of thousands of molecular genetic markers for analysis. One of the many uses of RAD-seq data has been to identify sex-specific genetic markers, markers found in one sex but not the other (Baxter et al. ; Gamble & Zarkower ). Sex-specific markers are a powerful tool for biologists. At their most basic, they can be used to identify the sex of an individual via PCR. This is useful in cases where a species lacks obvious sexual dimorphism at some or all life history stages. For example, such tests have been important for studying sex differences in life history (Sheldon ; Mossman & Waser ), the management and breeding of endangered species (Taberlet et al. ; Griffiths & Tiwari ; Robertson et al. ) and sexing embryonic material (Hacker et al. ; Smith et al. ). Furthermore, sex-specific markers allow recognition of the sex chromosome system in cases where standard cytogenetic methods fail (Charlesworth & Mank ; Gamble & Zarkower ). Thus, species with male-specific markers have male heterogamety (XY) while species with female-specific markers have female heterogamety (ZW). In this issue, Fowler & Buonaccorsi () illustrate the ease by which RAD-seq data can generate sex-specific genetic markers in rockfish (Sebastes). Moreover, by examining RAD-seq data from two closely related rockfish species, Sebastes chrysomelas and Sebastes carnatus (Fig. ), Fowler & Buonaccorsi () uncover shared sex-specific markers and a conserved sex chromosome system. © 2016 John Wiley & Sons Ltd.

  3. Henneguya sp. (Cnidospora:Myxosporida) parasitic in the heart of the bluefish, Pomatomus saltatrix.

    Science.gov (United States)

    Meyers, T R; Sawyer, T K; MacLean, S A

    1977-10-01

    A myxosporidan parasite, Henneguya sp., was discovered in the bulbus and truncus arteriosus of bluefish, Pomatomus saltatrix. Infected fish were captured from the Atlantic Ocean near Montauk Point, Long Island, New York, Raritan Bay, New Jersey, and Chesapeake Bay, Maryland. Comparative features of mature spores showed that they were similar to those of Henneguya sebasta Moser and Love 1975, from the bulbus arteriosus of seven species of California rockfish, Sebastes. Studies on growth stages of the parasite from both host species are necessary before a definite identification of the bluefish parasite can be made.

  4. Evaluation of a point-of-care blood analyzer and determination of reference ranges for blood parameters in rockfish.

    Science.gov (United States)

    Harrenstien, Lisa A; Tornquist, Susan J; Miller-Morgan, Timothy J; Fodness, Brian G; Clifford, Kevin E

    2005-01-15

    To compare values of blood parameters in rockfish obtained by use of a point-of-care portable blood analyzer with values determined by a veterinary diagnostic laboratory, calculate reference ranges for various blood parameters in black rockfish, and compare values of blood parameters in clinically normal fish with those of fish with clinical abnormalities. Prospective study. 41 captive adult black rockfish (Sebastes melanops) and 4 captive adult blue rockfish (Sebastes mystinus). Rockfish were anesthetized with tricaine methanesulfonate for collection of blood samples. Heparinized blood samples were immediately analyzed with a point-of-care analyzer. Blood sodium, potassium, chloride, urea nitrogen, and glucose concentrations; Hct; pH; partial pressure of carbon dioxide; total carbon dioxide concentration; bicarbonate concentration; base excess; and hemoglobin concentration were determined. A microhematocrit technique was used to determine PCV, and a refractometer was used to estimate total plasma protein concentration. Paired heparinized blood samples were transported to a veterinary diagnostic laboratory for analyses. Data obtained with the point-of-care analyzer were reproducible; however, values for most blood parameters were significantly different from those obtained by the veterinary diagnostic laboratory. Fish with poor body condition had several blood parameter values that were lower than corresponding values in clinically normal fish. Point-of-care blood analyses may prove useful in rockfish. Point-of-care data for a large number of clinically normal fish must be obtained for reference ranges to be calculated, and further assessments of clinically abnormal fish are necessary to determine the relevance of the data.

  5. Strontium-90 and cesium-137 in sea fish (from Nov. 1984 to Jun. 1985)

    International Nuclear Information System (INIS)

    1985-01-01

    Sr-90 and Cs-137 in sea fish were determined using radiochemical analysis. Seven species of fish (Branchiostegus sp., Katsuwonus pelamis, Limanda herzensteini, Sillago sihama, Scomber japonicus, Caesio chrysozonus cuvier, and Sebastes Inermis) were collected during the fishing season from nine sampling locations. Only the edible part was used in cases of larger sized fish, and the whole part was used in cases of smaller ones. Each sample was weighed and placed in a stainless steel pan or a porcelain dish. After carbonization, the sample was ashed in an electric muffle furnace. The maximum value of Sr-90 was 0.9 +- 0.26 pCi/kg in Limanda herzensteini collected from Hiroshima in March 1985; and that of Cs-137 was 12 +- 0.5 pCi/kg in Katsuwonus pelamis collected from Kochi in May 1985. (Namekawa, K.)

  6. Biochemical characteristics of four marine fish skins in Korea.

    Science.gov (United States)

    Cho, Jae-Kwon; Jin, Young-Guk; Rha, Sung-Ju; Kim, Seon-Jae; Hwang, Jae-Ho

    2014-09-15

    In this study, we investigated the biochemical characteristics of the fish skins of four industrial species: olive flounder (Paralichthys olivaceus), black rockfish (Sebastes schlegeli), sea bass (Lateolabrax maculatus) and red sea bream (Pagrus major). There is high domestic demand in Korea for farming of these fish for human consumption. Crude protein contents in the skin of these fish ranged from 73% to 94% by dry weight; this was in part due to a high content of the structural protein, collagen. Among the four species, olive flounder had the thickest dermal and epidermal layers in the dorsal skin. This species was also associated with the highest extraction ratio of acid-soluble collagen. We also examined whether fish skin could be a cost-effective alternative to current fish meal sources. Our analysis indicates that, when supplemented with additional fish oils and essential amino acids, fish skin is a viable alternative for fish meal formulations. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Histopathology of Marine and Freshwater Fish Lymphocytosis Disease Virus (LCDV)

    International Nuclear Information System (INIS)

    Hossain, M.; Myung-Joo, Oh

    2011-01-01

    Lymphocytosis disease (LCD) in fishes is caused by the agent called lymphocytosis disease virus (LCDV). LCDV is a chronic and benign virus. The disease affects 96 species of marine and fresh water fishes ranged among 34 families in the world. Affected fish with LCD has a typical external symptom with clusters consisted of enormously hypertrophied dermal cells on the skin and fins. The hypertrophied cells, generally named lymphocytosis cells, have a thick hyaline capsule, an enlarged nucleus and prominent basophilic cytoplasmic inclusions. Among the four species of fishes, olive flounder Paralichthys olivaceus, and rockfish Sebastes schlegeli were marine cultured fish, and gourami Trichogaster leeri and painted glass fish Channa baculis were freshwater ornamental fish. Although LCD causes low mortality, the disfigurement of infected fish can make them unsellable. Thus LCD has resulted in an important economic loss in the aquaculture industry. This study of histopathology may be adequate for a presumptive diagnosis of lymphocytosis diseases both in marine and freshwater fish species. (author)

  8. Incidence of Ichthyophonus hoferi in Puget Sound fishes and its increase with age of Pacific herring

    Science.gov (United States)

    Hershberger, P.K.; Stick, K.; Bui, B.; Carroll, C.; Fall, B.; Mork, C.; Perry, J.A.; Sweeney, E.; Wittouck, J.; Winton, J.; Kocan, R.

    2002-01-01

    A recent decrease in the mean age of adult Pacific herring Clupea pallasi in Puget Sound was associated with a high prevalence of Ichthyophonus hoferi, a protistan parasite that can be highly pathogenic to Pacific herring. In Puget Sound, high intensities of I. hoferiinfection may be maintained in older cohorts of Pacific herring because the prevalence ofI. hoferi increased with age from 12% among juveniles to 58% among the oldest, age-6 and older cohorts. Low intensities of I. hoferi infection in the region may be maintained in alternative fish hosts, such as surf smelt Hypomesus pretiosus, Puget Sound rockfishSebastes emphaeus, Pacific tomcod Microgadus proximus, and speckled sanddabCithanichthys stigmaeus.

  9. Ichthyophonus in sport-caught groundfishes from southcentral Alaska.

    Science.gov (United States)

    Harris, Bradley P; Webster, Sarah R; Wolf, Nathan; Gregg, Jacob L; Hershberger, Paul K

    2018-05-07

    This report of Ichthyophonus in common sport-caught fishes throughout the marine waters of southcentral Alaska represents the first documentation of natural Ichthyophonus infections in lingcod Ophiodon elongates and yelloweye rockfish Sebastes ruberrimus. In addition, the known geographic range of Ichthyophonus in black rockfish S. melanops has been expanded northward to include southcentral Alaska. Among all species surveyed, the infection prevalence was highest (35%, n = 334) in Pacific halibut Hippoglossus stenolepis. There were no gross indications of high-level infections or clinically diseased individuals. These results support the hypothesis that under typical conditions Ichthyophonus can occur at high infection prevalence accompanied with low-level infection among a variety of fishes throughout the eastern North Pacific Ocean, including southcentral Alaska.

  10. Ichthyophonus in sport-caught groundfishes from southcentral Alaska

    Science.gov (United States)

    Harris, Bradley P.; Webster, Sarah R.; Wolf, Nathan; Gregg, Jacob L.; Hershberger, Paul

    2018-01-01

    This report of Ichthyophonus in common sport-caught fishes throughout the marine waters of southcentral Alaska represents the first documentation of natural Ichthyophonus infections in lingcod Ophiodon elongates and yelloweye rockfish Sebastes ruberrimus. In addition, the known geographic range of Ichthyophonus in black rockfish S. melanops has been expanded northward to include southcentral Alaska. Among all species surveyed, the infection prevalence was highest (35%, n = 334) in Pacific halibut Hippoglossus stenolepis. There were no gross indications of high-level infections or clinically diseased individuals. These results support the hypothesis that under typical conditions Ichthyophonus can occur at high infection prevalence accompanied with low-level infection among a variety of fishes throughout the eastern North Pacific Ocean, including southcentral Alaska.

  11. Geographical, and seasonal variation in the diet of harbour porpoises (Phocoena phocoena in Icelandic coastal waters

    Directory of Open Access Journals (Sweden)

    Gísli A Víkingsson

    2003-07-01

    Overall capelin (Mallotus villosus comprised the predominant prey, followed by sandeel (Ammodytidae sp., then gadids, cephalopods and redfish (Sebastes marinus, while other taxa were of less importance. Differences were detected in diet composition among 5 areas around Iceland with redfish and gadids more prominent in the northern areas. Off SW Iceland there was considerable seasonal variation in the porpoise diet, where capelin appeared to be dominant in late winter and spring and sandeel in the summer through early winter. Predominance of capelin in the diet coincided with the spawning migration of capelin from northern waters along the east, south and west coasts of Iceland. Mature females appeared to have a more diverse diet than other reproductive classes. The length distributions of fish consumed by the porpoises ranged from 1 to 51 cm although most fish prey were less than 30 cm.

  12. Fish larvae from the Gulf of California

    Directory of Open Access Journals (Sweden)

    Gerardo Aceves-Medina

    2003-03-01

    Full Text Available Taxonomic composition of fish larvae was analysed from 464 plankton samples obtained during 10 oceanographic surveys in the Gulf of California between 1984 and 1988. We identified 283 taxa: 173 species, 57 genera, and 53 families. Tropical and subtropical species predominated except during the winter, when temperate-subarctic species were dominant. The most abundant species were the mesopelagic Benthosema panamense, Triphoturus mexicanus and Vinciguerria lucetia, but the coastal pelagic species Engraulis mordax, Opisthonema spp., Sardinops caeruleus and Scomber japonicus were also prominent. The taxonomic composition of the ichthyoplankton shows the seasonality of the Gulf as well as environmental changes that occurred between the 1984-1987 warm period and the 1956-1957 cool period previously reported. The presence of E. mordax larvae as one of the most abundant species in the Gulf provides evidence of the reproduction of this species two years before the development of the northern anchovy fishery and the decline of the sardine fishery in the Gulf of California.

  13. A review of Kudoa-induced myoliquefaction of marine fish species in South Africa and other countries

    Directory of Open Access Journals (Sweden)

    Sun S. Henning

    2013-11-01

    Full Text Available Myoliquefaction of fish musculature results in customer quality complaints and in huge economic losses, especially with regard to Pacific hake (Merluccius productus, farm-reared Atlantic salmon (Salmo salar, South African pilchards (Sardinops ocellatus and Cape snoek (Thyrsites atun. Myoliquefaction, or jelly flesh, is caused by proteolytic enzymes released by the marine myxosporean parasite,Kudoa thyrsites, after the death of the fish. Currently there are no fast methods of detection for this microscopic parasite, and because myoliquefaction is evident only after 38-56 h post-mortem, infected fish inevitably reach the processor and/or consumer. Several methods of detection have been investigated, but most of these methods are time-consuming and/or result in destruction of the fish, and are thus impractical for fishing vessels and fish processors. Limited research is available on possible means of destroying or inhibiting the post-mortem activity of the parasitic proteolytic enzyme. Means such as manipulating post-mortem pH and temperature control have been suggested; leaving opportunities for research into food technology applications such as cold-chain management and ionising radiation.

  14. Monthly variation in the Bioaccumulation of heavy metals and other safety issues in some marine and fresh water fish species in Ghana

    International Nuclear Information System (INIS)

    Arthur, W.

    2014-07-01

    Fish is one of the major sources of animal protein in Ghana and the fisheries industry is vital to the economy of the country. Unfortunately, most of the aquatic systems in Ghana are being polluted with domestic and industrial wastes which results in bioaccumulation of heavy metals in fish species. The traditional method for preserving fish in the country is by hot smoking or smoke drying, through freezing may be preferred where facilities are available. The presence of high levels of heavy metals in both fresh and smoked fish as well as other fish products is a matter of public health concern in Ghana. Variations in the level of bioaccumulation of heavy metals in both fresh and smoked marine fish, Sebastes marinus (red fish) and fresh water fish, Oreochromis niloticus (tilapia) caught off the coast of James Town in Accra and from the Volta river at Kpong respectively were monitored monthly from September 2013 to March 2014. Extension of two shelf life of the smoked fish species by gamma irradiation was also studied during 4 weeks of low temperature (5± 1 C ) storage by refrigeration. The total concentration of Iron (Fe), Zinc (Zn), Copper (Cu), Magnesium (Mg), Manganese (Mn), Cobalt (Co), Cadmium (Cd), Chromium (Cr), Arsenic (As) and Mercury (Hg) in the fish species as well as in their muscles, gills and bones were determined by Flame or Hydride Generation Atomic Absorption Spectrophotometry. The moisture content, pH, sensory analysis and population of aerobic mesophiles (on PCA), yeast and moulds (on OGYE), Escherichia coli (on EMB), Staphylococcus aureus (on BPA) and Salmonella (on XLD) in fresh fish, and smoked fish after treatment with 1, 2 and 3kGy of gamma irradiation and during storage were determined. Four patterns in the bioaccumulation of heavy metals in both Sebastes marinus and Oreochromis niloticus were observed over the 6 months monitoring period. Fe, Cu, Co and Cr accumulated heavily in the fish species during September and October after which the

  15. Composición taxonómica y relaciones zoogeográficas de los peces demersales de la costa occidental de Baja California Sur, México

    Directory of Open Access Journals (Sweden)

    Jesús Rodríguez-Romero

    2008-12-01

    Full Text Available Se presenta la composición sistemática de peces demersales de la costa occidental de Baja California Sur, límite de distribución norte de la ictiofauna del Pacífico Oriental Tropical. Se realizaron cuatro cruceros oceanográficos durante otoño de 2004 a marzo de 2006. Este listado incluye 220 especies, 132 géneros y 73 familias. El 26.3% corresponde a especies de amplia distribución desde la Provincia de San Diego a la Provincia Panámica y el 21.7% son especies restringidas a la región del Pacífico Oriental Tropical. Seis especies representan nuevos registros para la zona o ampliación de su ámbito de distribución. Las familias mejor representadas en número de especies fueron Paralichthyidae y Scorpaenidae, con 16 especies cada una. El género mejor representado fue Sebastes con 9 especies. Se presentan los nombres comunes, intervalo de tallas y el estatus de cada especie dentro de la comunidadTaxonomic composition and zoogeographic relations of demersal in the western coast of Baja California Sur, Mexico. The composition of demersal fish along the western coast of the State of Baja California Sur, México, including the limit of the northern distribution of the ichthyofauna of the eastern tropical Pacific, is presented. The survey was carried out on four oceanographic cruises between autumn 2004 and March 2006. Of 220 species in 132 genera and 73 families, 26.3% are species of wide distribution from San Diego County, USA to Panama and 21.7% are species restricted to the eastern tropical Pacific. Six species are new findings for the area or range expansions. The families with the most species are Paralichthyidae and Scorpaenidae, each with 16 species. The most frequent genus was Sebastes, with nine species. We present a table with common Spanish names, size range and status of each species inside the community. Rev. Biol. Trop. 56 (4: 1765-1783. Epub 2008 December 12.

  16. Fish community structure in San Agustín Bay, Huatulco, Mexico Estructura comunitaria de peces en bahía San Agustín, Huatulco, México

    Directory of Open Access Journals (Sweden)

    MARTÍN RAMÍREZ-GUTIÉRREZ

    2007-12-01

    Full Text Available San Agustín bay is one of the most important bays in the Huatulco National Park because it includes the broadest coral reef surface of this park, which supports a great diversity of fish species. The importance of the present work is that describes quantitatively, for first time, the fish assemblage of this reef area. Visual censuses were realized on transects, according to the coral reef size, on coral and rocky reefs, and coral rubble environments. 64 species, 46 genus and 29 families were registered. Seasonal variation in fish assemblage was observed; reflecting the influence of pelagic shoaling species associated with the Gulf of Tehuantepec upwelling, during the dry season. Thus species were Selar crumenophthalmus, Caranx caninus, and Sardinops caeruleus. For species more closely associated to the reef habitat little seasonal variation was observed for each species, except Chromis atrilobata, which exhibited high density during the dry season. Pomacentrids exhibited more affinity for coral reef, labrids and haemulids for coral rubble environments. The highest diversity values were on coral rubble and the highest density was on the coral reef. Our study suggests that in this region, the Gulf of Tehuantepec upwelling is an important factor as well as the heterogeneity of habitats in shaping the fish assemblages, which must be protected to maintain the biodiversity of this important ecosystemLa bahía de San Agustín es una de las más importantes del Parque Nacional Huatulco debido a que incluye al arrecife coralino más grande de este parque, el cual alberga una gran diversidad de especies de peces. La importancia del presente trabajo es describir cuantitativamente, por primera vez, la comunidad de peces de este habitat de arrecifes. Para ello se realizaron censos visuales en transectos de acuerdo al tamaño de los ambientes coralino, rocoso y de escombros. 64 especies, 46 géneros y 29 familias fueron registrados. Se observaron cambios

  17. [Mercury concentration of fish in Tokyo Bay and the surrounding sea area].

    Science.gov (United States)

    Zhang, R; Kashima, Y; Matsui, M; Okabe, T; Doi, R

    2001-07-01

    Total mercury in the muscles of three fish species was analyzed in fish caught in Tokyo Bay and the surrounding sea areas, Sagami Bay and Choshi. Tokyo Bay is a semi-closed sea area surrounded by Tokyo, Kanagawa and Chiba prefectures. Sagami Bay and Choshi are open to the Pacific Ocean. A total of 412 fish consisting of northern whiting (Sillago japonica), flatfish (Limanda yokohamae) and sardine (Sardinops melanosticta) were caught in these areas over a 6 months period from November 1998 to April 1999. Total mercury concentration ranged from 0.008-0.092 microgram/g (wet wt.) in northern whiting, 0.006-0.065 microgram/g in flatfish and 0.001-0.045 microgram/g in sardine. All concentrations were below the restriction limit of fish mercury in Japan, 0.4 microgram/g of total mercury concentration. A significant correlation was found between mercury concentrations and body length or body weight in northern whiting and flatfish, irrespective of the sea area. A correlation was also found between mercury concentration in fish and their feeding habits: among the 3 species caught in the same area, crustacean feeding northern whiting had the highest, polychaete feeding flatfish moderate, and plankton feeding sardine had the lowest mercury concentration. In a comparison of mercury concentration in the same species caught in different sea areas, a higher concentration was noted in fish caught in the semi-closed sea area of Tokyo Bay, than in fish caught in the open sea areas of Sagami Bay and Choshi. This difference was most marked in fish caught at the bottom of Tokyo Bay and we considered that the mercury concentration of seawater and sediment in these areas was the cause of mercury accumulation in fish. These findings suggest that improved water quality control and environmental monitoring is necessary in semi-closed sea areas such as Tokyo Bay.

  18. Cestodes of the blue shark, Prionace glauca (Linnaeus 1758), (Carcharhiniformes: Carcharhinidae), off the west coast of Baja California Sur, Mexico.

    Science.gov (United States)

    Méndez, Oscar; Galván-Magaña, Felipe

    2016-03-03

    The cestode species recovered from the spiral intestines of 27 blue sharks (Prionace glauca) (Linnaeus, 1758) are reported from the western coast of Baja California Sur (BCS). The sampling was undertaken on a monthly basis from January 2003 to January 2004. The helminthological examination indicated the presence of four species of cestodes: Platybothrium auriculatum Yamaguti, 1952; Prosobothrium japonicum Yamaguti, 1934; Anthobothrium caseyi (Yamaguti, 1934) Ruhnke & Caira, 2009; and Paraorygmatobothrium prionacis (Yamaguti, 1934) Ruhnke, 1994. Of all the 27 sharks examined, 88.8% were infected with at least one cestode species. The most frequent species was P. auriculatum infecting 85% of the spiral intestines examined. In contrast the species with the highest mean intensity was P. prionacis (80.4 200). The species richness of cestodes in P. glauca is very similar in other regions of the world despite its wide distribution; however, this richness is low compared with other species of sharks within the same family. The feeding and host-specific are important factors that influence the parameters of infection of cestodes in this shark. On the west coast of BCS, Prionace glauca feeds mainly on red crab Pleuroncodes planipes Stimpson, 1860; squids Gonatus californiensis Young, 1972, Ancistrocheirus lesueurii (D'Orbigny, 1842), Haliphron atlanticus Steenstrup, 1861, and low proportion of fish teleosts as Merluccius productus (Ayres, 1855), Sardinops sp. Hubbs, 1929 and Scomber japonicus Houttuyn, 1872. We speculate that these prey could be involved as the second intermediate hosts of these cestodes, as in other members of these genera, although the life cycles of none are known.

  19. Using non-systematic surveys to investigate effects of regional climate variability on Australasian gannets in the Hauraki Gulf, New Zealand

    Science.gov (United States)

    Srinivasan, Mridula; Dassis, Mariela; Benn, Emily; Stockin, Karen A.; Martinez, Emmanuelle; Machovsky-Capuska, Gabriel E.

    2015-05-01

    Few studies have investigated regional and natural climate variability on seabird populations using ocean reanalysis datasets (e.g. Simple Ocean Data Assimilation (SODA)) that integrate atmospheric information to supplement ocean observations and provide improved estimates of ocean conditions. Herein we use a non-systematic dataset on Australasian gannets (Morus serrator) from 2001 to 2009 to identify potential connections between Gannet Sightings Per Unit Effort (GSPUE) and climate and oceanographic variability in a region of known importance for breeding seabirds, the Hauraki Gulf (HG), New Zealand. While no statistically significant relationships between GSPUE and global climate indices were determined, there was a significant correlation between GSPUE and regional SST anomaly for HG. Also, there appears to be a strong link between global climate indices and regional climate in the HG. Further, based on cross-correlation function coefficients and lagged multiple regression models, we identified potential leading and lagging climate variables, and climate variables but with limited predictive capacity in forecasting future GSPUE. Despite significant inter-annual variability and marginally cooler SSTs since 2001, gannet sightings appear to be increasing. We hypothesize that at present underlying physical changes in the marine ecosystem may be insufficient to affect supply of preferred gannet main prey (pilchard Sardinops spp.), which tolerate a wide thermal range. Our study showcases the potential scientific value of lengthy non-systematic data streams and when designed properly (i.e., contain abundance, flock size, and spatial data), can yield useful information in climate impact studies on seabirds and other marine fauna. Such information can be invaluable for enhancing conservation measures for protected species in fiscally constrained research environments.

  20. Parasites as biological tags of marine, freshwater and anadromous fishes in North America from the Tropics to the Arctic.

    Science.gov (United States)

    Marcogliese, David J; Jacobson, Kym C

    2015-01-01

    Parasites have been considered as natural biological tags of marine fish populations in North America for almost 75 years. In the Northwest Atlantic, the most studied species include Atlantic cod (Gadus morhua), Atlantic herring (Clupea harengus) and the redfishes (Sebastes spp.). In the North Pacific, research has centred primarily on salmonids (Oncorhynchus spp.). However, parasites have been applied as tags for numerous other pelagic and demersal species on both the Atlantic and Pacific coasts. Relatively few studies have been undertaken in the Arctic, and these were designed to discriminate anadromous and resident salmonids (Salvelinus spp.). Although rarely applied in fresh waters, parasites have been used to delineate certain fish stocks within the Great Lakes-St Lawrence River basin. Anisakid nematodes and the copepod Sphyrion lumpi frequently prove useful indicators in the Northwest Atlantic, while myxozoan parasites prove very effective on the coast and open seas of the Pacific Ocean. Relative differences in the ability of parasites to discriminate between fish stocks on the Pacific and Atlantic coasts may be due to oceanographic and bathymetric differences between regions. Molecular techniques used to differentiate populations and species of parasites show promise in future applications in the field.

  1. Feeding Relationships among Six Seagrass-associated Fishes in the Northeastern Gwangyang Bay, Southern Korea

    Science.gov (United States)

    Park, Joo Myun; Kwak, Seok Nam; Han, In-Seong

    2018-03-01

    We conducted dietary analyses of six seagrass-associated fish species inhabiting northeastern Gwangyang Bay, Korea. These six species consumed a variety of benthic invertebrates and teleosts, but their preferences for different food resources varied. Although all species consumed crustaceans, the contributions of different crustacean taxa differed among the species' diets. Caridean shrimps and crabs were a significant part of the Hexagrammos agrammus and H. otakii diets, respectively, while amphipods were consumed mainly by Sebastes inermis. Caridean shrimps and prawns were abundant within the Lateolabrax japonicas diet, but were not common prey resources for Pseudopleuronectes yokohamae or S. schlegelii. Polychaetes and ophiurids were ingested by P. yokohamae, and the former prey taxon also made moderate contributions to the diets of H. agrammus and L. japonicus. With the exception of P. yokohamae, the diets of all species included teleosts. Teleosts contributed the largest proportion of the S. schlegelii diet, followed by the S. inermis and L. japonicas diets; however, H. agrammus and H. otakii rarely consumed teleosts. Non-metric multidimensional scaling (nMDS) ordination plots and permutational analysis of variance (PERMANOVA) revealed the variation in dietary composition among species and the contributions of each prey taxon. These interspecific differences in diet increase the range of food resources available to these fishes, thereby reducing competition for resources within the fish community in this region.

  2. Retrospective analysis: bile hydrocarbons and histopathology of demersal rockfish in Prince William Sound, Alaska, after the Exxon Valdez oil spill

    International Nuclear Information System (INIS)

    Marty, G.D.; Okihiro, M.S.; Hanes, D.

    2003-01-01

    Demersal rockfish are the only fish species that have been found dead in significant numbers after major oil spills, but the link between oil exposure and effect has not been well established. After the 1989 Exxon Valdez oil spill in Prince William Sound, Alaska, several species of rockfish (Sebastes spp.) from oiled and reference sites were analyzed for hydrocarbon metabolites in bile (1989-1991) and for microscopic lesions (1990 and 1991). Biliary hydrocarbons consistent with exposure to Exxon Valdez oil were elevated in 1989, but not in 1990 or 1991. Significant microscopic findings included pigmented macrophage aggregates and hepatic megalocytosis, fibrosis, and lipid accumulation. Site differences in microscopic findings were significant with respect to previous oil exposure in 1991 (P=0.038), but not in 1990. However, differences in microscopic findings were highly significant with respect to age and species in both years (P<0.001). We concluded that demersal rockfish were exposed to Exxon Valdez oil in 1989, but differences in microscopic changes in 1990 and 1991 were related more to age and species differences than to previous oil exposure. (author)

  3. Evidence of bottom-up limitations in nearshore marine systems based on otolith proxies of fish growth

    Science.gov (United States)

    von Biela, Vanessa R.; Kruse, Gordon H.; Mueter, Franz J.; Black, Bryan A.; Douglas, David C.; Helser, Thomas E.; Zimmerman, Christian E.

    2015-01-01

    Fish otolith growth increments were used as indices of annual production at nine nearshore sites within the Alaska Coastal Current (downwelling region) and California Current (upwelling region) systems (~36–60°N). Black rockfish (Sebastes melanops) and kelp greenling (Hexagrammos decagrammus) were identified as useful indicators in pelagic and benthic nearshore food webs, respectively. To examine the support for bottom-up limitations, common oceanographic indices of production [sea surface temperature (SST), upwelling, and chlorophyll-a concentration] during summer (April–September) were compared to spatial and temporal differences in fish growth using linear mixed models. The relationship between pelagic black rockfish growth and SST was positive in the cooler Alaska Coastal Current and negative in the warmer California Current. These contrasting growth responses to SST among current systems are consistent with the optimal stability window hypothesis in which pelagic production is maximized at intermediate levels of water column stability. Increased growth rates of black rockfish were associated with higher chlorophyll concentrations in the California Current only, but black rockfish growth was unrelated to the upwelling index in either current system. Benthic kelp greenling growth rates were positively associated with warmer temperatures and relaxation of downwelling (upwelling index near zero) in the Alaska Coastal Current, while none of the oceanographic indices were related to their growth in the California Current. Overall, our results are consistent with bottom-up forcing of nearshore marine ecosystems—light and nutrients constrain primary production in pelagic food webs, and temperature constrains benthic food webs.

  4. Influence of on-board irradiation on the shelflife of redfish. Pt. 2

    International Nuclear Information System (INIS)

    Karnop, G.; Antonacopoulos, N.; Muenzer, R.

    1978-01-01

    Bacteriological and chemical investigations on extending the shelflife of fresh iced unpacked redfish (Sebastes marinus) be 100 krad irradiation were carried out during two voyages of RV 'Anton Dohrn'. Bacteriological criteria indicated no shelflife extension on one voyage and an extension by 5 - 7 days on the other voyage. Chemical indices indicated an extension of 4 - 6 and more then 10 days, respectively. Delayed irradiation after 7 days storage in ice influenced only the chemical values (4 - 6 days shelflife extension), while reirradiation on the 6th day affected both the bacteriological (some days extension) and the chemical values (more than 10 days extension). The greatest effect was obtained with whole fish irradiated and stored in plastic bags, which - due to the dominance of biologically largely inactive Moraxella sp. - on the 28th day showed nearly the initial chemical values. Together with the previously published sensoric findings (13) these results indicate no or only a slight prolongation of shelflife of unpacked iced redfish due to irradiation at once or on the 7th day or both at once and on the 7th day. (orig.) [de

  5. Temporal and sex-specific variability in Rhinoceros Auklet diet in the central California Current system

    Science.gov (United States)

    Carle, Ryan D.; Beck, Jessie N.; Calleri, David M.; Hester, Michelle M.

    2015-06-01

    We used stable isotopes (δ15N and δ13C) and compared prey provided to chicks by each sex to evaluate seasonal and sex-specific diets in Rhinoceros Auklets (Cerorhinca monocerata) in the central California Current system during 2012-2013. Mixing models indicated northern anchovy (Engraulis mordax) were important prey for adults during fall/winter and juvenile rockfishes (Sebastes spp.) were important prey during incubation both years. Adult trophic level increased between incubation and chick-rearing periods in both years. During 2012, δ15N and δ13C of chick-rearing males and females differed significantly; mixing models indicated that females ate more Pacific saury (Cololabis saira) and less market squid (Doryteuthis opalescens) than males. Likewise, females delivered significantly more Pacific saury and less market squid to chicks than males during 2012. Chick growth (g d- 1) and chick survival to fledging were significantly lower during 2012 than 2013, likely because chicks were fed lesser quality prey or fed less frequently in 2012. Lesser body mass of females during incubation in 2012 indicated sex-specific diet differences may have been related to female energetic constraints. The observed variability in Rhinoceros Auklet diet underscores the importance of managing multiple prey populations in this system so that generalist predators have sufficient resources through changing conditions.

  6. Larval abundances of rockfishes that were historically targeted by fishing increased over 16 years in association with a large marine protected area.

    Science.gov (United States)

    Thompson, Andrew R; Chen, Dustin C; Guo, Lian W; Hyde, John R; Watson, William

    2017-09-01

    Marine protected areas (MPAs) can facilitate recovery of diminished stocks by protecting reproductive adults. To effectively augment fisheries, however, reproductive output must increase within the bounds of MPAs so that larvae can be exported to surrounding areas and seed the region. In response to dramatic declines of rockfishes ( Sebastes spp.) in southern California by the late 1990s two large MPAs, the Cowcod Conservation Areas (CCAs), were established in 2001. To evaluate whether the CCAs affected rockfish productivity we evaluated the dynamics of 8 species that were, and 7 that were not, historically targeted by fishing. Abundances of 6/8 targeted and 4/7 non-targeted species increased regionally from 1998 to 2013. These upturns were probably affected by environmental conditions in addition to changes in fishing pressure as the presence of most species correlated negatively with temperature, and temperature was lower than the historic average in 11/15 years. Seventy-five per cent of the targeted, but none of the non-targeted species increased at a greater rate inside than outside the CCAs while controlling for environmental factors. Results indicate that management actions, coupled with favourable environmental conditions, facilitated the resurgence of multiple rockfish species that were targeted by intense fishing effort for decades.

  7. Structure-forming corals and sponges and their use as fish habitat in Bering Sea submarine canyons.

    Directory of Open Access Journals (Sweden)

    Robert J Miller

    Full Text Available Continental margins are dynamic, heterogeneous settings that can include canyons, seamounts, and banks. Two of the largest canyons in the world, Zhemchug and Pribilof, cut into the edge of the continental shelf in the southeastern Bering Sea. Here currents and upwelling interact to produce a highly productive area, termed the Green Belt, that supports an abundance of fishes and squids as well as birds and marine mammals. We show that in some areas the floor of these canyons harbors high densities of gorgonian and pennatulacean corals and sponges, likely due to enhanced surface productivity, benthic currents and seafloor topography. Rockfishes, including the commercially important Pacific ocean perch, Sebastes alutus, were associated with corals and sponges as well as with isolated boulders. Sculpins, poachers and pleuronectid flounders were also associated with corals in Pribilof Canyon, where corals were most abundant. Fishes likely use corals and sponges as sources of vertical relief, which may harbor prey as well as provide shelter from predators. Boulders may be equivalent habitat in this regard, but are sparse in the canyons, strongly suggesting that biogenic structure is important fish habitat. Evidence of disturbance to the benthos from fishing activities was observed in these remote canyons. Bottom trawling and other benthic fishing gear has been shown to damage corals and sponges that may be very slow to recover from such disturbance. Regulation of these destructive practices is key to conservation of benthic habitats in these canyons and the ecosystem services they provide.

  8. Structure-forming corals and sponges and their use as fish habitat in Bering Sea submarine canyons.

    Science.gov (United States)

    Miller, Robert J; Hocevar, John; Stone, Robert P; Fedorov, Dmitry V

    2012-01-01

    Continental margins are dynamic, heterogeneous settings that can include canyons, seamounts, and banks. Two of the largest canyons in the world, Zhemchug and Pribilof, cut into the edge of the continental shelf in the southeastern Bering Sea. Here currents and upwelling interact to produce a highly productive area, termed the Green Belt, that supports an abundance of fishes and squids as well as birds and marine mammals. We show that in some areas the floor of these canyons harbors high densities of gorgonian and pennatulacean corals and sponges, likely due to enhanced surface productivity, benthic currents and seafloor topography. Rockfishes, including the commercially important Pacific ocean perch, Sebastes alutus, were associated with corals and sponges as well as with isolated boulders. Sculpins, poachers and pleuronectid flounders were also associated with corals in Pribilof Canyon, where corals were most abundant. Fishes likely use corals and sponges as sources of vertical relief, which may harbor prey as well as provide shelter from predators. Boulders may be equivalent habitat in this regard, but are sparse in the canyons, strongly suggesting that biogenic structure is important fish habitat. Evidence of disturbance to the benthos from fishing activities was observed in these remote canyons. Bottom trawling and other benthic fishing gear has been shown to damage corals and sponges that may be very slow to recover from such disturbance. Regulation of these destructive practices is key to conservation of benthic habitats in these canyons and the ecosystem services they provide.

  9. Feeding habits of harp and hooded seals in Greenland waters

    Directory of Open Access Journals (Sweden)

    Finn O Kapel

    2000-05-01

    Full Text Available Results of stomach contents analyses of harp and hooded seals collected in West Greenland waters in the period 1986-1993 are reviewed, and compared with published data and circumstantial information from local hunters.  The diet of harp seals in this region is variable but consists mainly of pelagic crustaceans (Thysanoessa spp. and Parathemisto libellula and small fish species like capelin (Mallotus villosus, sandeel (Ammodytes spp., polar cod (Boreogadus saida and Arctic cod (Arctogadus glacialis. Species of importance for commercial fisheries in Greenland, such as Northern prawn (Pandalus borealis, Atlantic cod (Gadus morhua, and Greenland halibut (Reinhardtius hippoglossoides play a minor role in the diet of harp seals in this area. Variation in the diet of hooded seals is less well documented, but in addition to the species also taken by harp seals, larger demersal fishes like Greenland halibut, redfish (Sebastes spp., cod, and wolffish (Anarhichas minor are apparently important prey items.

  10. Ichthyophonus in Puget Sound rockfish from the San Juan Islands archipelago and Puget Sound, Washington, USA

    Science.gov (United States)

    Halos, D.; Hart, S.A.; Hershberger, P.; Kocan, R.

    2005-01-01

    In vitro explant cultures identified Ichthyophonus in 10.9% of 302 Puget Sound rockfish Sebastes emphaeus sampled from five sites in the San Juan Islands archipelago and Puget Sound, Washington, in 2003. None of the infected fish exhibited visible lesions and only a single fish was histologically positive. Significantly more females were infected (12.4%) than males (6.8%), and while infected males were only detected at two of the five sites, infected females were identified at all sites, with no significant differences in infection prevalence. Genomic sequences of Ichthyophonus isolates obtained from Puget Sound rockfish, Pacific herring Clupea pallasii, and Yukon River Chinook salmon Oncorhynchus tshawytscha were identical in both the A and B regions of the small subunit 18S ribosomal DNA but were different from Ichthyophonus sequences previously isolated from four different species of rockfish from the northeastern Pacific Ocean. Ichthyophonus in Puget Sound rockfish may not have been previously detected because the infection is subclinical in this species and earlier investigators did not utilize in vitro techniques for diagnosis of ichthyophoniasis. However, since clinical ichthyophoniasis has recently been identified in several other species of northeast Pacific rockfishes, it is hypothesized that this either is an emerging disease resulting from changing marine conditions or the result of introduction by infected southern species that appear during periodic El Nin??o events. ?? Copyright by the American Fisheries Society 2005.

  11. Parasite infection and immune and health-state in wild fish exposed to marine pollution.

    Science.gov (United States)

    Sueiro, María Cruz; Bagnato, Estefanía; Palacios, María Gabriela

    2017-06-15

    Association between parasitism and immunity and health-state was investigated in wild Sebastes oculatus after having determined that pollution exposure is associated with altered immune and health-state parameters. Given the importance of the immune system in antiparasite defense we predicted: (i) parasite infection would be higher in pollution-exposed than in control fish and (ii) fish with lower immune and health-state parameters would show higher parasitism than fish in better condition. Metazoan parasite fauna was compared between pollution-exposed and non-exposed fish and parasitic indices were correlated with integrated measures of immunity and health-state. Results provided little support for the predictions; some parasite taxa increased, some decreased, and some were not affected in pollution-exposed fish despite their altered health and immunity. Furthermore, there was no link between individual immune and health-state parameters and parasitism. These findings highlight the complexity of host-parasite-environment interactions in relation to pollution in natural marine ecosystems. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Ecological conversion efficiency and its influencers in twelve species of fish in the Yellow Sea Ecosystem

    Science.gov (United States)

    Tang, Qisheng; Guo, Xuewu; Sun, Yao; Zhang, Bo

    2007-09-01

    The ecological conversion efficiencies in twelve species of fish in the Yellow Sea Ecosystem, i.e., anchovy ( Engraulis japonicus), rednose anchovy ( Thrissa kammalensis), chub mackerel ( Scomber japonicus), halfbeak ( Hyporhamphus sajori), gizzard shad ( Konosirus punctatus), sand lance ( Ammodytes personatus), red seabream ( Pagrus major), black porgy ( Acanthopagrus schlegeli), black rockfish ( Sebastes schlegeli), finespot goby ( Chaeturichthys stigmatias), tiger puffer ( Takifugu rubripes), and fat greenling ( Hexagrammos otakii), were estimated through experiments conducted either in situ or in a laboratory. The ecological conversion efficiencies were significantly different among these species. As indicated, the food conversion efficiencies and the energy conversion efficiencies varied from 12.9% to 42.1% and from 12.7% to 43.0%, respectively. Water temperature and ration level are the main factors influencing the ecological conversion efficiencies of marine fish. The higher conversion efficiency of a given species in a natural ecosystem is acquired only under the moderate environment conditions. A negative relationship between ecological conversion efficiency and trophic level among ten species was observed. Such a relationship indicates that the ecological efficiency in the upper trophic levels would increase after fishing down marine food web in the Yellow Sea ecosystem.

  13. Concentration of trace elements in marine organisms

    International Nuclear Information System (INIS)

    Ishii, Takaaki; Suzuki, Hamaji; Iimura, Mitsue; Koyanagi, Taku

    1976-01-01

    Information on the quality and quantity of stable trace elements in marine environments is frequently required to analyze the radioecological behavior of radionuclides released from nuclear facilities into the sea. In the present work, special attention was concentrated in determination of stable Mn, Fe, Co, Zn, Rb and Cs in marine organisms to estimate the concentration factors for these elements and corresponding radionuclides. Marine organisms (fishes, marine invertebrates and seaweeds) were collected at the seashore of Ibaragi prefecture and provided for chemical analysis after dry-ashing and wet-ashing. Atomic absorption spectrophotometry and neutron activation analysis were applied to determine the concentration of elements. The concentration of stable elements in fish muscle was independent on species of the fishes though slightly higher trends were observed in ''Usumebaru'', Sebastes nivosus for Cs, ''Ishimochi'', Nibea mitsukurii for Zn and Fe compared with other species. The concentration of Co, Zn and Fe in muscle of marine invertebrates was one order of magnitude higher than fish muscles especially in shellfishes for Co. Seaweeds showed peculiar species specificity for the concentration of stable trace elements and remarkable differences was observed between the species even among the same genus. (auth.)

  14. Application of acoustic telemetry to assess residency and movements of rockfish and lingcod at created and natural habitats in Prince William Sound.

    Directory of Open Access Journals (Sweden)

    Brad F Reynolds

    Full Text Available Loss and/or degradation of nearshore habitats have led to increased efforts to restore or enhance many of these habitats, particularly those that are deemed essential for marine fishes. Copper rockfish (Sebastes caurinus and lingcod (Ophiodon enlongatus are dominant members of the typical reef fish community that inhabit rocky and high-relief substrates along the Pacific Northwest. We used acoustic telemetry to document their residency and movements in the nearshore waters of Prince William Sound, Alaska in order to assess use of created reef habitat in an individual-based manner. A total of 57 fish were surgically implanted with acoustic transmitters. Forty-five fish were captured and monitored in three habitats: artificial reef, low-relief natural reef, and patchy high-relief natural reef. Within each habitat, both rockfish and lingcod exhibited long periods of residency with limited movements. Twelve rockfish were captured at the natural reefs and displaced a distance of 4.0 km to the artificial reef. Five of the 12 rockfish returned within 10 d of their release to their initial capture site. Another five of the 12 displaced fish established residency at the artificial reef through the duration of our study. Our results suggest the potential for artificial reefs to provide rockfish habitat in the event of disturbances to natural habitat.

  15. Detection of lymphocystis disease virus in Japanese flounder Paralichthys olivaceus and other marine teleosts from northern China

    Science.gov (United States)

    Zhan, Wenbin; Li, Yongqin; Sheng, Xiuzhen; Xing, Jing; Tang, Xiaoqian

    2010-11-01

    We isolated a strain of lymphocystis disease virus (LCDV) from Japanese flounder ( Paralichthys olivaceus) cultured in northern China. Based on published sequences of major capsid protein (MCP) gene of LCDV-cn (GenBank: AF126405), we designed two primer sets P1/P2 and P3/P4. We then used one-step or nested PCR and in-situ hybridization (ISH) to detect LCDV and identify the target tissues or cells in infected Japanese flounder. The PCR products were positive in purified viral supernatant, skin nodules, gut, gill, kidney, spleen, stomach, heart, and liver of Japanese flounder. We compared the DNA sequence with 14 MCP nucleotide sequences from GenBank, including Megalocytivirus (OFIV and RSIV), Iridovirus (CzIV and WIV), Ranavirus (TFV and FV3), and Lymphocystivirus (8 LCDV). Based on the alignment, we confirmed the PCR product was from Lymphocystivirus (GenBank accession number DQ279090 (LCDV-HD)). Using ISH, we noted the presence of LCDV in the skin nodules, gut, gill, spleen, stomach, and heart of spontaneously infected Japanese flounders. We successfully amplified LCDV fragments from Schlegel’s black rockfish ( Sebastes schlegeli Higendorf), redwing sea robin ( Lepidotrigla microptera Günther) and turbot ( Scophthalmus maximus) using the one-step and nested PCR, suggesting the target genes can be widely detected in fish using this method.

  16. Elucidating dynamic responses of North Pacific fish populations to climatic forcing: Influence of life-history strategy

    Science.gov (United States)

    Yatsu, A.; Aydin, K. Y.; King, J. R.; McFarlane, G. A.; Chiba, S.; Tadokoro, K.; Kaeriyama, M.; Watanabe, Y.

    2008-05-01

    In order to explore mechanistic linkages between low-frequency ocean/climate variability, and fish population responses, we undertook comparative studies of time-series of recruitment-related productivity and the biomass levels of fish stocks representing five life-history strategies in the northern North Pacific between the 1950s and the present. We selected seven species: Japanese sardine ( Sardinopus melanostictus) and California sardine ( Sardinopus sagax) (opportunistic strategists), walleye pollock ( Theragra chalcogramma, intermediate strategist), pink salmon ( Oncorhynchus gorbuscha, salmonic strategist), sablefish ( Anoplopoma fimbria) and Pacific halibut ( Hippoglossus stenolepis) (periodic strategists) and spiny dogfish ( Squalus acanthias, equilibrium strategist). The responses in terms of productivity of sardine, pink salmon, sablefish and halibut to climatic regime shifts were generally immediate, delayed, or no substantial responses depending on the particular regime shift year and fish stock (population). In walleye pollock, there were some periods of high productivity and low productivity, but not coincidental to climatic regime shifts, likely due to indirect climate forcing impacts on both bottom-up and top-down processes. Biomass of zooplankton and all fish stocks examined, except for spiny dogfish whose data were limited, indicated a decadal pattern with the most gradual changes in periodic strategists and most intensive and rapid changes in opportunistic strategists. Responses of sardine productivity to regime shifts were the most intense, probably due to the absence of density-dependent effects and the availability of refuges from predators when sardine biomass was extremely low. Spiny dogfish were least affected by environmental variability. Conversely, spiny dogfish are likely to withstand only modest harvest rates due to their very low intrinsic rate of increase. Thus, each life-history strategy type had a unique response to climatic

  17. A LATE SANTONIAN FISH-FAUNA FROM THE EUTAW FORMATION OF ALABAMA RECONSTRUCTED FROM OTOLITHS

    Directory of Open Access Journals (Sweden)

    WERNER W. SCHWARZHANS

    2018-01-01

    Full Text Available The otoliths described here from the Late Santonian of the Eutaw Formation of Alabama, represent one of the earliest association of teleost otoliths known from North America and it is remarkable for its good preservation and species diversity. They were collected by the late C.K. Lamber in 1969 from a road cut on the Hurtsboro-Marvyn highway south of Marvyn in Russell County, eastern Alabama. It contains 18 taxa based on sagittae otoliths, of which 14 are identifiable to the species level, 10 species are new to science and five new genera. The new otolith-based genera are: Allogenartina n. gen. (Stomiiformes family indet., Pseudotrichiurus n. gen. (Aulopiformes family indet., Eutawichthys n. gen. (Beryciformes family indet., Cowetaichthys n. gen. (Polymixiidae and Vox n. gen. (Teleostei family indet.; the new species are: Elops eutawanus n. sp., Genartina cretacea n. sp., Allogenartina muscogeei n. sp., Pseudotrichiurus sagax n. sp., Apateodus? assisi n. sp., Eutawichthys compressus n. sp., Eutawichthys stringeri n. sp., Cowetaichthys alabamae n. sp., Cowetaichthys lamberi n. sp. and Vox thlotlo n. sp. In addition, 8 different morphologies are recognized based on lapilli otoliths, which however cannot be identified to a distinct taxonomic level except for a species of the Ariidae. Two taxa can be related to otoliths recently recorded in situ, pertaining to the genera Osmeroides and Apateodus. The otolith association bears much similarity with those of the Campanian to Maastrichtian of the USA described previously as indicated by the dominance of otoliths of the genera Eutawichthys and Osmeroides. Differences with those faunas are on the species level as well as in the accessory components. The abundance of otoliths of the albuliforms (Osmeroides, putative stomiiforms (Allogenartina, beryciform (Eutawichthys and polymixiids (Cowetaichthys characterizes a rather stable faunal composition through the entire Late Cretaceous of locations studied in

  18. [A development of Byzantine Christian charities during the 4(th)-7(th) centuries and the birth of the hospital].

    Science.gov (United States)

    Nam, Sung Hyun

    2015-04-01

    This study aims to examine the beginning and the development of Christian Charities during the 4(th)-6(th) centuries which would eventually result in the birth of the hospital in modern sense in the first half of the 7(th) century. For this purpose, I looked carefully into various primary sources concerning the early Christian institutions for the poor and the sick. Above all, it's proper to note that the first xenodocheion where hospitality was combined with a systematic caring, is concerned with the Trinitarian debate of the 4(th) century. In 356, Eustathios, one of the leaders of homoiousios group, established xenodocheion to care for the sick and the lepers in Sebaste of Armenia, whereas his opponent Aetios, doctor and leader of the heteroousios party, was reckoned to have combined the medical treatment with his clerical activities. Then, Basil of Caesarea, disciple of Eustathios of Sebaste, also founded in 372 a magnificent benevolent complex named 'Basileias' after its founder. I scrupulously analysed several contemporary materials mentioning the charitable institution of Caesarea which was called alternatively katagogia, ptochotropheion, xenodocheion. John Chrysostome also founded several nosokomeia in Constantinople at the end of the 4(th) century and the beginning of the 5(th) century. Apparently, the contemporary sources mention that doctors existed for these Charities, but there is no sufficient proof that these 'Christian Hospitals,' Basileias or nosokomeia of Constantinople were hospitals in modern sense. Imperial constitutions began to mention ptochotropheion, xenodocheion and orphanotropheion since the second half of the 5(th) century and then some Justinian laws evoked nosokomium, brephotrophia, gerontocomia. These laws reveal that 'Christian Hospitals' were well clarified and deeply rooted in Byzantine society already in these periods. And then, new benevolent institutions emerged in the 6(th) century: nosokomeia for a specific class and

  19. Selective algicidal action of peptides against harmful algal bloom species.

    Directory of Open Access Journals (Sweden)

    Seong-Cheol Park

    Full Text Available Recently, harmful algal bloom (HAB, also termed "red tide", has been recognized as a serious problem in marine environments according to climate changes worldwide. Many novel materials or methods to prevent HAB have not yet been employed except for clay dispersion, in which can the resulting sedimentation on the seafloor can also cause alteration in marine ecology or secondary environmental pollution. In the current study, we investigated that antimicrobial peptide have a potential in controlling HAB without cytotoxicity to harmless marine organisms. Here, antimicrobial peptides are proposed as new algicidal compounds in combating HAB cells. HPA3 and HPA3NT3 peptides which exert potent antimicrobial activity via pore forming action in plasma membrane showed that HPA3NT3 reduced the motility of algal cells, disrupted their plasma membrane, and induced the efflux of intracellular components. Against raphidoflagellate such as Heterosigma akashiwo, Chattonella sp., and C. marina, it displayed a rapid lysing action in cell membranes at 1~4 µM within 2 min. Comparatively, its lysing effects occurred at 8 µM within 1 h in dinoflagellate such as Cochlodium polykrikoides, Prorocentrum micans, and P. minimum. Moreover, its lysing action induced the lysis of chloroplasts and loss of chlorophyll a. In the contrary, this peptide was not effective against Skeletonema costatum, harmless algal cell, even at 256 µM, moreover, it killed only H. akashiwo or C. marina in co-cultivation with S. costatum, indicating to its selective algicidal activity between harmful and harmless algal cells. The peptide was non-hemolytic against red blood cells of Sebastes schlegeli, the black rockfish, at 120 µM. HAB cells were quickly and selectively lysed following treatment of antimicrobial peptides without cytotoxicity to harmless marine organisms. Thus, the antibiotic peptides examined in our study appear to have much potential in effectively controlling HAB with minimal

  20. Potential Fish Production Impacts from Partial Removal of Decommissioned Oil and Gas Platforms off the Coast of California

    Science.gov (United States)

    Claisse, J.; Pondella, D.; Love, M.; Zahn, L.; Williams, C.; Bull, A. S.

    2016-02-01

    When oil and gas platforms become obsolete they go through a decommissioning process. This may include partial removal (from the surface to 26 m depth) or complete removal of the platform structure. While complete removal would likely eliminate most of the existing fish biomass and associated secondary production, we find that the potential impacts of partial removal would likely be limited on all but one platform off the coast of California. On average 80% of fish biomass and 86% of secondary fish production would be retained after partial removal, with above 90% retention expected for both metrics on many platforms. Partial removal would likely result in the loss of fish biomass and production for species typically found residing in the shallow portions of the platform structure. However, these fishes generally represent a small proportion of the fishes associated with these platforms. More characteristic of platform fauna are the primarily deeper-dwelling rockfishes (genus Sebastes). "Shell mounds" are biogenic reefs that surround some of these platforms resulting from an accumulation of mollusk shells that have fallen from the shallow areas of the platforms mostly above the depth of partial removal. We found that shell mounds are moderately productive fish habitats, similar to or greater than natural rocky reefs in the region at comparable depths. The complexity and areal extent of these biogenic habitats, and the associated fish biomass and production, will likely be reduced after either partial or complete platform removal. Habitat augmentation by placing the partially removed platform superstructure or some other additional habitat enrichment material (e.g., rock boulders) on the seafloor adjacent to the base of partially removed platforms provides additional options to enhance fish production, potentially mitigating reductions in shell mound habitat.

  1. Impacts from Partial Removal of Decommissioned Oil and Gas Platforms on Fish Biomass and Production on the Remaining Platform Structure and Surrounding Shell Mounds.

    Science.gov (United States)

    Claisse, Jeremy T; Pondella, Daniel J; Love, Milton; Zahn, Laurel A; Williams, Chelsea M; Bull, Ann S

    2015-01-01

    When oil and gas platforms become obsolete they go through a decommissioning process. This may include partial removal (from the surface to 26 m depth) or complete removal of the platform structure. While complete removal would likely eliminate most of the existing fish biomass and associated secondary production, we find that the potential impacts of partial removal would likely be limited on all but one platform off the coast of California. On average 80% of fish biomass and 86% of secondary fish production would be retained after partial removal, with above 90% retention expected for both metrics on many platforms. Partial removal would likely result in the loss of fish biomass and production for species typically found residing in the shallow portions of the platform structure. However, these fishes generally represent a small proportion of the fishes associated with these platforms. More characteristic of platform fauna are the primarily deeper-dwelling rockfishes (genus Sebastes). "Shell mounds" are biogenic reefs that surround some of these platforms resulting from an accumulation of mollusk shells that have fallen from the shallow areas of the platforms mostly above the depth of partial removal. We found that shell mounds are moderately productive fish habitats, similar to or greater than natural rocky reefs in the region at comparable depths. The complexity and areal extent of these biogenic habitats, and the associated fish biomass and production, will likely be reduced after either partial or complete platform removal. Habitat augmentation by placing the partially removed platform superstructure or some other additional habitat enrichment material (e.g., rock boulders) on the seafloor adjacent to the base of partially removed platforms provides additional options to enhance fish production, potentially mitigating reductions in shell mound habitat.

  2. Impacts from Partial Removal of Decommissioned Oil and Gas Platforms on Fish Biomass and Production on the Remaining Platform Structure and Surrounding Shell Mounds.

    Directory of Open Access Journals (Sweden)

    Jeremy T Claisse

    Full Text Available When oil and gas platforms become obsolete they go through a decommissioning process. This may include partial removal (from the surface to 26 m depth or complete removal of the platform structure. While complete removal would likely eliminate most of the existing fish biomass and associated secondary production, we find that the potential impacts of partial removal would likely be limited on all but one platform off the coast of California. On average 80% of fish biomass and 86% of secondary fish production would be retained after partial removal, with above 90% retention expected for both metrics on many platforms. Partial removal would likely result in the loss of fish biomass and production for species typically found residing in the shallow portions of the platform structure. However, these fishes generally represent a small proportion of the fishes associated with these platforms. More characteristic of platform fauna are the primarily deeper-dwelling rockfishes (genus Sebastes. "Shell mounds" are biogenic reefs that surround some of these platforms resulting from an accumulation of mollusk shells that have fallen from the shallow areas of the platforms mostly above the depth of partial removal. We found that shell mounds are moderately productive fish habitats, similar to or greater than natural rocky reefs in the region at comparable depths. The complexity and areal extent of these biogenic habitats, and the associated fish biomass and production, will likely be reduced after either partial or complete platform removal. Habitat augmentation by placing the partially removed platform superstructure or some other additional habitat enrichment material (e.g., rock boulders on the seafloor adjacent to the base of partially removed platforms provides additional options to enhance fish production, potentially mitigating reductions in shell mound habitat.

  3. Pacific Canada's Rockfish Conservation Areas: using Ostrom's design principles to assess management effectiveness

    Directory of Open Access Journals (Sweden)

    Darienne Lancaster

    2015-09-01

    Full Text Available International declines in marine biodiversity have lead to the creation of marine protected areas and fishery reserve systems. In Canada, 164 Rockfish Conservation Areas (RCAs were implemented between 2003 and 2007 and now cover 4847.2 km² of ocean. These reserves were created in response to widespread concern from fishers and nongovernmental organizations about inshore rockfish (genus Sebastes population declines. We used the design principles for effective common-pool resource management systems, originally developed by Elinor Ostrom, to assess the social and ecological effectiveness of these conservation areas more than 10 years after their initial implementation. We assessed the relative presence or absence of each design principle within current RCA management. We found that 2 of the 11 design principles were moderately present in the recreational fishery. All other design principles were lacking for the recreational sector. We found that 2 design principles were fully present and 5 were moderately present in the commercial sector. Four design principles were lacking in the commercial sector. Based on this analysis, we highlight 4 main areas for management improvement: (1 create an education and outreach campaign to explain RCA rules, regulations, boundaries, and the need for marine conservation; (2 increase monitoring of users and resources to discourage noncompliance and gather the necessary data to create social buy-in for marine conservation; (3 encourage informal nested governance through stakeholder organizations for education and self-regulation (e.g. fisher to fisher; and (4 most importantly, create a formal, decadal RCA review process to gather stakeholder input and make amendments to regulations and RCA boundaries. This information can be used to inform spatial management systems both in Canada and internationally. This analysis also contributes to a growing literature on effectively scaling up small-scale management techniques

  4. Fish communities associated with cold-water corals vary with depth and substratum type

    Science.gov (United States)

    Milligan, Rosanna J.; Spence, Gemma; Roberts, J. Murray; Bailey, David M.

    2016-08-01

    Understanding the processes that drive the distribution patterns of organisms and the scales over which these processes operate are vital when considering the effective management of species with high commercial or conservation value. In the deep sea, the importance of scleractinian cold-water corals (CWCs) to fish has been the focus of several studies but their role remains unclear. We propose this may be due to the confounding effects of multiple drivers operating over multiple spatial scales. The aims of this study were to investigate the role of CWCs in shaping fish community structure and individual species-habitat associations across four spatial scales in the NE Atlantic ranging from "regions" (separated by >500 km) to "substratum types" (contiguous). Demersal fish and substratum types were quantified from three regions: Logachev Mounds, Rockall Bank and Hebrides Terrace Seamount (HTS). PERMANOVA analyses showed significant differences in community composition between all regions which were most likely caused by differences in depths. Within regions, significant variation in community composition was recorded at scales of c. 20-3500 m. CWCs supported significantly different fish communities to non-CWC substrata at Rockall Bank, Logachev and the HTS. Single-species analyses using generalised linear mixed models showed that Sebastes sp. was strongly associated with CWCs at Rockall Bank and that Neocyttus helgae was more likely to occur in CWCs at the HTS. Depth had a significant effect on several other fish species. The results of this study suggest that the importance of CWCs to fish is species-specific and depends on the broader spatial context in which the substratum is found. The precautionary approach would be to assume that CWCs are important for associated fish, but must acknowledge that CWCs in different depths will not provide redundancy or replication within spatially-managed conservation networks.

  5. Larval fish feeding ecology, growth and mortality from two basins with contrasting environmental conditions of an inner sea of northern Patagonia, Chile.

    Science.gov (United States)

    Landaeta, Mauricio F; Bustos, Claudia A; Contreras, Jorge E; Salas-Berríos, Franco; Palacios-Fuentes, Pámela; Alvarado-Niño, Mónica; Letelier, Jaime; Balbontín, Fernando

    2015-05-01

    During austral spring 2011, a survey was carried out in the inland sea (41°30'-44°S) of north Patagonia, South Pacific, studying a northern basin (NB: Reloncaví Fjord, Reloncaví Sound and Ancud Gulf) characterized by estuarine regime with stronger vertical stratification and warmer (11-14 °C) and most productive waters, and a southern basin (SB: Corcovado Gulf and Guafo mouth), with more oceanic water influence, showed mixed conditions of the water column, colder (11-10.5 °C) and less productive waters. Otolith microstructure and gut content analysis of larval lightfish Maurolicus parvipinnis and rockfish Sebastes oculatus were studied. Larval M. parvipinnis showed similar growth rates in both regions (0.13-0.15 mm d(-1)), but in NB larvae were larger-at-age than in SB. Larval S. oculatus showed no differences in size-at-age and larval growth (0.16 and 0.11 mm d(-1) for NB and SB, respectively). M. parvipinnis larvae from NB had larger number of prey items (mostly invertebrate eggs), similar total volume in their guts and smaller prey size than larvae collected in SB (mainly calanoid copepods). Larval S. oculatus had similar number, volume and body width of prey ingested at both basins, although prey ingestion rate by size was 5 times larger in NB than in SB, and prey composition varied from nauplii in NB to copepodites in SB. This study provides evidence that physical-biological interactions during larval stages of marine fishes from Chilean Patagonia are species-specific, and that in some cases large size-at-age correspond to increasing foraging success. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. Comparison of concentrations and profiles of polycyclic aromatic hydrocarbon metabolites in bile of fishes from offshore oil platforms and natural reefs along the California coast

    Science.gov (United States)

    Gale, Robert W.; Tanner, Michael J.; Love, Milton S.; Nishimoto, Mary M.; Schroeder, Donna M.

    2012-01-01

    To determine the environmental consequences of decommissioning offshore oil platforms on local and regional fish populations, contaminant loads in reproducing adults were investigated at seven platform sites and adjacent, natural sites. Specimens of three species (Pacific sanddab, Citharichthys sordidus; kelp rockfish, Sebastes atrovirens; and kelp bass, Paralabrax clathratus) residing at platforms and representing the regional background within the Santa Barbara Channel and within the San Pedro Basin were collected. Some of the most important contaminant classes related to oil operations are polycyclic aromatic hydrocarbons (PAHs) because of their potential toxicity and carcinogenicity. However, acute exposure cannot be related directly to PAH tissue concentrations because of rapid metabolism of the parent chemicals in fish; therefore, PAH metabolites in bile were measured, targeting free hydroxylated PAHs (OH-PAHs) liberated by enzymatic hydrolysis of the bound PAH glucuronides and sulfates. An ion-pairing method was developed for confirmatory analysis that targeted PAH glucuronides and sulfates. Concentrations of hydroxylated PAHs in all samples (76 fish from platforms and 64 fish from natural sites) were low, ranging from less than the limits of detection (5 to 120 nanograms per milliliter bile; 0.03 to 42 nanograms per milligram protein) to a maximum of 320 nanograms per milliliter bile (32 nanograms per milligram protein). A previously proposed dosimeter of PAH exposure in fish, 1-hydroxypyrene, was not detected at any platform site. Low concentrations of 1-hydroxypyrene were detected in 3 of 12 kelp rockfish collected from a natural reef site off Santa Barbara. The most prevalent OH-PAH, 2-hydroxyfluorene, was detected at low concentrations in seven fish of various species; of these, four were from two of the seven platform sites. The greatest concentrations of 2-hydroxyfluorene were found in three fish of various species from Platform Holly and were only

  7. Interspecific variation in life history relates to antipredator decisions by marine mesopredators on temperate reefs.

    Directory of Open Access Journals (Sweden)

    Alejandro Frid

    Full Text Available As upper-level predatory fishes become overfished, mesopredators rise to become the new 'top' predators of over-exploited marine communities. To gain insight into ensuing mechanisms that might alter indirect species interactions, we examined how behavioural responses to an upper-level predatory fish might differ between mesopredator species with different life histories. In rocky reefs of the northeast Pacific Ocean, adult lingcod (Ophiodon elongatus are upper-level predators that use a sit-and-wait hunting mode. Reef mesopredators that are prey to adult lingcod include kelp greenling (Hexagrammos decagrammus, younger lingcod, copper rockfish (Sebastes caurinus and quillback rockfish (S. maliger. Across these mesopredators species, longevity and age at maturity increases and, consequently, the annual proportion of lifetime reproductive output decreases in the order just listed. Therefore, we hypothesized that the level of risk taken to acquire resources would vary interspecifically in that same order. During field experiments we manipulated predation risk with a model adult lingcod and used fixed video cameras to quantify interactions between mesopredators and tethered prey (Pandalus shrimps. We predicted that the probabilities of inspecting and attacking tethered prey would rank from highest to lowest and the timing of these behaviours would rank from earliest to latest as follows: kelp greenling, lingcod, copper rockfish, and quillback rockfish. We also predicted that responses to the model lingcod, such as avoidance of interactions with tethered prey, would rank from weakest to strongest in the same order. Results were consistent with our predictions suggesting that, despite occupying similar trophic levels, longer-lived mesopredators with late maturity have stronger antipredator responses and therefore experience lower foraging rates in the presence of predators than mesopredators with faster life histories. The corollary is that the fishery

  8. Dioxins and dioxin-like PCBs in fish in general and in particular from Baltic Sea

    Energy Technology Data Exchange (ETDEWEB)

    Karl, H. [Federal Research Centre for Nutrition and Food, Hamburg (Germany); Ruoff, U. [Federal Research Centre For Nutrition and Food, Kiel (Germany)

    2004-09-15

    Commission Regulation No 466/2001 establishes maximum levels for dioxins in foodstuffs, foreseeing to review the maximum levels by 31 December 2006 and to include dioxin-like PCBs in the levels to be set. Fish is known to accumulate dioxins and dioxin related compounds in the lipid phase of their tissue. To collect information of the actual contamination levels in fish species on the German market, samples were taken from fishing grounds important for the supply and in particular from the Baltic Sea. Sampling concentrates on fish species with higher fat content like mackerel (Scomber scombrus), salmon (Salmo salar), trout (Oncorhynchus mykiss), red fish (Sebastes sp.) and herring (Clupea harengus), because lean fish species are known to be less contaminated. Herring is the most important fat fish species for the German fish processing industry with a market share of 19% in 2001. The annual demand is approximately 149.000 t. Herring and other fish species accumulate PCDD/Fs with increasing age and dioxin levels in the edible part of eastern Baltic herring exceeds the maximum limit of 4 ng WHOPCDD/ F-TEQ/kg wet weight (w.w.) at ages of 4 - 6 years, corresponding to sizes of approximately 17 - 18 cm and a weight of 40 g, respectively. Hence Isosaari recommended to use preferably young fish from this area for human consumption. However, the German herring industry is based on the processing of large herring with a minimum weight of > 85g up to 250g. Therefore our interest focused on herring sizes of potential interest for the German processing industry. Samples were collected in September 1999 within two weeks covering an area from the Skagerrak to the Coast of Latvia. Additionally the contamination levels in sprat (Sprattus sprattus), flounder, brown trout (Salmo trutta) and in spring spawning herring from commercial landings around the area of Ruegen have been analysed.

  9. Interspecific variation in life history relates to antipredator decisions by marine mesopredators on temperate reefs.

    Science.gov (United States)

    Frid, Alejandro; Marliave, Jeff; Heithaus, Michael R

    2012-01-01

    As upper-level predatory fishes become overfished, mesopredators rise to become the new 'top' predators of over-exploited marine communities. To gain insight into ensuing mechanisms that might alter indirect species interactions, we examined how behavioural responses to an upper-level predatory fish might differ between mesopredator species with different life histories. In rocky reefs of the northeast Pacific Ocean, adult lingcod (Ophiodon elongatus) are upper-level predators that use a sit-and-wait hunting mode. Reef mesopredators that are prey to adult lingcod include kelp greenling (Hexagrammos decagrammus), younger lingcod, copper rockfish (Sebastes caurinus) and quillback rockfish (S. maliger). Across these mesopredators species, longevity and age at maturity increases and, consequently, the annual proportion of lifetime reproductive output decreases in the order just listed. Therefore, we hypothesized that the level of risk taken to acquire resources would vary interspecifically in that same order. During field experiments we manipulated predation risk with a model adult lingcod and used fixed video cameras to quantify interactions between mesopredators and tethered prey (Pandalus shrimps). We predicted that the probabilities of inspecting and attacking tethered prey would rank from highest to lowest and the timing of these behaviours would rank from earliest to latest as follows: kelp greenling, lingcod, copper rockfish, and quillback rockfish. We also predicted that responses to the model lingcod, such as avoidance of interactions with tethered prey, would rank from weakest to strongest in the same order. Results were consistent with our predictions suggesting that, despite occupying similar trophic levels, longer-lived mesopredators with late maturity have stronger antipredator responses and therefore experience lower foraging rates in the presence of predators than mesopredators with faster life histories. The corollary is that the fishery removal of top

  10. Surface distribution of brachyuran megalopae and ichthyoplankton in the Columbia River plume during transition from downwelling to upwelling conditions

    Science.gov (United States)

    Roegner, G. Curtis; Daly, Elizabeth A.; Brodeur, Richard D.

    2013-06-01

    In the California Current coastal boundary zone, the spring transition between downwelling and upwelling conditions, along with the fluctuating structure of the Columbia River plume, creates highly dynamic interactions. In this study, we investigated whether the surface distribution of brachyuran larvae and ichthyoplankton would track the dynamics of the Columbia River plume. By happenstance, the cruise period coincided with the spring transition from downwelling to sustained upwelling conditions in 2010, a year when the transition was delayed and Columbia River flow was substantially higher than average. We used time series of wind and freshwater input to evaluate the influence of physical forcing on oceanographic patterns, and sampled hydrography and surface plankton concentrations within a 182 km2 grid off Willapa Bay, WA. Additionally, two longer transects, one cross-shelf and the other along-shore, were made to discern the extent of plume influence on larval crab and fish abundance. We found that plume waters that were trapped in a northward-flowing coastal-boundary current during downwelling conditions were advected offshore after several days of upwelling-favorable winds. Neustonic collections of brachyuran larvae and ichthyoplankton varied in response to this large seaward advective event. Megalopae of cancrid crabs exhibited patterns of both offshore transport (Cancer oregonensis/productus) and nearshore retention (C. magister). Additionally, abundant numbers of large juvenile widow (Sebastes entomelas) and yellowtail (S. flavidus) rockfish of a size appropriate for settlement were sampled during a period when ocean conditions favored high recruitment success. These results demonstrated that the response of planktonic crab larvae and ichthyoplankton to large-scale advection varied by species, with larger and more vagile fish exhibiting less evidence of passive transport than smaller crab larvae. Importantly, portions of the planktonic fish and crab

  11. Trophic interactions of the pelagic ecosystem over the Reykjanes Ridge as evaluated by fatty acid and stable isotope analyses

    Science.gov (United States)

    Petursdottir, H.; Gislason, A.; Falk-Petersen, S.; Hop, H.; Svavarsson, J.

    2008-01-01

    Trophic relationships of the important oceanic crustacean species Calanus finmarchicus, Meganyctiphanes norvegica and Sergestes arcticus, as well as the mesopelagic fishes Maurolicus muelleri, Benthosema glaciale and Sebastes mentella, were investigated over the Reykjanes Ridge in June 2003 and in June 2004. Measurements were performed of length, wet weight, dry weight, total lipid, lipid class, fatty acid and fatty alcohol profiles and stable isotopes (δ 13C and δ 15N). High amounts of the Calanus lipid markers, 20:1(n-9) and 22:1(n-11) in these species confirm the importance of Calanus spp. in this ecosystem. Comparisons of fatty acid/alcohol profiles by multivariate analysis revealed two main trophic pathways over the Reykjanes Ridge. In one pathway, Calanus spp. was an important part of the diet for the small mesopelagic fish species M. muelleri and B. glaciale and the shrimp S. arcticus, whereas in the other pathway, the euphausiid M. norvegica was the dominant food for the redfish S. mentella, and Calanus spp. were of less importance. M. muelleri and the smaller B. glaciale feed on C. finmarchicus, whereas the larger B. glaciale and S. arcticus select the larger, deeper-living C. hyperboreus. All investigated species are true pelagic species except for the shrimp S. arcticus, which seems to have a benthic feeding habit as well. The δ 15N levels show that of the species investigated, C. finmarchicus occupies the lowest trophic level (2.0) and the redfish, S. mentella, the highest (4.2). All the species were lipid rich, typical for subarctic pelagic ecosystem. Calanus finmarchicus, S. arcticus and B. glaciale store wax esters as their lipid stores, while M. norvegica, M. muelleri and S. mentella store triacylglycerols.

  12. Environmental conditions and prey-switching by a seabird predator impact juvenile salmon survival

    Science.gov (United States)

    Wells, Brian K.; Santora, Jarrod A.; Henderson, Mark J.; Warzybok, Pete; Jahncke, Jaime; Bradley, Russell W.; Huff, David D.; Schroeder, Isaac D.; Nelson, Peter; Field, John C.; Ainley, David G.

    2017-10-01

    Due to spatio-temporal variability of lower trophic-level productivity along the California Current Ecosystem (CCE), predators must be capable of switching prey or foraging areas in response to changes in environmental conditions and available forage. The Gulf of the Farallones in central California represents a biodiversity hotspot and contains the largest common murre (Uria aalge) colonies along the CCE. During spring, one of the West Coast's most important Chinook salmon (Oncorhynchus tshawytscha) populations out-migrates into the Gulf of the Farallones. We quantify the effect of predation on juvenile Chinook salmon associated with ecosystem-level variability by integrating long-term time series of environmental conditions (upwelling, river discharge), forage species abundance within central CCE, and population size, at-sea distribution, and diet of the common murre. Our results demonstrate common murres typically forage in the vicinity of their offshore breeding sites, but in years in which their primary prey, pelagic young-of-year rockfish (Sebastes spp.), are less available they forage for adult northern anchovies (Engraulis mordax) nearshore. Incidentally, while foraging inshore, common murre consumption of out-migrating juvenile Chinook salmon, which are collocated with northern anchovy, increases and population survival of the salmon is significantly reduced. Results support earlier findings that show timing and strength of upwelling, and the resultant forage fish assemblage, is related to Chinook salmon recruitment variability in the CCE, but we extend those results by demonstrating the significance of top-down impacts associated with these bottom-up dynamics. Our results demonstrate the complexity of ecosystem interactions and impacts between higher trophic-level predators and their prey, complexities necessary to quantify in order to parameterize ecosystem models and evaluate likely outcomes of ecosystem management options.

  13. Species-Specific Responses of Juvenile Rockfish to Elevated pCO2: From Behavior to Genomics.

    Directory of Open Access Journals (Sweden)

    Scott L Hamilton

    Full Text Available In the California Current ecosystem, global climate change is predicted to trigger large-scale changes in ocean chemistry within this century. Ocean acidification-which occurs when increased levels of atmospheric CO2 dissolve into the ocean-is one of the biggest potential threats to marine life. In a coastal upwelling system, we compared the effects of chronic exposure to low pH (elevated pCO2 at four treatment levels (i.e., pCO2 = ambient [500], moderate [750], high [1900], and extreme [2800 μatm] on behavior, physiology, and patterns of gene expression in white muscle tissue of juvenile rockfish (genus Sebastes, integrating responses from the transcriptome to the whole organism level. Experiments were conducted simultaneously on two closely related species that both inhabit kelp forests, yet differ in early life history traits, to compare high-CO2 tolerance among species. Our findings indicate that these congeners express different sensitivities to elevated CO2 levels. Copper rockfish (S. caurinus exhibited changes in behavioral lateralization, reduced critical swimming speed, depressed aerobic scope, changes in metabolic enzyme activity, and increases in the expression of transcription factors and regulatory genes at high pCO2 exposure. Blue rockfish (S. mystinus, in contrast, showed no significant changes in behavior, swimming physiology, or aerobic capacity, but did exhibit significant changes in the expression of muscle structural genes as a function of pCO2, indicating acclimatization potential. The capacity of long-lived, late to mature, commercially important fish to acclimatize and adapt to changing ocean chemistry over the next 50-100 years is likely dependent on species-specific physiological tolerances.

  14. Characterization of Atlantic cod spawning habitat and behavior in Icelandic coastal waters.

    Directory of Open Access Journals (Sweden)

    Timothy B Grabowski

    Full Text Available The physical habitat used during spawning may potentially be an important factor affecting reproductive output of broadcast spawning marine fishes, particularly for species with complex, substrate-oriented mating systems and behaviors, such as Atlantic cod Gadus morhua. We characterized the habitat use and behavior of spawning Atlantic cod at two locations off the coast of southwestern Iceland during a 2-d research cruise (15-16 April 2009. We simultaneously operated two different active hydroacoustic gear types, a split beam echosounder and a dual frequency imaging sonar (DIDSON, as well as a remotely operated underwater vehicle (ROV. A total of five fish species were identified through ROV surveys: including cusk Brosme brosme, Atlantic cod, haddock Melanogrammus aeglefinus, lemon sole Microstomus kitt, and Atlantic redfish Sebastes spp. Of the three habitats identified in the acoustic surveys, the transitional habitat between boulder/lava field and sand habitats was characterized by greater fish density and acoustic target strength compared to that of sand or boulder/lava field habitats independently. Atlantic cod were observed behaving in a manner consistent with published descriptions of spawning. Individuals were observed ascending 1-5 m into the water column from the bottom at an average vertical swimming speed of 0.20-0.25 m s(-1 and maintained an average spacing of 1.0-1.4 m between individuals. Our results suggest that cod do not choose spawning locations indiscriminately despite the fact that it is a broadcast spawning fish with planktonic eggs that are released well above the seafloor.

  15. Comparison of fishes taken by a sportfishing party vessel around oil platforms and adjacent natural reefs near Santa Barbara, California

    International Nuclear Information System (INIS)

    Love, M.S.; Westphal, W.

    1990-01-01

    Since 1958, 29 oil platforms have been sited in the southern California Bight of which 28 still remain in place. However, little is known of the fish populations surrounding these structures, particularly those sited in water deeper than 30 m. In the course of research on the Santa Barbara, California, party vessel sport fishery, it was noted that the platforms off Santa Barbara supported considerable sportfishing activity. Those platforms, located to the southeast of Santa Barbara in depths of 48-62 m, were particularly important and were fished intensively for various rockfishes (genus Sebastes). When fishing a platform, the vessel pulled up to within 5-10 m of a platform and drifts along one side, with the vessel operator using intermittent power to keep it near the structure. Most of the desirable species, particularly rockfishes, remained close to the platforms, rarely venturing more than perhaps 20 m from the structure. The party vessels also spent considerable time fishing over nearby natural reefs. In this survey, it was noted that there appeared to be differences in species catch composition and fish size between oil platforms and these natural reefs. Increased offshore oil drilling off California has raised interest in the role platforms play in marine systems. Questions have been raised regarding what fish live around platforms, how these structures influence populations over surrounding reefs, and whether the platforms act as fish enhancers (promoting recruitment) or only as aggregators. These questions are particularly relevant when the platforms are to be decommissioned and the possibility of allowing them to remain as artificial reefs is raised. This paper describes the results of the study on the fish populations around oil platforms and nearby natural reefs off Santa Barbara

  16. Early life history pelagic exposure profiles of selected commercially important fish species in the Gulf of Alaska

    Science.gov (United States)

    Doyle, Miriam J.; Mier, Kathryn L.

    2016-10-01

    A synthesis of nearly four decades of ichthyoplankton survey data from the Gulf of Alaska was undertaken to provide the most comprehensive information available on the early life history ecology of five focal species: Pacific Cod (Gadus macrocephalus), Walleye Pollock (Gadus chalcogrammus), Pacific Ocean Perch (Sebastes alutus), Sablefish (Anoplopoma fimbria), and Arrowtooth Flounder (Atheresthes stomias). This analysis of historical data, along with information from published studies, is presented here in the form of ecological reviews of the species during their planktonic phase. The reviews include descriptions of temporal and spatial patterns of exposure to the environment, and interpretation regarding associated sensitivities to environmental forcing. On a temporal scale, patterns in abundance of eggs and larvae are synthesized that characterize seasonal exposure to the pelagic environment, and interannual variation that is presumed to incorporate responses to long-term environmental forcing. Spatial patterns are synthesized to identify horizontal and vertical extent of egg and larval distributions, delineate areas of primary larval habitat, and illuminate egg and larval drift pathways. The observed patterns are discussed with respect to characterizing species early life history strategies, identifying long-term adaptations to the Gulf of Alaska environment, and associated resilience and vulnerability factors that may modulate early life responses to environmental forcing in this region. For each species, gaps in knowledge are identified and are concerned primarily with the period of transition between the larval and juvenile stage, and feeding habits and ecology across seasons, habitats and sub-intervals of early ontogeny. These early life history reviews advance our ecological understanding of the pelagic phase, and fine-tune our focus for the investigation of potential response mechanisms to environmental forcing at appropriate, species-specific temporal

  17. Variability in abundance of temperate reef fishes estimated by visual census.

    Directory of Open Access Journals (Sweden)

    Alejo J Irigoyen

    Full Text Available Identifying sources of sampling variation and quantifying their magnitude is critical to the interpretation of ecological field data. Yet, most monitoring programs of reef fish populations based on underwater visual censuses (UVC consider only a few of the factors that may influence fish counts, such as the diver or census methodology. Recent studies, however, have drawn attention to a broader range of processes that introduce variability at different temporal scales. This study analyzes the magnitude of different sources of variation in UVCs of temperate reef fishes off Patagonia (Argentina. The variability associated with time-of-day, tidal state, and time elapsed between censuses (minutes, days, weeks and months was quantified for censuses conducted on the five most conspicuous and common species: Pinguipes brasilianus, Pseudopercis semifasciata, Sebastes oculatus, Acanthistius patachonicus and Nemadactylus bergi. Variance components corresponding to spatial heterogeneity and to the different temporal scales were estimated using nested random models. The levels of variability estimated for the different species were related to their life history attributes and behavior. Neither time-of-day nor tidal state had a significant effect on counts, except for the influence of tide on P. brasilianus. Spatial heterogeneity was the dominant source of variance in all but one species. Among the temporal scales, the intra-annual variation was the highest component for most species due to marked seasonal fluctuations in abundance, followed by the weekly and the instantaneous variation; the daily component was not significant. The variability between censuses conducted at different tidal levels and time-of-day was similar in magnitude to the instantaneous variation, reinforcing the conclusion that stochastic variation at very short time scales is non-negligible and should be taken into account in the design of monitoring programs and experiments. The present

  18. Recovery of Coastal Fauna after the 2011 Tsunami in Japan as Determined by Bimonthly Underwater Visual Censuses Conducted over Five Years.

    Directory of Open Access Journals (Sweden)

    Reiji Masuda

    Full Text Available Massive tsunamis induce catastrophic disturbance in marine ecosystems, yet they can provide unique opportunities to observe the process of regeneration. Here, we report the recovery of fauna after the 2011 tsunami in northeast Japan based on underwater visual censuses performed every two months over five years. Both total fish abundance and species richness increased from the first to the second year after the tsunami followed by stabilization in the following years. Short-lived fish, such as the banded goby Pterogobius elapoides, were relatively abundant in the first two years, whereas long-lived species, such as the black rockfish Sebastes cheni, increased in the latter half of the survey period. Tropical fish species were recorded only in the second and third years after the tsunami. The body size of long-lived fish increased during the survey period resulting in a gradual increase of total fish biomass. The recovery of fish assemblages was slow at one site located in the inner bay, where the impact of the tsunami was the strongest. Apart from fish, blooms of the moon jellyfish Aurelia sp. occurred only in the first two years after the tsunami, whereas the abundances of sea cucumber Apostichopus japonicus and abalone Haliotis discus hannai increased after the second year. Although we lack quantitative data prior to the tsunami, we conclude that it takes approximately three years for coastal reef fish assemblages to recover from a heavy disturbance such as a tsunami and that the recovery is dependent on species-specific life span and habitat.

  19. From sea water to marine organisms; transfer to marine organisms

    International Nuclear Information System (INIS)

    Koyanagi, Taku

    1979-01-01

    As a study on transfer of radioiodine to marine organisms, accumulation and excretion of radioiodine by five species of marine fishes were observed by the aquarium experiments using Na 131 I as the tracer. Transfer of radioiodine to the fishes was examined on three different pathways, via seawater, sediment, and food. Concentration of radioiodine in organs of tissues of sea bass, Lateolabrax japonics, yellow tail, Seriola quinqueradiata, and rock fish, Sebastes nivosus, reared in labeled seawater reached maximum within five to ten days and decreased thereafter. Concentration factors calculated at the fifth day of breeding showed the highest value in gall-bladder followed by gut-content suggesting the secretion of bile into the intestine. Loss of radioactivity from the fishes showed two components elimination patterns and biological half-lives were calculated as 2.8 days and 53.5 days, respectively, in muscle of sea bass, for example. Sediment-bound radioiodine administered to benthic fish, right-eye flounder, Kareius bicoloratus, was lost rapidly after the administration but about ten per cent of the whole-body radioactivity were retained by the fishes after the excretion of sediment and eliminated with longer half-lives comparable to those taken up from seawater. Distribution of radioiodine among organs or tissues of the flounder was different between the fishes before and after the elimination experiment showing rapid loss from gill and slower elimination from liver or muscle. Radioiodine administered to sea bream, Pagrus major, as labeled anchovy was climinated also with two components loss processes and elimination rates were little higher than the fishes administered radioiodine as solution in gelatine capsules. Higher distribution of radioiodine in gill of the sea bream suggested the dominant excretion of radioiodine through gill of the fishes. (author)

  20. Characterization of Atlantic cod spawning habitat and behavior in Icelandic coastal waters

    Science.gov (United States)

    Grabowski, Timothy B.; Boswell, Kevin M.; McAdam, Bruce J.; Wells, R. J. David; Marteinsdóttir, Gudrún

    2012-01-01

    The physical habitat used during spawning may potentially be an important factor affecting reproductive output of broadcast spawning marine fishes, particularly for species with complex, substrate-oriented mating systems and behaviors, such as Atlantic cod Gadus morhua. We characterized the habitat use and behavior of spawning Atlantic cod at two locations off the coast of southwestern Iceland during a 2-d research cruise (15–16 April 2009). We simultaneously operated two different active hydroacoustic gear types, a split beam echosounder and a dual frequency imaging sonar (DIDSON), as well as a remotely operated underwater vehicle (ROV). A total of five fish species were identified through ROV surveys: including cusk Brosme brosme, Atlantic cod, haddock Melanogrammus aeglefinus, lemon sole Microstomus kitt, and Atlantic redfish Sebastes spp. Of the three habitats identified in the acoustic surveys, the transitional habitat between boulder/lava field and sand habitats was characterized by greater fish density and acoustic target strength compared to that of sand or boulder/lava field habitats independently. Atlantic cod were observed behaving in a manner consistent with published descriptions of spawning. Individuals were observed ascending 1–5 m into the water column from the bottom at an average vertical swimming speed of 0.20–0.25 m s−1 and maintained an average spacing of 1.0–1.4 m between individuals. Our results suggest that cod do not choose spawning locations indiscriminately despite the fact that it is a broadcast spawning fish with planktonic eggs that are released well above the seafloor.

  1. The parasite assemblage in the spiral intestine of the shark Mustelus canis.

    Science.gov (United States)

    Cislo, P R; Caira, J N

    1993-12-01

    no evidence that the 4 species do not occur independently among host individuals. The number of species and number of individuals in M. canis were low when compared to the marine fish Sebastes nebulosus. These values for M. canis more closely resemble values for freshwater fishes. The comparatively much greater host specificity of these tapeworms may at least partially account for this difference. We propose that site specificity may have a phylogenetic component, in a manner similar to that of host specificity.

  2. A biomonitoring plan for assessing potential radionuclide exposure using Amchitka Island in the Aleutian chain of Alaska as a case study

    Energy Technology Data Exchange (ETDEWEB)

    Burger, Joanna [Division of Life Sciences, Rutgers University, 604 Allison Road, Nelson Hall, Piscataway, NJ 08854-8082 (United States); Consortium for Risk Evaluation with Stakeholder Participation (CRESP), Nashville, TN, and Piscataway, NJ (United States); Environmental and Occupational Health Sciences Institute (EOHSI), Piscataway, NJ (United States)], E-mail: burger@biology.rutgers.edu; Gochfeld, Michael [Consortium for Risk Evaluation with Stakeholder Participation (CRESP), Nashville, TN, and Piscataway, NJ (United States); Environmental and Occupational Health Sciences Institute (EOHSI), Piscataway, NJ (United States); Environmental and Occupational Medicine, UMDNJ - Robert Wood Johnson Medical School, Piscataway, NJ (United States); Kosson, D.S. [Consortium for Risk Evaluation with Stakeholder Participation (CRESP), Nashville, TN, and Piscataway, NJ (United States); Department of Civil and Environmental Engineering, Vanderbilt University, Nashville, TN (United States); Powers, Charles W. [Consortium for Risk Evaluation with Stakeholder Participation (CRESP), Nashville, TN, and Piscataway, NJ (United States); Environmental and Occupational Health Sciences Institute (EOHSI), Piscataway, NJ (United States); Environmental and Occupational Medicine, UMDNJ - Robert Wood Johnson Medical School, Piscataway, NJ (United States); Department of Civil and Environmental Engineering, Vanderbilt University, Nashville, TN (United States)

    2007-12-15

    mussel (Mytilus trossulus), dolly varden (Salvelinus malma), black rockfish (Sebastes melanops), Pacific cod (Gadus macrocephalus), Pacific halibut (Hippoglossus stenolepis), and glaucous-winged gull (Larus glaucescens) as bioindicators. This combination of species included mainly subsistence foods, commercial fish, and nodes on different food chains.

  3. Franz Josef Land: extreme northern outpost for Arctic fishes

    Directory of Open Access Journals (Sweden)

    Natalia V. Chernova

    2014-12-01

    Full Text Available The remote Franz Josef Land (FJL Archipelago is the most northerly land in Eurasia and its fish fauna, particularly in nearshore habitats, has been poorly studied. An interdisciplinary expedition to FJL in summer 2013 used scuba, seines, and plankton nets to comprehensively study the nearshore fish fauna of the archipelago. We present some of the first underwater images for many of these species in their natural habitats. In addition, deep water drop cameras were deployed between 32 and 392 m to document the fish fauna and their associated habitats at deeper depths. Due to its high latitude (79°–82°N, extensive ice cover, and low water temperatures (<0 °C much of the year, the fish diversity at FJL is low compared to other areas of the Barents Sea. Sixteen species of fishes from seven families were documented on the expedition, including two species previously unknown to the region. One Greenland shark, Somniosus microcephalus (Somniosidae, ca. 2 m in length, was recorded by drop camera near Hayes Island at 211 m, and Esipov’s pout, Gymnelus esipovi (Zoarcidae, was collected at Wilton Island at 15 m in a kelp forest. Including the tape-body pout, Gymnelus taeniatus, described earlier from the sub-littoral zone of Kuhn Island, 17 fish species are now known from FJL’s nearshore waters. Species endemic to the Arctic accounted for 75% of the nearshore species observed, followed by species with wider ranges. A total of 43 species from 15 families are known from FJL with the majority of the records from offshore trawl surveys between 110 and 620 m. Resident species have mainly high Arctic distributions, while transient species visit the archipelago to feed (e.g., Greenland shark, and others are brought by currents as larvae and later migrate to spawn grounds in the south (e.g., Atlantic cod Gadus morhua, Capelin Mallotus villosus, Beaked redfish Sebastes mentella. Another species group includes warmer-water fishes that are rare waifs (e

  4. Ichthyoplankton spatial distribution and its relation with water column stratification in fjords of southern Chile (46°48‧-50°09‧S) in austral spring 1996 and 2008

    Science.gov (United States)

    Bustos, Claudia A.; Landaeta, Mauricio F.; Balbontín, Fernando

    2011-03-01

    The occidental shore of the southern tip of South America is one of the largest estuarine ecosystems around the world. Although demersal finfish fisheries are currently in full exploitation in the area, the fjords south of 47°S have been poorly investigated. Two bio-oceanographic cruises carried out in austral spring 1996 and 2008 between 47°S and 50°09'S were utilized to investigate the spatial distribution of fish eggs and larvae. Small differences in the environmental conditions were identified in the top 200 m of the water column between years (5.3-10.5 °C and 0.7-33.9 units of salinity in October 1996; 6.3-11.5 °C and 1.2-34.2 units of salinity in November 2008). The low salinity surface layer generated a highly stable water column within the fjords (Brunt-Väisälä frequency, N>0.1 rad/s; wave period ichthyoplankton analysis showed that early life stages of lightfish Maurolicus parvipinnis were dominant (>75% total eggs and >70% total larvae) and they were collected throughout the area, irrespective of the water column stratification. However, other components of the ichthyoplankton such as Falkland sprat Sprattus fuegensis, rockfish Sebastes oculatus, and hoki Macruronus magellanicus were more abundant and found in a wider range of larval sizes in less stable waters ( N<0.1 rad/s). Oceanic taxa such as myctophids ( Lampanyctodes hectoris) and gonostomatids ( Cyclothone sp.) were collected exclusively in open waters. The October 1996 observation of Engraulis ringens eggs in plankton samples corresponded to the southernmost record of early stages of this fish in the Pacific Ocean. We found a significant negative relationship between the number of larval species and N, and a significant positive relationship between the number of larval species and wave period. Therefore, only some marine fish species are capable to utilize fjords systems as spawning and nursery grounds in areas having high amounts of freshwater discharges and very high vertical

  5. The Optimum Feeding Frequency in Growing Korean Rockfish ( Rearing at the Temperature of 15°C and 19°C

    Directory of Open Access Journals (Sweden)

    Rahman Md Mizanur

    2014-09-01

    Full Text Available Two feeding trials were conducted to determine the optimum feeding frequency in growing Korean rockfish, (Sebastes schlegeli reared at the temperatures of 15°C and 19°C. Fish averaging 92.2±0.7 g (mean±standard deviation [SD] at 15.0±0.5°C and 100.2±0.4 g (mean±SD at 19.0±0.5°C water temperature were randomly distributed into each of 15 indoor tanks containing 250-L sea water from a semi-recirculation system. A total of five feeding frequency groups were set up in three replicates as follows: one meal in a day at 08:00 hour, two meals a day at 08:00 and 17:00 hours, three meals a day at 08:00, 14:00, and 20:00 hours, four meals a day at 08:00, 12:00, 16:00, and 20:00 hours, and one meal every 2 days at 08:00 hour. Fish were fed at the rate of 1.2% body weight (BW/d at 15°C and 1.5% BW/d at 19°C. At the end of 8 wks of feeding trial weight gain and specific growth rate were significantly higher at the fish fed groups of one meal a day and two meals a day at 15°C and fish fed groups of 1 meal every 2 days at 19°C were significantly lower than those of all other fish fed groups. Glutamic oxaloacetic transaminase and glutamic pyruvic transaminase of fish fed group at 1 meal every 2 days was significantly higher than those of all other fish fed groups in both experiments. Weight gain, specific growth rate and condition factor were gradually decreased as the feeding frequency increased. The results indicate that growing Korean rockfish 92 and 100 g perform better at 15°C than 19°C water temperature. As we expected, current results have indicated that a feeding frequency of 1 meal a day is optimal for the improvement of weight gain in growing Korean rockfish grown from 92 g to 133 g at 15°C and 100 g to 132 g at 19°C water temperature.

  6. Quantifying Physiological, Behavioral and Ecological Consequences of Hypoxic Events in Kelp Forest

    Science.gov (United States)

    Litvin, S. Y.; Beers, J. M.; Woodson, C. B.; Leary, P.; Fringer, O. B.; Goldbogen, J. A.; Micheli, F.; Monismith, S. G.; Somero, G. N.

    2016-02-01

    Rocky reef kelp forests that extend along the coast of central California, like many habitats in upwelling systems, often experience inundations of low dissolved oxygen (DO) or hypoxic waters. These events have the potential to influence the structure and function of coastal ecosystems. The ecological consequences of hypoxia for these systems will be mediated by physiological thresholds and behavioral responses of resident organisms in the context of the spatial and temporal variability of DO, and other potential stressors. Our research focuses on Sebastes (i.e. rockfish) because of their commercial, recreational and ecological importance, high abundance across near shore habitats and the potentially severe impacts of physiological stress due to hypoxia. In the lab, to investigate how hypoxic events physiologically effect rockfish, we exposed young of the year (YOY) of 5 species and two life stages of blue rockfish, S. mystinus (YOY and 1+), to DO concentrations representative of upwelling conditions and measured a suite of whole organisms and tissue level responses including metabolic rate, ventilation, tissue-level metabolism, and blood biochemistry. Results demonstrate species and life stage specific differences in physiological stress under upwelling driven hypoxic conditions and suggest YOY rockfishes may currently be living near their physiological limits. In the laboratory we further explored if physiological impacts result in behavioral consequences by examining the startle response of YOY rockfish, a relative measure of predator avoidance ability, under a range of DO concentrations and exposure durations. To further explore behavioral responses of rockfish to low in DO within the kelp forest we are using two approaches, monitoring the vertical distribution of fish communities across the water column using an acoustic imaging camera (ARIS 3000, Soundmetrics Inc.) and acoustic tagging, with 3-D positioning ability (VPS, VEMCO Inc.), of larger blue rockfish

  7. Evaluating the Potential for Marine and Hydrokinetic Devices to Act as Artificial Reefs or Fish Aggregating Devices. Based on Analysis of Surrogates in Tropical, Subtropical, and Temperate U.S. West Coast and Hawaiian Coastal Waters

    Energy Technology Data Exchange (ETDEWEB)

    Kramer, Sharon H. [H. T. Harvey & Associates, Honolulu, HI (United States); Hamilton, Christine D. [H. T. Harvey & Associates, Honolulu, HI (United States); Spencer, Gregory C. [H. T. Harvey & Associates, Honolulu, HI (United States); Ogston, Heather O. [H. T. Harvey & Associates, Honolulu, HI (United States)

    2015-05-12

    Wave energy converters (WECs) and tidal energy converters (TECs) are only beginning to be deployed along the U.S. West Coast and in Hawai‘i, and a better understanding of their ecological effects on fish, particularly on special-status fish (e.g., threatened and endangered) is needed to facilitate project design and environmental permitting. The structures of WECs and TECs placed on to the seabed, such as anchors and foundations, may function as artificial reefs that attract reef-associated fishes, while the midwater and surface structures, such as mooring lines, buoys, and wave or tidal power devices, may function as fish aggregating devices (FADs), forming the nuclei for groups of fishes. Little is known about the potential for WECs and TECs to function as artificial reefs and FADs in coastal waters of the U.S. West Coast and Hawai‘i. We evaluated these potential ecological interactions by reviewing relevant information about fish associations with surrogate structures, such as artificial reefs, natural reefs, kelps, floating debris, oil and gas platforms, marine debris, anchored FADs deployed to enhance fishing opportunities, net-cages used for mariculture, and piers and docks. Based on our review, we postulate that the structures of WECs and TECs placed on or near the seabed in coastal waters of the U.S. West Coast and Hawai‘i likely will function as small-scale artificial reefs and attract potentially high densities of reef-associated fishes (including special-status rockfish species [Sebastes spp.] along the mainland), and that the midwater and surface structures of WECs placed in the tropical waters of Hawai‘i likely will function as de facto FADs with species assemblages varying by distance from shore and deployment depth. Along the U.S. West Coast, frequent associations with midwater and surface structures may be less likely: juvenile, semipelagic, kelp-associated rockfishes may occur at midwater and surface structures of WECs in coastal waters of