WorldWideScience

Sample records for sara zimbardo philip

  1. Philips Pavilion

    NARCIS (Netherlands)

    Konig dos Santos, M.M.

    2012-01-01

    The Philips company street name meant Light and Sound and they wished to show what Man can do. Therefore for the Expo'58 in Brussels they contracted Le Corbusier to create a pavilion that would transmit their message as well as show what Philips is. After all, the main aim of the 1958 exhibition was

  2. Philip Kurian

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Philip Kurian. Articles written in Bulletin of Materials Science. Volume 24 Issue 6 December 2001 pp 623-631 Magnetic Materials. Tailoring magnetic and dielectric properties of rubber ferrite composites containing mixed ferrites · M R Anantharaman K A Malini S Sindhu E M ...

  3. News developments at Sara

    International Nuclear Information System (INIS)

    Belmont, J.L.; Fruneau, M.; Martin, P.

    1989-05-01

    SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration

  4. Philip Glass tuleb Eestisse

    Index Scriptorium Estoniae

    2002-01-01

    26. nov. Tallinnas Sakala keskuses toimuvast muusikafestivali NYYD ja Pimedate Ööde filmifestivali ühisprojektist, mis kujutab endast Godfrey Reggio ja Philip Glassi kultusfilmi "Koyaanisqatsi" kontsert-linastust

  5. Loovkirjutamist õpetab Philip Gross

    Index Scriptorium Estoniae

    2011-01-01

    T.S. Elioti luulepreemia laureaat Philip Gross on Tallinna Ülikooli talvekooli rahvusvahelise kursuse "Poetry: A Conversation between Words and Silence" läbiviija. Oma seminarides keskendub ta lisaks loovkirjutamisele ka loova lugemise vajadusele

  6. Testing the Zimbardo Time Perspective Inventory in the Chinese context.

    Science.gov (United States)

    Wang, Ya; Chen, Xing-Jie; Cui, Ji-Fang; Liu, Lu-Lu

    2015-09-01

    In this study, the authors evaluated the Chinese version of the Zimbardo Time Perspective Inventory (ZTPI). The ZTPI was tested among a sample of 303 university students. A subsample of 51 participants was then asked to complete the ZTPI again along with another set of questionnaires. The five-factor model of a 20-item short version of the ZTPI showed good model fit, internal consistency, and test-retest reliability. The 20-item Chinese version of the ZTPI also provided good validity, showing correlations with other variables in expected directions. Past-Positive was positively correlated with reappraisal and negatively correlated with suppression emotion regulation strategies, and Present-Hedonistic was positively correlated with reappraisal emotion regulation strategies. These findings indicate that the ZTPI is a reliable and valid instrument for measuring time perspective in the Chinese setting. © 2015 The Institute of Psychology, Chinese Academy of Sciences and Wiley Publishing Asia Pty Ltd.

  7. The predictability of Philips

    International Nuclear Information System (INIS)

    Roggen, M.

    2001-01-01

    Philips will be centralizing electric power purchasing for its European branches. The purchasing department needs to have up-to-date and comparable figures on energy consumption within each branch to be able to secure the most profitable contracts. With Energy ICT's real-time multisite on energy registration they are bound to succeed

  8. 2012 SARA Students Technical Report

    International Nuclear Information System (INIS)

    Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet

    2012-01-01

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of

  9. 2012 SARA Students Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

    2012-07-30

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the

  10. The SARA REU Site Program

    Science.gov (United States)

    Wood, M. A.; Oswalt, T. D.; SARA Collaboration

    2000-12-01

    We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.

  11. Sara

    International Nuclear Information System (INIS)

    Aparo, M.; Dionisi, M.; Vicini, C.; Zeppa, P.; Frazzoli, F.V.; Remetti, R.; Portale, C.

    1989-01-01

    Nuclear Material Accountability, supported by Containment and Surveillance measures, is a foundamental means for an effective International Safeguard implemention in nuclear plants. Accountability is based on the verification that difference between a material quantity entering a given material balance and the quantity leaving that area in a given period of time, correspond and the amount of material actually present at the moment of the inspection. In the recent years International Safeguards appealing to the needs of timeliness in detecting diversion and concealing activities, devoted ReD efforts on a new Dynamic Accountability procedures (NRTMA) with particular concern with reprocessing plants. The present paper, which is the result of a research activity carried out in the frame of the Italian Support Programme to IAEA for Safeguards implementation, deals with a feasibility study of a NRTMA system to be applied to the EUREX pilot reprocessing plant. Such a feasibility study was performed by developing a computer program based on simulated plant generated data

  12. Exploring Time Perspective in Greek Young Adults: Validation of the Zimbardo Time Perspective Inventory and Relationships with Mental Health Indicators

    Science.gov (United States)

    Anagnostopoulos, Fotios; Griva, Fay

    2012-01-01

    In this article we examine the factorial structure of the Greek version of the Zimbardo Time Perspective Inventory (ZTPI; Zimbardo and Boyd in "J Personal Soc Psychol" 77:1271-1288, 1999), in a sample of 337 university students, using principal axis factoring (PAF) with oblique rotation, and its dimensionality using parallel analysis.…

  13. From Milgram to Zimbardo: the double birth of postwar psychology/psychologization.

    Science.gov (United States)

    De Vos, Jan

    2010-01-01

    Milgram's series of obedience experiments and Zimbardo's Stanford Prison Experiment are probably the two best-known psychological studies. As such, they can be understood as central to the broad process of psychologization in the postwar era. This article will consider the extent to which this process of psychologization can be understood as a simple overflow from the discipline of psychology to wider society or whether, in fact, this process is actually inextricably connected to the science of psychology as such. In so doing, the article will argue that Milgram's and Zimbardo's studies are best usefully understood as twin experiments. Milgram's paradigm of a psychology which explicitly draws its subject into the frame of its own discourse can be said to be the precondition of Zimbardo's claim that his experiment offers a window onto the crucible of human behaviour. This will be analysed by drawing on the Lacanian concepts of acting out and passage à l'acte. The question then posed is: if both Milgram and Zimbardo claim that their work has emancipatory dimensions - a claim maintained within mainstream psychology - does a close reading of the studies not then reveal that psychology is, rather, the royal road to occurrences such as Guantanamo and Abu Ghraib? The drama of a psychology which is fundamentally based on a process of psychologization is that it turns its subjects into homo sacer of psychological discourse.

  14. The Reliability and Validity of Zimbardo Time Perspective Inventory Scores in Academically Talented Adolescents

    Science.gov (United States)

    Worrell, Frank C.; Mello, Zena R.

    2007-01-01

    In this study, the authors examined the reliability, structural validity, and concurrent validity of Zimbardo Time Perspective Inventory (ZTPI) scores in a group of 815 academically talented adolescents. Reliability estimates of the purported factors' scores were in the low to moderate range. Exploratory factor analysis supported a five-factor…

  15. Severe Accident Recriticality Analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  16. Severe accident recriticality analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H

    2001-11-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated

  17. Severe accident recriticality analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.

    2001-01-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady

  18. Severe Accident Recriticality Analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  19. Interpreting the SARA and RCRA training requirements

    International Nuclear Information System (INIS)

    Moreland, W.M.; Wells, S.M.

    1987-01-01

    The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements

  20. A Fan Solution for the Philips Airfryer

    OpenAIRE

    Gibernau Torres, Octavi

    2012-01-01

    The thesis on hand has been carried out at Philips Consumer Lifestyle Drachten that, together with Delft University of Technology, aims to develop a computed tool that determines the performance and efficiency curve of any centrifugal fan operating in the Philips Airfryer. The Airfryer is a Philips kitchen appliance that, thanks to the use of Rapid Air Technology, enables to fry food with a reduction of unhealthy fat up to 80%. Philips aims at reducing the total cost of the cooking fan an...

  1. Philips LTC 2009/51

    CERN Multimedia

    1999-01-01

    It was part of a range of high-performance monitors (computers screens) that were associated with other units such as Philip's video surveillance systems, cameras or transmission and control equipment. Included in this range of Philips monitors are LTC 2009 (like this one), LTC 2012, LTC 2017 and LTC 2020 Series monochrome monitors. They offer high-performance images with a resolution of 900 TVL (TV-Lines), or in the case of the LTC 2017 monitor, 700 TVL, making them ideal for remote viewing and video applications. The monitor housing consists of a robust rectangular metal case which minimizes interference from external signals and allows “stacking” of monitors when used in large numbers.

  2. Contesting the "Nature" Of Conformity: what Milgram and Zimbardo's studies really show.

    Directory of Open Access Journals (Sweden)

    S Alexander Haslam

    Full Text Available Understanding of the psychology of tyranny is dominated by classic studies from the 1960s and 1970s: Milgram's research on obedience to authority and Zimbardo's Stanford Prison Experiment. Supporting popular notions of the banality of evil, this research has been taken to show that people conform passively and unthinkingly to both the instructions and the roles that authorities provide, however malevolent these may be. Recently, though, this consensus has been challenged by empirical work informed by social identity theorizing. This suggests that individuals' willingness to follow authorities is conditional on identification with the authority in question and an associated belief that the authority is right.

  3. System Analysis and Risk Assessment (SARA) system

    International Nuclear Information System (INIS)

    Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

    1986-01-01

    Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable

  4. A Global Look at Time: A 24-Country Study of the Equivalence of the Zimbardo Time Perspective Inventory

    Czech Academy of Sciences Publication Activity Database

    Sircova, A.; van de Vijver, F.J.R.; Osin, E.; Milfont, T.L.; Fieulaine, N.; Kislali-Erginbilgic, A.; Zimbardo, P.G.; Djarallah, S.; Chorfi, M.S.; do Rego Leite, U.; Lin, H.; Lv, H.; Bunjevac, T.; Tomaš, T.; Punek, J.; Vrlec, A.; Matić, J.; Bokulić, M.; Klicperová-Baker, Martina; Košťál, J.; Seema, R.; Baltin, A.; Apostolidis, T.; Pediaditakis, D.; Griva, F.; Anagnostopoulos, F.; Carmi, C.; Goroshit, M.; Peri, M.; Shimojima, Y.; Sato, K.; Ochi, K.; Kairys, A.; Liniauskaite, A.; Corral-Verdugo, V.; Przepiorka, A.; Blachnio, A.; Ortuño, V.E.C.; Gamboa, V.; Mitina, O.; Semyenova, N.; Gerasimova, V.; Rawski (Nepryakho), T.; Kuleshova, E.; Polskaya, N.; Tulinov, N.; Romanko, I.; Semina, Y.; Nikitina, E.; Yasnaya, V.; Davydova, I.; Utyasheva, E.; Emeliyanova, I.; Ershova, R.; Nedeljkovic, J.; Díaz Morales, J.F.; Carelli, M.G.; Wiberg, B.; Boniwell, I.; Linley, P.A.; Boyd, J.N.

    2014-01-01

    Roč. 4, January-March (2014), s. 1-12 ISSN 2158-2440 Institutional support: RVO:68081740 Keywords : Zimbardo Time Perspective Inventory * time perspective * equivalence * cross - cultural research Subject RIV: AN - Psychology http://sgo.sagepub.com/content/4/1/2158244013515686

  5. Psychometric properties of the Hebrew short version of the Zimbardo Time Perspective Inventory.

    Science.gov (United States)

    Orkibi, Hod

    2015-06-01

    The purpose of this study was to develop a short Hebrew version of the Zimbardo Time Perspective Inventory that can be easily administered by health professionals in research, therapy, and counseling. First, the empirical links of time perspective (TP) to subjective well-being and health protective and health risk behaviors are reviewed. Then, a brief account of the instrument's previous modifications is provided. Results of confirmatory factor analysis (N = 572) verified the five-factor structure of the short version and yielded acceptable internal consistency reliability for each factor. The correlation coefficients between the five subscales of the short (20 items) and the original (56 items) instruments were all above .79, indicating the suitability of the short version for assessing the five TP factors. Support for the discriminant and concurrent validity was also achieved, largely in agreement with previous findings. Finally, limitations and future directions are addressed, and potential applications in therapy and counseling are offered. © The Author(s) 2014.

  6. Metrology at Philip Morris Europe

    Directory of Open Access Journals (Sweden)

    Gualandris R

    2014-12-01

    Full Text Available The importance of the metrology function at Philip Morris Europe (PME, a multinational organisation producing at over 40 sites in the European, Middle Eastern and African Regions is presented. Standardisation of test methods and equipment as well as the traceability of calibration gauges to the same reference gauge are essential in order to obtain comparable results among the various production centers. The metrology function as well as the qualification of instruments and the drafting of test and calibration operating procedures for this region are conducted or co-ordinated by the Research and Development Department in Neuchatel, Switzerland. In this paper the metrology function within PME is presented based on the measurement of the resistance to draw for which the PME R&D laboratory is accredited (ISO/CEI 17025, as both a calibration and a testing laboratory. The following topics are addressed in this paper: traceability of calibration standards to national standards; comparison of results among manufacturing centres; the choice, the budget as well as the computation of uncertainties. Furthermore, some practical aspects related to the calibration and use of the glass multicapillary gauges are discussed.

  7. Altria means tobacco: Philip Morris's identity crisis.

    Science.gov (United States)

    Smith, Elizabeth A; Malone, Ruth E

    2003-04-01

    Philip Morris Companies, the world's largest and most profitable tobacco seller, has changed its corporate name to The Altria Group. The company has also embarked on a plan to improve its corporate image. Examination of internal company documents reveals that these changes have been planned for over a decade and that the company expects to reap specific and substantial rewards from them. Tobacco control advocates should be alert to the threat Philip Morris's plans pose to industry focused tobacco control campaigns. Company documents also suggest what the vulnerabilities of those plans are and how advocates might best exploit them.

  8. The relationship between SARA fractions and crude oil stability

    Directory of Open Access Journals (Sweden)

    Siavash Ashoori

    2017-03-01

    Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.

  9. Layering of life (Sara novel of Peter Sarić

    Directory of Open Access Journals (Sweden)

    Kostić Dragomir J.

    2015-01-01

    Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safe­guard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.

  10. "Clockwork": Philip Pullman's Posthuman Fairy Tale

    Science.gov (United States)

    Gooding, Richard

    2011-01-01

    This article examines the connections between posthumanism and narrative form in Philip Pullman's "Clockwork." Beginning with an account of Pullman's materialism, it argues that the novel represents consciousness and agency as emergent properties of matter, a position that manifests itself first in the tale's figurative language and later in the…

  11. A. Philip Randolph: Integration in the Workplace.

    Science.gov (United States)

    Wright, Sarah

    This biography for younger readers describes the life of A. Philip Randolph, the civil rights activist who organized the labor union for Pullman car porters, the Brotherhood of Sleeping Car Porters. The book presents an overview of the civil rights movement in the United States while documenting the part Randolph played as advocate for African…

  12. Philip Glass : "Koyaanisqatsi" muutub üha aktuaalsemaks / Philip Glass ; interv. Romi Erlach

    Index Scriptorium Estoniae

    Glass, Philip, 1937-

    2003-01-01

    Philip Glass ja tema ansambel esitavad 2. detsembril PÖFFil oma filmimuusika Godfrey Reggio filmile "Koyaanisqatsi" selle linastusel Tallinna linnahallis. Helilooja räägib oma muusikast, ka Arvo Pärdist

  13. Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.

    Science.gov (United States)

    O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J

    2008-04-01

    Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.

  14. Gene : CBRC-SARA-01-1996 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

  15. SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS

    International Nuclear Information System (INIS)

    Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.

    2015-01-01

    SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index

  16. Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

    Directory of Open Access Journals (Sweden)

    M. Sidi Ritau'din

    2017-06-01

    Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.

  17. PHILIP GlASS: SCREEN MUSIC

    Directory of Open Access Journals (Sweden)

    Neretina Maina S.

    2012-12-01

    Full Text Available Research is devoted to the music of contemporary composer Philip Glass, which he wrote specifically for the movies including feature and documentary films by American, British and Australian directors (M.Scorsese, E.Morris, S.Daldry, P.Weir etc.. It makes a connection of the composition technologies between his filmmusic and his artmusic written in the aesthetics of minimalism (the repetition and additive processes. The works in collaboration with director G.Reggio highlights as top Glass’ creative at the film industry. It also covers the principles of compilation the composer’s music for a variety of screen opuses, movies and commercials.

  18. Layering of life (Sara novel of Peter Sarić)

    OpenAIRE

    Kostić, Dragomir J.

    2015-01-01

    Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...

  19. A simple blowdown code for SUPER-SARA loop conditions

    International Nuclear Information System (INIS)

    Fritz, G.

    1981-01-01

    The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section

  20. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...

  1. Sara, a patient with borderline personality structure: A "crisis" management

    Directory of Open Access Journals (Sweden)

    Paola Marinelli

    2015-05-01

    Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma. 

  2. Philip Morris changes its name, but not its harmful practices.

    Science.gov (United States)

    Myers, M L

    2002-09-01

    After spending more than $250 million on an advertising campaign to improve its name and reputation, Philip Morris has abruptly shifted course and decided instead to change its corporate name-to The Altria Group, Inc.

  3. Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

    Directory of Open Access Journals (Sweden)

    Jessica N Snowden

    Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.

  4. System Analysis and Risk Assessment system (SARA) Version 4.0

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1992-01-01

    This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis

  5. The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...

  6. Calculations for the design and modification of the 2 cyclotrons of S.A.R.A

    International Nuclear Information System (INIS)

    Albrand, P.S.; Belmont, J.L.; Ripouteau, F.

    1983-09-01

    S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron

  7. Social humanoid robot SARA: development of the wrist mechanism

    Science.gov (United States)

    Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.

    2018-01-01

    This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.

  8. Obituary: Philip Morrison, 1915-2005

    Science.gov (United States)

    Trimble, Virginia

    2005-12-01

    Philip Morrison, who died 22 April 2005 in Cambridge, Massachusetts, was born in Somerville, New Jersey on 7 November 1915 to Moses and Tilly (née Rosenbloom) Morrison. Early childhood polio confined him for extended periods, during which he apparently developed his remarkable skill at speed reading. Speed writing (leading to a bibliography of more than 600 items) came later, and his memory must always have been exceedingly retentive. Morrison went on from the public and private schools of Pittsburgh, Pennsylvania to receive a BS in physics from Carnegie Institute of Technology (now Carnegie Mellon) in 1936. At the University of California, Berkeley, he joined the Young Communist League and later the Communist Party, letting his membership lapse in the early 1940s when work and war came to seem more important. He was officially the student of J. Robert Oppenheimer and worked also with postdocs Robert Serber and Leonard Schiff and with a number of his fellow Oppenheimer students (a spectacular crew, which included Robert Christy, Sidney Dancoff, Bernard Peters [born Pietrkowski], Hartland Snyder, Joseph Weinberg, Dale Corson, Giovanni Rossi Lomanitz, David Bohm, and Eugene Cooper). Following his 1940 PhD, Phil (his preferred signature) taught for a year at San Francisco State and then at University of Illinois (where he replaced Dancoff, who had gone on to a year at Institute for Advanced Study, Princeton). From Illinois, Morrison was recruited to the Metallurgy Lab (uranium project) at the University of Chicago by Christy in 1942. There he worked on the design for the Hanford Reactor, the main source of plutonium for the Trinity and Nagasaki bombs. He seems to have been sensitive to human relationships even in that context and was the author of a "Dear Opje" letter to Oppenheimer pointing out that the lack of cooperation between management and the scientists was getting in the way of the project. Morrison's early research was largely in theoretical nuclear physics

  9. Electron beam characteristics on a Philips SL25

    International Nuclear Information System (INIS)

    Palta, J.R.; Daftari, I.K.; Ayyangar, K.M.; Suntharalingam, N.

    1990-01-01

    Dosimetry measurements at nominal electron energies of 4, 6, 8, 10, 12, 15, 17, 20, and 22 MeV were made for different sized, open-sided applicators on two Philips SL25 linear accelerators. Measurements include beam flatness, percentage depth dose, surface dose, isodose curves, field size dependence, output at extended distances, virtual source position, and required low melting point alloy thickness for field shaping. These measurements are presented to document the characteristics of electron beams with a new type of applicator design on this series of Philips accelerators

  10. Altria Means Tobacco: Philip Morris’s Identity Crisis

    Science.gov (United States)

    Smith, Elizabeth A.; Malone, Ruth E.

    2003-01-01

    Philip Morris Companies, the world’s largest and most profitable tobacco seller, has changed its corporate name to The Altria Group. The company has also embarked on a plan to improve its corporate image. Examination of internal company documents reveals that these changes have been planned for over a decade and that the company expects to reap specific and substantial rewards from them. Tobacco control advocates should be alert to the threat Philip Morris’s plans pose to industryfocused tobacco control campaigns. Company documents also suggest what the vulnerabilities of those plans are and how advocates might best exploit them. PMID:12660196

  11. Obituary: Philip M. Solomon, 1939-2008

    Science.gov (United States)

    Scoville, Nick

    2009-01-01

    Philip Solomon, one of the pioneers and leading researchers in molecular astrophysics, died on 30 April 2008 at his apartment on the upper west side of Manhattan after a battle with cancer. His pioneering research included both theoretical and very extensive observational studies of stellar atmospheres, interstellar molecules, high redshift galaxies, and the Earth's stratosphere. Phil was Distinguished Professor at The State University of New York [SUNY], Stony Brook, where he had been since 1974. Phil was born on 29 March 1939 in Manhattan, New York City, to Nat and Betty Solomon. Nat Solomon was a labor organizer and a printer. Phil attended the University of Wisconsin, where he received his BS in 1959 and where he met his future wife Sheila who was studying art. His Ph.D., "On the Role of Light Molecules in Astrophysics," was also from the University of Wisconsin under the guidance of Art Code and Bob Bless. After postdoctoral positions at Princeton and lectureships at Columbia and the University of California, San Diego, Phil spent two years as a Professor at the University of Minnesota. After two years at the Institute for Advanced Study in Princeton, he came to SUNY, Stony Brook, as Professor of Astronomy in the Department of Earth and Space Sciences. In 1988 Phil was selected as a Humboldt Senior Distinguished Scientist, and, in 1999, he was honored with the rank of Distinguished Professor at SUNY. Phil took sabbatical and other leaves at Churchill College and the Institute of Astronomy, Cambridge; the Institute for Advanced Study; l'Ecole Normale Superieure, Paris; Institut d'Astrophysique, Paris; and the Institut de Radioastronomie Millimetrique [IRAM], France. Phil published more than 160 papers and supervised seven Ph.D. students. He served on numerous review, visiting, and advisory panels. Phil's first theoretical research focused on opacity and abundance of light molecules such as H2, CO, and CN in stellar atmospheres, but then shifted quickly to the

  12. Kotler : teiste inimeste arvamust usutakse enam kui meediat / Philip Kotler

    Index Scriptorium Estoniae

    Kotler, Philip

    2007-01-01

    Philip Kotler vastab küsimustele, millised faktorid mõjutasid tänapäevase turunduse kujundamist, millised vahendid on kasulikud tarbijate leidmiseks, meelitamiseks ja hoidmiseks ning milline on tema arvamus selle kohta, et internetti ja sotsiaalseid võrgustikke nähakse kui tuleviku turundusvahendeid

  13. The Philips QL-lamp : modelling and comparison with experiments

    NARCIS (Netherlands)

    Benoij, D.A.; Heuvel, van den J.; Jonkers, J.; Mullen, van der J.J.A.M.

    1996-01-01

    Summary form only given. The Philips QL lightsource is a low pressure inductively coupled RF discharge. The main advantage of this system is the fact that it contains no electrodes so that the lifetime is longer. A characteristic feature is that the induction coil with a ferrite core is located at

  14. Thinking the "unthinkable": why Philip Morris considered quitting.

    Science.gov (United States)

    Smith, E A; Malone, R E

    2003-06-01

    To investigate the genesis and development of tobacco company Philip Morris's recent image enhancement strategies and analyse their significance. Internal Philip Morris documents, made available by the terms of the Master Settlement Agreement between the tobacco companies and the attorneys general of 46 states, and secondary newspaper sources. Searches of the Philip Morris documents website (www.pmdocs.com) beginning with terms such as "image management" and "identity" and expanding as relevant new terms (consultant names, project names, and dates), were identified, using a "snowball" sampling strategy. In the early 1990s, Philip Morris, faced with increasing pressures generated both externally, from the non-smokers' rights and public health communities, and internally, from the conflicts among its varied operating companies, seriously considered leaving the tobacco business. Discussions of this option, which occurred at the highest levels of management, focused on the changing social climate regarding tobacco and smoking that the tobacco control movement had effected. However, this option was rejected in favour of the image enhancement strategy that culminated with the recent "Altria" name change. This analysis suggests that advocacy efforts have the potential to significantly denormalise tobacco as a corporate enterprise.

  15. Barn music at St Donat's castle / Philip Gross

    Index Scriptorium Estoniae

    Gross, Philip, 1952-

    2011-01-01

    Muusikafestivalist "Vale of Glamorgan", mis oli 2010. a. pühendatud Arvo Pärdile. Eesti kammermuusikaansambli Resonabilis kavas oli ka festivali tellimusel valminud uelsi helilooja Gareth Peredur Churchilli "Vocable", mille teksti kirjutas Philip Gross. Festivalikontsertide muljeid leiab Grossi luuletsüklis "Barn music" (avaldatud samas ajakirjanumbris, lk. 42-43)

  16. Philip Atsu Afeadie (2016). Workplace Anguish and Pleasure in ...

    African Journals Online (AJOL)

    Philip Atsu Afeadie's book, Workplace Anguish and Pleasure in Northern Nigeria: Exactions of Colonial ... the author reveals in six chapters the oft-neglected issues involving the power of emotions and sentiments on ... In all, the author, considering the sources at his disposal, does creditably well by drawing attention to.

  17. Mengukur Politisasi Agama dalam Ruang Publik: Komunikasi SARA dalam Perdebatan Rational Choice Theory

    Directory of Open Access Journals (Sweden)

    Mohammad Supriyadi

    2015-12-01

    Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.

  18. Concurrent software system design supported by SARA at the age of one

    Energy Technology Data Exchange (ETDEWEB)

    Campos, I.M.; Estrin, G.

    A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.

  19. ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

    Directory of Open Access Journals (Sweden)

    Sulistyastuti Sutomo

    2015-01-01

    Full Text Available Not only does art   have   self-fullfillment, but  it also has axiological  benefits both socially, culturally, religiously, and economiclally.  So does Sara Douda dance.  Sara Douda aesthetics  is first contained  in its whole dance movements. In addition, it  can also be found in the whole dance equipments.  Moreover,  this dance aesthetics  may  also be contained in the verbal symbols in the speech forms  prior to the dance performance. However,  both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and  religious values in the Loli community about  their honoring their ancestors,  having social harmony, and  highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance.   Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...

  6. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    Science.gov (United States)

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...

  14. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  3. Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural

    Directory of Open Access Journals (Sweden)

    Tiara Kharisma

    2017-12-01

    Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

  7. Characteristics of photon beams from Philips SL25 linear accelerators

    International Nuclear Information System (INIS)

    Palta, J.R.; Ayyangar, K.; Daftari, I.; Suntharalingam, N.

    1990-01-01

    The Philips SL25 accelerator is a multimodality machine offering asymmetric collimator jaws and a new type of beam bending and transport system. It produces photon beams, nominally at 6 and 25 MV, and a scattered electron beam with nine selectable energies between 4 and 22 MeV. Dosimetric characteristics for the 6- and 25-MV photon beams are presented with respect to field flatness, surface and depth dose characteristics, isodose distribution, field size factors for both open and wedged fields, and narrow beam transmission data in different materials

  8. Valores Epistêmicos no Naturalismo Normativo de Philip Kitcher

    Directory of Open Access Journals (Sweden)

    Eduardo Salles O. Barra

    2000-06-01

    Full Text Available This paper aims at analyzing Philip Kitcher's naturalistic epistemology, particularly its normative features, which are viewed as a sort of response to negative assessments made by radical naturalists on the plurality of epistemic values. According to them such values are ineffective for normative ends, e.g. theory choice. Differently from that quite excessive evaluation, Kitcher argues rather for explanatory unity as the most important and universal epistemic value. Even though Kitcher's arguments are sound, there remains some serious gaps as regards his attempts; there are also serious doubts about the desirability of achieving such a value.

  9. Time perspective in hereditary cancer: psychometric properties of a short form of the Zimbardo Time Perspective Inventory in a community and clinical sample.

    Science.gov (United States)

    Wakefield, Claire E; Homewood, Judi; Taylor, Alan; Mahmut, Mehmet; Meiser, Bettina

    2010-10-01

    We aimed to assess the psychometric properties of a 25-item short form of the Zimbardo Time Perspective Inventory in a community sample (N = 276) and in individuals with a strong family history of cancer, considering genetic testing for cancer risk (N = 338). In the community sample, individuals with high past-negative or present-fatalistic scores had higher levels of distress, as measured by depression, anxiety, and aggression. Similarly, in the patient sample, past-negative time perspective was positively correlated with distress, uncertainty, and postdecision regret when making a decision about genetic testing. Past-negative-oriented individuals were also more likely to be undecided about, or against, genetic testing. Hedonism was associated with being less likely to read the educational materials they received at their clinic, and fatalism was associated with having lower knowledge levels about genetic testing. The assessment of time perspective in individuals at increased risk of cancer can provide valuable clinical insights. However, further investigation of the psychometric properties of the short form of this scale is warranted, as it did not meet the currently accepted criteria for psychometric validation studies.

  10. Dialéctica material Donald Judd y Philip Johnson

    Directory of Open Access Journals (Sweden)

    María Teresa Muñoz

    2016-05-01

    Full Text Available Resumen El objetivo de este escrito es examinar cómo se plantea una cierta dialéctica material en el conjunto llamado la Mansana de Chinati, construido por el escultor Donald Judd en la ciudad de Marfa, Texas, a partir del año 1974, comparándolo con las dos viviendas que realiza el arquitecto Philip Johnson en su propiedad de New Canaan, Connecticut, en torno al año 1950. Tanto en New Canaan como en la Mansana de Chinati existe una  oposición, una dialéctica, entre una arquitectura industrial y otra artesana, tanto Philip Johnson como Donald Judd consideran que existe una arquitectura principal, la realizada con materiales y técnicas industriales, y otra subalterna o de servicio, la construida con piezas de arcilla y técnicas artesanales. Esta segunda arquitectura encarnará las cualidades asociadas con la pobreza, la abundancia material y la clausura espacial. Sin  embargo, esta exhibición de pobreza no tiene como fin los propios edificios domésticos construidos artesanalmente, ya sea con adobe o con ladrillo, sino que estará al servicio de esa otra arquitectura, construida con técnicas industriales, a la que se exige renunciar a la comodidad y el confort o cuando menos ocultarlos bajo la forma de una radical austeridad.

  11. Transferring generic SARA/OSHA training to US Department of Energy facilities

    International Nuclear Information System (INIS)

    White, A.; McKinley, T.

    1989-01-01

    The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs

  12. SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

    DEFF Research Database (Denmark)

    Martin, Christer; Heinze, C.; Busch, M.

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...

  16. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    OpenAIRE

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...

  18. Identification of Differentially Expressed Proteins in Liver in Response to Subacute Ruminal Acidosis (SARA Induced by High-concentrate Diet

    Directory of Open Access Journals (Sweden)

    X. Y. Jiang

    2014-08-01

    Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.

  19. SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-05-01

    Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.

  20. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    Science.gov (United States)

    Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

    2017-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.

  1. System Analysis and Risk Assessment System (SARA), Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.

    1992-02-01

    This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs

  2. Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

    2009-07-01

    Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench

  3. Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

    Science.gov (United States)

    Thomas, S. M.; Su, Y. C.; Hummel, P. R.

    2016-12-01

    Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance

  4. Philanthropy, politics and promotion: Philip Morris' "charitable contributions" in Thailand.

    Science.gov (United States)

    MacKenzie, Ross; Collin, Jeff

    2008-08-01

    The efforts of members of the tobacco industry to portray themselves as responsible corporations via ostensible commitment to improved labour practices and public philanthropy have attracted growing criticism. This is particularly true of corporate social responsibility (CSR) schemes undertaken in emerging nations that are designed to rehabilitate the tobacco industry's image among public, government and market opinions in North America and western Europe. In the case of Thailand, sponsorship of arts events and community groups has been one avenue of promoting the industry in a regulatory environment that severely curtails promotion and advertising. The Association of Southeast Asian Nations (ASEAN) Art Award, sponsored by Philip Morris (PM) has provided one such outlet for 10 years. Analysis of PM funding announcements since the end of the ASEAN art programme in Thailand reveals that recent donations to tobacco-related community organisations reinforces the extent to which seemingly generous acts are driven by corporate self-interest rather than social responsibility.

  5. Integrating Philips' extreme UV source in the alpha-tools

    Science.gov (United States)

    Pankert, Joseph; Apetz, Rolf; Bergmann, Klaus; Derra, Guenther; Janssen, Maurice; Jonkers, Jeroen; Klein, Jurgen; Kruecken, Thomas; List, Andreas; Loeken, Michael; Metzmacher, Christof; Neff, Willi; Probst, Sven; Prummer, Ralph; Rosier, Oliver; Seiwert, Stefan; Siemons, Guido; Vaudrevange, Dominik; Wagemann, Dirk; Weber, Achim; Zink, Peter; Zitzen, Oliver

    2005-05-01

    The paper describes recent progress in the development of the Philips's EUV source. Progress has been realized at many frontiers: Integration studies of the source into a scanner have primarily been studied on the Xe source because it has a high degree of maturity. We report on integration with a collector, associated collector lifetime and optical characteristics. Collector lifetime in excess of 1 bln shots could be demonstrated. Next, an active dose control system was developed and tested on the Xe lamp. Resulting dose stability data are less than 0.2% for an exposure window of 100 pulses. The second part of the paper reports on progress in the development of the Philips' Sn source. First, the details of the concept are described. It is based on a Laser triggered vacuum arc, which is an extension with respect to previous designs. The source is furbished with rotating electrodes that are covered with a Sn film that is constantly regenerated. Hence by the very design of the source, it is scalable to very high power levels, and moreover has fundamentally solved the notorious problem of electrode erosion. Power values of 260 W in 2p sr are reported, along with a stable, long life operation of the lamp. The paper also addresses the problem of debris generation and mitigation of the Sn-source. The problem is attacked by a combined strategy of protection of the collector by traditional means (e.g. fields, foiltraps... ), and by designing the gas atmosphere according to the principles of the well known halogen cycles in incandescent lamps. These principles have been studied in the Lighting industry for decades and rely on the excessively high vapor pressures of metal halides. Transferred to the Sn source, it allows pumping away tin residues that would otherwise irreversibly deposit on the collector.

  6. Usability laboratories at Philips : supporting research, development, and design for consumer and professional products

    NARCIS (Netherlands)

    Vries, de G.; Gelderen, van T.; Brigham, F.

    1994-01-01

    This paper describes two of the usability laboratories at Philips, discusses practical issues arising from our experience using the facilities, gives an example of a typical usability evaluation, and briefly outlines our vision for the future of the laboratories. Usability tests at Philips can

  7. Tensions within an industrial research laboratory: the Philips laboratory's x-ray department between the wars

    NARCIS (Netherlands)

    Boersma, F.K.

    2003-01-01

    Tensions arose in the X-ray department of the Philips research laboratory during the interwar period, caused by the interplay among technological development, organizational culture, and individual behavior. This article traces the efforts of Philips researchers to find a balance between their

  8. Development of an ion guide coupled to an on-line isotope separation system on Sara. Identification and study of isospin exotic nuclei at Isolde and Sara

    International Nuclear Information System (INIS)

    Bouldjedri, A.

    1992-06-01

    This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements

  9. Philips Gemini TF64 PET/CT Acceptance Testing

    International Nuclear Information System (INIS)

    González Gonzalez, Joaquín J.; Calderón Marin, Carlos F.; Varela Corona, Consuelo; Machado Tejeda, Adalberto; González Correa, Héctor J.

    2016-01-01

    The Philips Gemini TF64 is the first PET/CT scanner installed in Cuba at the Institute of Oncology and Radiobiology in 2014. It is a third generation fully tridimensional whole body PET scanner with time-of-flight (TOF) technology combined with a 64-slice Brilliance CT scanner. The CT detector module contains 672x64 solid state detector, incorporating GOS scintillators, optical diodes and electronic signal channels arranged in 64 side by side arcs, with 672 detectors in each arc. There are sixteen 0.75 mm individual detector elements around the center and four 1.5 mm elements at each end, resulting in a 24 mm total detection length. The PET detector consists of 28 pixelar modules of a 23x44 array of 4x4x22 mm3 of LYSO crystals arranged in an Anger-logic detector design. The hardware coincidence-timing window for this scanner is set at 4 ns and delayed coincidence window technique is used to estimate the random coincidences in collected data. In this study the performance characteristics of PET/CT scanner were measured as part of the program tests of acceptance for clinical use.Methodology. The performance characteristics of CT scanner were evaluated by manufacturer protocol using Philips system performance phantom. Some additional geometrical tests were performed by the user. The intrinsic measurements of energy resolution as well as timing resolution, which define the TOF performance of PET scanner, were performed following the recommendations of manufacturer using 18 F. Spatial resolution, sensitivity, scatter fraction, counting rate performance, image quality and accuracy were measured according to the NEMA NU-2 2007 procedures. Additionally, to characterize the effect of TOF reconstruction on lesion contrast and noise, the standard NEMA torso phantom was reconstructed with and without TOF capability. The accuracy of PET/CT image registration was tested according to the manufacturer protocol using an image alignment calibration holder with 6 point sources of 22

  10. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  11. Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.

    1995-01-01

    Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...

  13. Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010

    OpenAIRE

    Beaulé, Sophie

    2014-01-01

    With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w

  15. Lepidoptera, Nymphalidae, Heliconiinae, Heliconius sara apseudes (Hübner, 1813: Distribution extension

    Directory of Open Access Journals (Sweden)

    Iserhard, C. A.

    2010-01-01

    Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.

  16. Evaluation of the penumbras of a Philips multileaf collimator

    International Nuclear Information System (INIS)

    Lafay, F.; Malet, C.; Mombard, C.; Ginestet, C.; Blondel, E.; Desfarges, Y.; Dupin, G.

    1995-01-01

    Since January 1995, a Philips SL20 linear accelerator which is connected to a multileaf collimator has been used. Computer-controlled multileaf collimators open up the opportunity to practice conformal radiotherapy. Its aim is to adjust as well as possible the Planning Target Volume (PTV) to the effective treated volume with an homogeneous dose distribution in the PTV, and to protect healthy tissues and delicate organs. This is possible by means of a multileaf collimator by increasing the number of complex fields with different incidences during a same session. Moreover, the Beam's Eye View function of the three-dimensional treatment planning system allows to define the shape of complex fields. For rectangular fields, the penumbra is defined by the distance between the 80% and 20% isodoses relative to the beam axis. In addition, the distances between, respectively, the 95% and 50% isodoses, the 90% and 50% isodoses, the 50% and 20% isodoses relative to the beam axis have been analysed. Different penumbras were evaluated. The result of this work will enable to adjust the reference isodose to the PTV either by integrating this result into dosimetry software, or by taking it into account for drawing the PTV

  17. Evaluation of the penumbras of a Philips multileaf collimator

    Energy Technology Data Exchange (ETDEWEB)

    Lafay, F; Malet, C; Mombard, C; Ginestet, C [Centre de Lutte Contre le Cancer Leon-Berard, 69 - Lyon (France); Blondel, E [Isotec, Saint-Quentin (France); Desfarges, Y; Dupin, G [Philips Medical System, Lyon (France)

    1995-12-01

    Since January 1995, a Philips SL20 linear accelerator which is connected to a multileaf collimator has been used. Computer-controlled multileaf collimators open up the opportunity to practice conformal radiotherapy. Its aim is to adjust as well as possible the Planning Target Volume (PTV) to the effective treated volume with an homogeneous dose distribution in the PTV, and to protect healthy tissues and delicate organs. This is possible by means of a multileaf collimator by increasing the number of complex fields with different incidences during a same session. Moreover, the Beam`s Eye View function of the three-dimensional treatment planning system allows to define the shape of complex fields. For rectangular fields, the penumbra is defined by the distance between the 80% and 20% isodoses relative to the beam axis. In addition, the distances between, respectively, the 95% and 50% isodoses, the 90% and 50% isodoses, the 50% and 20% isodoses relative to the beam axis have been analysed. Different penumbras were evaluated. The result of this work will enable to adjust the reference isodose to the PTV either by integrating this result into dosimetry software, or by taking it into account for drawing the PTV.

  18. "What Is Our Story?" Philip Morris's Changing Corporate Narrative.

    Science.gov (United States)

    McDaniel, Patricia A; Malone, Ruth E

    2015-10-01

    We sought to learn how employees reacted to changes in the corporate narrative of Philip Morris Companies (PMC) in the late 1990s and early 2000s. We analyzed archival internal tobacco industry documents about PMC's creation of a new corporate story. In response to litigation and public opprobrium, PMC replaced its market success-oriented corporate narrative with a new one centered on responsibility. Although management sought to downplay inconsistencies between the old and new narratives, some employees reportedly had difficulty reconciling them, concerned that the responsibility focus might affect company profitability. However, others embraced the new narrative, suggesting radical ideas to prevent youth smoking. These ideas were not adopted. PMC's new narrative was unconvincing to many of its employees, who perceived it either as a threat to the company's continued profits or as incongruous with what they had previously been told. As it had done with the public, PMC misled its employees in explaining a narrative repositioning that would help the company continue business as usual. Moving toward a tobacco endgame will require ongoing discursive and symbolic efforts to disrupt this narrative.

  19. PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

    Directory of Open Access Journals (Sweden)

    Jorge A. Orrego-Ruiz

    2014-06-01

    Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.

  20. The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

    Science.gov (United States)

    Wood, M. A.

    2003-12-01

    The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.

  1. Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.

    Science.gov (United States)

    Zhao, Bryan M; Hoffmann, F Michael

    2006-09-01

    Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.

  2. Sara John: Ethnisierte Arbeit. Eine feministische Perspektive. Marburg: Tectum Wissenschaftsverlag 2009.

    Directory of Open Access Journals (Sweden)

    Grit Grigoleit

    2011-03-01

    Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.

  3. André-Philip Lemke näitus Tallinnas / Mari Laaniste

    Index Scriptorium Estoniae

    Laaniste, Mari, 1977-

    1998-01-01

    Saksa kunstniku André-Philip Lemke (1970) näitus "Üks-üks armsa Jumala kasuks" 17. augustist Saksa Kultuuriinstituudis. Tööd on valgele paberile tavalise sinise pastapliiatsiga kirjutatud-joonistatud

  4. PENGARUH KEPUASAN KONSUMEN TERHADAP KEPUTUSAN PEMBELIAN LAMPU PHILIPS (STUDI KASUS PADA MAHASISWA TELKOM UNIVERSITY

    Directory of Open Access Journals (Sweden)

    Rahmat Hidayat

    2016-03-01

      Abstrak - Berubahnya pasar menjadi 3.0. ini memacu para produsen untuk tetap melakukan inovasi, agar tetap konsisten ditengah persaingan pasar yang semakin ketat. Produsen Lampu Philips, juga mengalami pergeseran menuju persaingan pasar yang semakin ketat Jenis penelitian ini ialah Deskriptif bersifat kausal, dengan tujuan untuk melihat pengaruh kepuasan konsumen terhadap keputusan pembelian lampu Philips . Subjek penelitian adalah pada mahasiswa Telkom University. Jumlah responden sebesar 100 orang mahasiswa Telkom University. Analisa menggunakan Regresi Sederhana. Hasil penelitian menunjukkan adanya pengaruh kepuasan konsumen terhadap keputusan pembelian lampu Philips pada mahasiswa Telkom University dengan nilai p = .000, koefisien korelasi sebesar 0.791 (R=0.791, dan koefisien determinan (R Square / R2 sebesar 62,6%.   Kata Kunci : Keputusan Pembelian , Kepuasan Konsumen, Lampu Philips

  5. Muusika ilma kuulajata pole palju väärt / Philip Glass ; interv. Immo Mihkelson

    Index Scriptorium Estoniae

    Glass, Philip, 1937-

    2003-01-01

    Philip Glass ja tema ansambel esitavad 2. detsembril PÖFFil oma filmimuusika Godfrey Reggio filmile "Koyaanisqatsi" selle linastusel Tallinna linnahallis. Helilooja räägib oma muusika missioonist, oma lava- ja filmimuusikast

  6. Interview with Dr. Philip Stone, executive director of the Institute for Dark Tourism Research

    OpenAIRE

    BAILLARGEON, Taïka

    2016-01-01

    Dr. Philip Stone is the executive director of the Institute for Dark Tourism Research. Founded in 2012 and based at the University of Central Lancashire (UCLan), England, the iDTR largely contributes to scientific research on Dark Tourism while offering guidance to industry practitioners and collaborating with the media. In 2009, along with his colleague Richard Sharpley, Philip Stone published The Darker Side of Travel: The Theory and Practice of Dark Tourism. This book has become one of the...

  7. From adversary to target market: the ACT-UP boycott of Philip Morris

    OpenAIRE

    Offen, N; Smith, E; Malone, R

    2003-01-01

    BACKGROUND: In 1990, the AIDS Coalition to Unleash Power (ACT-UP) sparked a year long boycott of Philip Morris's Marlboro cigarettes and Miller beer. The boycott protested the company's support of Senator Jesse Helms (R-North Carolina), a leading opponent of AIDS funding and civil rights for lesbian, gay, bisexual and transgender (LGBT) people. ACT-UP demanded that Philip Morris sever its ties with Helms and acknowledge its responsibility to the LGBT community and to people with AIDS. OBJECTI...

  8. A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

    Science.gov (United States)

    Worthen, Helena Harlow

    2012-01-01

    The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…

  9. Hemolytic disease of the fetus and newborn caused by an antibody to a low-prevalence antigen, anti-SARA.

    Science.gov (United States)

    Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy

    2011-09-01

    The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.

  10. Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

    Science.gov (United States)

    Goldrick-Rab, Sara; Kelly, Andrew P.

    2016-01-01

    In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…

  11. Philip Glass muusika kirjutamisest filmile ja teistele kunstiliikidele : "Koyaanisqatsi" lugu / Philip Glass ; interv. Charles Merrell Berg, tõlk. Kaia Sisask

    Index Scriptorium Estoniae

    Glass, Philip, 1937-

    2004-01-01

    Philip Glass ja tema ansambel esitasid 2. detsembril 2003 PÖFFil oma filmimuusika Godfrey Reggio filmile "Koyaanisqatsi" selle linastusel Tallinna linnahallis. Intervjuu on tõlgitud seda sündmust silmas pidades. Järgneb apr. 2004, lk. 74-82

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

  13. NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r

  18. Escribiendo el silencio: la contemplación poética de Sara Pujol

    Directory of Open Access Journals (Sweden)

    Gala, Candelas

    2005-06-01

    Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.

  19. Public versus internal conceptions of addiction: An analysis of internal Philip Morris documents.

    Directory of Open Access Journals (Sweden)

    Jesse Elias

    2018-05-01

    Full Text Available Tobacco addiction is a complex, multicomponent phenomenon stemming from nicotine's pharmacology and the user's biology, psychology, sociology, and environment. After decades of public denial, the tobacco industry now agrees with public health authorities that nicotine is addictive. In 2000, Philip Morris became the first major tobacco company to admit nicotine's addictiveness. Evolving definitions of addiction have historically affected subsequent policymaking. This article examines how Philip Morris internally conceptualized addiction immediately before and after this announcement.We analyzed previously secret, internal Philip Morris documents made available as a result of litigation against the tobacco industry. We compared these documents to public company statements and found that Philip Morris's move from public denial to public affirmation of nicotine's addictiveness coincided with pressure on the industry from poor public approval ratings, the Master Settlement Agreement (MSA, the United States government's filing of the Racketeer Influenced and Corrupt Organizations (RICO suit, and the Institute of Medicine's (IoM's endorsement of potentially reduced risk products. Philip Morris continued to research the causes of addiction through the 2000s in order to create successful potentially reduced exposure products (PREPs. While Philip Morris's public statements reinforce the idea that nicotine's pharmacology principally drives smoking addiction, company scientists framed addiction as the result of interconnected biological, social, psychological, and environmental determinants, with nicotine as but one component. Due to the fragmentary nature of the industry document database, we may have missed relevant information that could have affected our analysis.Philip Morris's research suggests that tobacco industry activity influences addiction treatment outcomes. Beyond nicotine's pharmacology, the industry's continued aggressive advertising

  20. From adversary to target market: the ACT-UP boycott of Philip Morris.

    Science.gov (United States)

    Offen, N; Smith, E A; Malone, R E

    2003-06-01

    In 1990, the AIDS Coalition to Unleash Power (ACT-UP) sparked a year long boycott of Philip Morris's Marlboro cigarettes and Miller beer. The boycott protested the company's support of Senator Jesse Helms (R-North Carolina), a leading opponent of AIDS funding and civil rights for lesbian, gay, bisexual and transgender (LGBT) people. ACT-UP demanded that Philip Morris sever its ties with Helms and acknowledge its responsibility to the LGBT community and to people with AIDS. To assess the impact of the boycott on the LGBT community, the tobacco industry, and the tobacco control movement; and to determine what lessons tobacco control advocates can extract from this case. Internal tobacco industry documents and newspaper archives. Search of tobacco industry documents websites using "boycott", "ACT-UP", "gay", and other terms. Philip Morris used the boycott to its own advantage. It exploited differences within the community and settled the boycott by pledging large donations to combat AIDS. Through corporate philanthropy, Philip Morris gained entrée to the LGBT market without appearing gay friendly. Many LGBT organisations, thirsty for recognition and funding from mainstream corporations, welcomed Philip Morris's overtures without considering the health hazards of tobacco. Unless the goal of a boycott is to convince the tobacco industry to abandon tobacco altogether, such actions invite the industry to expand its marketing under the guise of philanthropy. Tobacco control advocates should be clear about goals and acceptable settlement terms before participating in a boycott of a tobacco company.

  1. Stress Testing of the Philips 60W Replacement Lamp L Prize Entry

    Energy Technology Data Exchange (ETDEWEB)

    Poplawski, Michael E.; Ledbetter, Marc R.; Smith, Mark

    2012-04-24

    The Pacific Northwest National Laboratory, operated by Battelle for the U.S. Department of Energy, worked with Intertek to develop a procedure for stress testing medium screw-base light sources. This procedure, composed of alternating stress cycles and performance evaluation, was used to qualitatively compare and contrast the durability and reliability of the Philips 60W replacement lamp L Prize entry with market-proven compact fluorescent lamps (CFLs) with comparable light output and functionality. The stress cycles applied simultaneous combinations of electrical, thermal, vibration, and humidity stresses of increasing magnitude. Performance evaluations measured relative illuminance, x chromaticity and y chromaticity shifts after each stress cycle. The Philips L Prize entry lamps appear to be appreciably more durable than the incumbent energy-efficient technology, as represented by the evaluated CFLs, and with respect to the applied stresses. Through the course of testing, all 15 CFL samples permanently ceased to function as a result of the applied stresses, while only 1 Philips L Prize entry lamp exhibited a failure, the nature of which was minor, non-destructive, and a consequence of a known (and resolved) subcontractor issue. Given that current CFL technology appears to be moderately mature and no Philips L Prize entry failures could be produced within the stress envelope causing 100 percent failure of the benchmark CFLs, it seems that, in this particular implementation, light-emitting diode (LED) technology would be much more durable in the field than current CFL technology. However, the Philips L Prize entry lamps used for testing were carefully designed and built for the competition, while the benchmark CFLs were mass produced for retail sale—a distinction that should be taken into consideration. Further reliability testing on final production samples would be necessary to judge the extent to which the results of this analysis apply to production versions

  2. Creating the "desired mindset": Philip Morris's efforts to improve its corporate image among women.

    Science.gov (United States)

    McDaniel, Patricia A; Malone, Ruth E

    2009-01-01

    Through analysis of tobacco company documents, we explored how and why Philip Morris sought to enhance its corporate image among American women. Philip Morris regarded women as an influential political group. To improve its image among women, while keeping tobacco off their organizational agendas, the company sponsored women's groups and programs. It also sought to appeal to women it defined as "active moms" by advertising its commitment to domestic violence victims. It was more successful in securing women's organizations as allies than active moms. Increasing tobacco's visibility as a global women's health issue may require addressing industry influence.

  3. Intravenous immunoglobulin in the management of a rare cause of hemolytic disease of the newborn: Anti-SARA antibodies.

    Science.gov (United States)

    Venkataraman, Rohini; Yusuf, Kamran

    2017-01-01

    Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.

  4. Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

    Directory of Open Access Journals (Sweden)

    Tirshem Kumar Kaushik

    2015-05-01

    Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.

  5. Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge

    DEFF Research Database (Denmark)

    Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette

    2017-01-01

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...

  6. TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

    Energy Technology Data Exchange (ETDEWEB)

    1989-03-01

    This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.

  7. Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.

    1994-11-01

    The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)

  8. Instructional materials for SARA/OSHA training. Volume 1, General site working training

    Energy Technology Data Exchange (ETDEWEB)

    Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)

    1988-04-01

    This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.

  9. La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli

    Directory of Open Access Journals (Sweden)

    Umberto Fortis

    2014-04-01

    Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.

  10. Reading Sara Pujol Russell’s Poetry of Contemplation and Connection

    Directory of Open Access Journals (Sweden)

    Anita M. Hart

    2012-06-01

    Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.

  11. SAPHIRE technical reference manual: IRRAS/SARA Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.

    1993-01-01

    This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix

  12. "The Big WHY": Philip Morris's failed search for corporate social value.

    Science.gov (United States)

    McDaniel, Patricia A; Malone, Ruth E

    2012-10-01

    We examined Philip Morris USA's exploration of corporate social responsibility practices and principles and its outcome. We analyzed archival internal tobacco industry documents, generated in 2000 to 2002, related to discussions of corporate social responsibility among a Corporate Responsibility Taskforce and senior management at Philip Morris. In exploring corporate social responsibility, Philip Morris executives sought to identify the company's social value-its positive contribution to society. Struggling to find an answer, they considered dramatically changing the way the company marketed its products, apologizing for past actions, and committing the company to providing benefits for future generations. These ideas were eventually abandoned. Despite an initial call to distinguish between social and economic value, Philip Morris ultimately equated social value with providing shareholder returns. When even tobacco executives struggle to define their company's social value, it signals an opening to advocate for endgame scenarios that would encourage supply-side changes appropriate to the scale of the tobacco disease epidemic and consistent with authentic social value.

  13. Campaign to counter a deteriorating consumer market: Philip Morris's Project Sunrise.

    Science.gov (United States)

    Givel, M

    2013-02-01

    From 1997 to 2000, Philip Morris implemented Project Sunrise. This paper discusses the impact of this project on national and Philip Morris's cigarette unit sales, public opinion about smoking and secondhand tobacco smoke, and national prevalence trends for tobacco use. A qualitative archival content analysis of Project Sunrise from 1997 to 2000, and a descriptive statistical analysis of cigarette unit sales and operating profits, acceptability of smoking and secondhand tobacco smoke, and national prevalence trends for tobacco use from 1996 to 2006. Qualitative data sources related to Project Sunrise found on WebCat, Pubmed.com, LexisNexis Academic and Philip Morris's website, and archived tobacco industry documents were analysed using NVivo Version 9.0. A descriptive statistical analysis of cigarette unit sales, public opinion about smoking and secondhand tobacco smoke, and national prevalence trends for tobacco use was undertaken. Project Sunrise was a high-level strategic corporate plan to maintain profits that included four possible scenarios resulting in seven interwoven strategies. However, national prevalence rates for tobacco use declined, sales of national and Philip Morris cigarettes declined, operating profits remained at substantially lower levels after 2000 from 2001 to 2006, and a large majority of Americans agreed that there were significant health dangers associated with smoking and secondhand tobacco smoke. The impact of Project Sunrise, including countering the anti-tobacco movement, was less than successful in the USA. Copyright © 2012 The Royal Society for Public Health. Published by Elsevier Ltd. All rights reserved.

  14. Working to make an image: an analysis of three Philip Morris corporate image media campaigns.

    Science.gov (United States)

    Szczypka, Glen; Wakefield, Melanie A; Emery, Sherry; Terry-McElrath, Yvonne M; Flay, Brian R; Chaloupka, Frank J

    2007-10-01

    To describe the nature and timing of, and population exposure to, Philip Morris USA's three explicit corporate image television advertising campaigns and explore the motivations behind each campaign. Analysis of television ratings from the largest 75 media markets in the United States, which measure the reach and frequency of population exposure to advertising; copies of all televised commercials produced by Philip Morris; and tobacco industry documents, which provide insights into the specific goals of each campaign. Household exposure to the "Working to Make a Difference: the People of Philip Morris" averaged 5.37 ads/month for 27 months from 1999-2001; the "Tobacco Settlement" campaign averaged 10.05 ads/month for three months in 2000; and "PMUSA" averaged 3.11 ads/month for the last six months in 2003. The percentage of advertising exposure that was purchased in news programming in order to reach opinion leaders increased over the three campaigns from 20%, 39% and 60%, respectively. These public relations campaigns were designed to counter negative images, increase brand recognition, and improve the financial viability of the company. Only one early media campaign focused on issues other than tobacco, whereas subsequent campaigns have been specifically concerned with tobacco issues, and more targeted to opinion leaders. The size and timing of the advertising buys appeared to be strategically crafted to maximise advertising exposure for these population subgroups during critical threats to Philip Morris's public image.

  15. Leadership style and entrepreneurial change: the Centurion operation at Philips Electronics

    NARCIS (Netherlands)

    Karsten, L.; Keulen, S.; Kroeze, R.; Peters, R.

    2009-01-01

    Purpose - This paper aims to look at the role of the top and middle management of the Philips organization during the transition from one type of organizational change to another in the 1990s and the role the history of the organisation played in this process. Design/methodology/approach - The paper

  16. Leadership style and entrepreneurial change : The Centurion operation at Philips Electronics

    NARCIS (Netherlands)

    Karsten, Luchien; Keulen, Sjoerd; Kroeze, Ronald; Peters, Rik

    2009-01-01

    Purpose - This paper aims to look at the role of the top and middle management of the Philips organization during the transition from one type of organizational change to another in the 1990s and the role the history of the organisation played in this process. Design/methodology/approach - The paper

  17. “The Big WHY”: Philip Morris’s Failed Search for Corporate Social Value

    Science.gov (United States)

    Malone, Ruth E.

    2012-01-01

    Objectives. We examined Philip Morris USA’s exploration of corporate social responsibility practices and principles and its outcome. Methods. We analyzed archival internal tobacco industry documents, generated in 2000 to 2002, related to discussions of corporate social responsibility among a Corporate Responsibility Taskforce and senior management at Philip Morris. Results. In exploring corporate social responsibility, Philip Morris executives sought to identify the company’s social value—its positive contribution to society. Struggling to find an answer, they considered dramatically changing the way the company marketed its products, apologizing for past actions, and committing the company to providing benefits for future generations. These ideas were eventually abandoned. Despite an initial call to distinguish between social and economic value, Philip Morris ultimately equated social value with providing shareholder returns. Conclusions. When even tobacco executives struggle to define their company’s social value, it signals an opening to advocate for endgame scenarios that would encourage supply-side changes appropriate to the scale of the tobacco disease epidemic and consistent with authentic social value. PMID:22897536

  18. Enhancing the IT Infrastructure at Saint Philip's Hospital: Point-of-Care Solutions

    Science.gov (United States)

    Naydenova, Iva; White, Bruce

    2013-01-01

    Healthcare has become a rapidly changing field. With the introduction of value-based purchasing to determine reimbursement of Medicare providers based on the quality of care in addition to outcomes in treatment, the environment is becoming ever more competitive. Saint Philip's Hospital is among the largest non-profit hospitals in the nation…

  19. Managing between science and industrie: An historical analysis of the Philips Research and Development Department's management

    NARCIS (Netherlands)

    Boersma, F.K.

    2007-01-01

    Purpose This paper seeks to deal with the history of Research and Development (R&D) management. It takes the history of the R&D Department of the Royal Philips Electronics of The Netherlands as an example to unravel the dynamics behind industrial R&D management. Designomethodologyoapproach This

  20. A. Philip Randolph's Attempt at Equal Economic Opportunity: A Case Study

    Science.gov (United States)

    Walker, Joel

    2013-01-01

    A. Philip Randolph, the national president of the Brotherhood of Sleeping Car Porters was one of the driving forces behind the March on Washington Movement in 1941. In frustration over the federal government's lack of support for opportunities in the booming war industries and equality in the military, Randolph had begun to organize the March…

  1. An Information Model for Product Development : A Case Study at PHILIPS Shavers

    NARCIS (Netherlands)

    Jauregui Becker, Juan Manuel; Wits, Wessel Willems

    2013-01-01

    This paper presents an investigation into the development of an information model to support the Product Development Process (PDP) of shaving devices at PHILIPS. Firstly, challenges of the PDP were identified by carrying out interviews with several systems engineers and product architects. It was

  2. Paradise Lost and Found: Obedience, Disobedience, and Storytelling in C.S. Lewis and Philip Pullman.

    Science.gov (United States)

    Wood, Naomi

    2001-01-01

    Considers how in the fantasy series "The Chronicles of Narnia" and "His Dark Materials," by C.S. Lewis and Philip Pullman respectively, the authors use symbols and themes from "Paradise Lost." Notes that each author's narrative choice uses his view of cosmic order to persuade readers that obedience should be…

  3. Instrumental parameters' determination in a fluorescences X-ray Philips PW 1400 equipment

    International Nuclear Information System (INIS)

    Martinez, J.M.; Fasio, I.; Baronio, N.; Viola, M.

    1987-01-01

    The instrumental parameters of a Philips PW 1400 equipment wavelengths dispersive are determined; fundamentally, those related to the equipment's accuracy (stability at a very short, short and long term drift) as well as to those related to the detection system (dead time, detector's cleaning and detection limit). (S.M.) [es

  4. 76 FR 71048 - Sixth Annual Philip S. Chen, Jr. Distinguished Lecture on Innovation and Technology Transfer

    Science.gov (United States)

    2011-11-16

    ... present ``Treatment of Cancer with Recombinant Immunotoxins: From Technology Transfer to the Patient.'' Dr. Pastan is an NIH Distinguished Investigator and Chief, Laboratory of Molecular Biology, National Cancer Institute Center for Cancer Research. This annual series honors Dr. Philip S. Chen, Jr. for his almost 50...

  5. Leadership style and entrepreneurial change: The Centurion operation at Philips Electronics

    NARCIS (Netherlands)

    Kroeze, D.B.R.; Karsten, L.; Keulen, S.J.; Peters, R.G.P.

    2009-01-01

    Purpose - This paper aims to look at the role of the top and middle management of the Philips organization during the transition from one type of organizational change to another in the 1990s and the role the history of the organisation played in this process. Design/methodology/approach - The paper

  6. PWA90 Workshop : Marking the Scientific Accomplishments of Philip W. Anderson

    CERN Document Server

    Coleman, PIers; Kotliar, Gabi; Ong, Phuan; Stein, Daniel L; Yu, Clare; PWA90 : a lifetime of emergence

    2016-01-01

    In a remarkable career spanning more than six decades, Philip W Anderson has made many fundamental contributions to physics. As codified in his oft-quoted phrase "More is Different", Anderson has been the most forceful and persuasive proponent of the radical, but now ubiquitous, viewpoint of emergent phenomena: truly fundamental concepts that can and do emerge from studies of Nature at each layer of complexity or energy scale. Anderson's ideas have also extended deeply into other areas of physics, including the Anderson–Higgs mechanism and the dynamics of pulsars. PWA90: A Lifetime of Emergence is a volume of original scientific essays and personal reminiscences of Philip W Anderson by experts in the field, that were presented as part of "PWA90: Emergent Frontiers of Condensed Matter" meeting held at Princeton in December 2013 to highlight Anderson's contributions to physics.

  7. Three Experts on Quality Management: Philip B. Crosby, W. Edwards Deming, Joseph M. Juran

    Science.gov (United States)

    1992-07-01

    Department of the Navy Office of the Under Secretary of the Navy Total Quality Leadership Omce THREE EXPERTS ON QUALITY MANAGEMENT : PHILIP B. CROSBY W...research, as the "price of nonconformance." To aid managers in statistical theory , statistical thinking, and the application tracking the cost of doing...Quality Management emphasizes that the process must become a way of life in Theory of Systems. "A system is a series of the organization. Continuance is

  8. Soil physical properties influencing the fitting parameters in Philip and Kostiakov infiltration models

    International Nuclear Information System (INIS)

    Mbagwu, J.S.C.

    1994-05-01

    Among the many models developed for monitoring the infiltration process those of Philip and Kostiakov have been studied in detail because of their simplicity and the ease of estimating their fitting parameters. The important soil physical factors influencing the fitting parameters in these infiltration models are reported in this study. The results of the study show that the single most important soil property affecting the fitting parameters in these models is the effective porosity. 36 refs, 2 figs, 5 tabs

  9. Application of isotopic information for estimating parameters in Philip infiltration model

    Directory of Open Access Journals (Sweden)

    Tao Wang

    2016-10-01

    Full Text Available Minimizing parameter uncertainty is crucial in the application of hydrologic models. Isotopic information in various hydrologic components of the water cycle can expand our knowledge of the dynamics of water flow in the system, provide additional information for parameter estimation, and improve parameter identifiability. This study combined the Philip infiltration model with an isotopic mixing model using an isotopic mass balance approach for estimating parameters in the Philip infiltration model. Two approaches to parameter estimation were compared: (a using isotopic information to determine the soil water transmission and then hydrologic information to estimate the soil sorptivity, and (b using hydrologic information to determine the soil water transmission and the soil sorptivity. Results of parameter estimation were verified through a rainfall infiltration experiment in a laboratory under rainfall with constant isotopic compositions and uniform initial soil water content conditions. Experimental results showed that approach (a, using isotopic and hydrologic information, estimated the soil water transmission in the Philip infiltration model in a manner that matched measured values well. The results of parameter estimation of approach (a were better than those of approach (b. It was also found that the analytical precision of hydrogen and oxygen stable isotopes had a significant effect on parameter estimation using isotopic information.

  10. In-depth study of single photon time resolution for the Philips digital silicon photomultiplier

    International Nuclear Information System (INIS)

    Liu, Z.; Pizzichemi, M.; Ghezzi, A.; Paganoni, M.; Gundacker, S.; Auffray, E.; Lecoq, P.

    2016-01-01

    The digital silicon photomultiplier (SiPM) has been commercialised by Philips as an innovative technology compared to analog silicon photomultiplier devices. The Philips digital SiPM, has a pair of time to digital converters (TDCs) connected to 12800 single photon avalanche diodes (SPADs). Detailed measurements were performed to understand the low photon time response of the Philips digital SiPM. The single photon time resolution (SPTR) of every single SPAD in a pixel consisting of 3200 SPADs was measured and an average value of 85 ps full width at half maximum (FWHM) was observed. Each SPAD sends the signal to the TDC with different signal propagation time, resulting in a so called trigger network skew. This distribution of the trigger network skew for a pixel (3200 SPADs) has been measured and a variation of 50 ps FWHM was extracted. The SPTR of the whole pixel is the combination of SPAD jitter, trigger network skew, and the SPAD non-uniformity. The SPTR of a complete pixel was 103 ps FWHM at 3.3 V above breakdown voltage. Further, the effect of the crosstalk at a low photon level has been studied, with the two photon time resolution degrading if the events are a combination of detected (true) photons and crosstalk events. Finally, the time response to multiple photons was investigated.

  11. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    Directory of Open Access Journals (Sweden)

    Abdullah K. Shehabat

    2016-09-01

    Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.

  12. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0. Volume 5, Systems Analysis and Risk Assessment (SARA) tutorial manual

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities

  13. SARA South Observations and Analysis of the Solar Type, Totally Eclipsing, Over Contact Binary, PY Aquarii

    Science.gov (United States)

    Chamberlain, Heather; Samec, Ronald G.; Caton, Daniel Bruce; Van Hamme, Walter

    2018-01-01

    PY Aqr (GSC 05191-00853) is a solar Type (T ~ 5750K) eclipsing binary. It was observed in July to October, 2017 at Cerro Tololo in remote mode with the 0.6-m SARA South reflector. Two times of minimum light were calculated from our present observations, a primary and a secondary eclipse:HJD Min I = 2457951.7762±0.0006 HJD Min II = 2458019.5295±00.0003. Both weighted as 1.0.In addition, four timings were determined from online data given in IBVS 5600 and five observations at minima were determined from archived All Sky Automated Survey Data:HJD Min I = 2452908.3165, 2452912.33612 HJD Min II = 2452877.5621, 2452913.34465. All weighted as 0.5.ASAS Observations at minima: 2452094.688, 2453478.882, 2453266.576, 2452093.685 and 54729.600. Each weighted as 0.10The following linear and quadratic ephemerides were determined from all available times of minimum light:JD Hel Min I=2452951.7443±0.0008d + 0.402093441±0.000000099 X E {1} JD Hel Min I=2452951.7439±0.0007d + 0.4020912±0.0000007 X E +0.00000000018 ± 0.00000000006 X E2 {2}A BVRI Bessell filtered simultaneous Wilson-Devinney Program (W-D) solution reveals that the system has a mass ratio of ~0.34 and a component temperature difference of only ~40 K. One low luminosity (Tfact ~ 0.94, ~66 degree radius) large cool region of spots was iterated on the primary component in the WD Synthetic Light Curve computations. It appears in the Southern Hemisphere (colatitude 155 degrees). The Roche Lobe fill-out of the binary is ~17%. The inclination is ~86 degrees. An eclipse duration of ~10 minutes was determined for the primary eclipse and the light curve solution. Additional and more detailed information is given in this report.

  14. DETERMINACIÓN DE LAS FRACCIONES SARA DE ASFALTOS COLOMBIANOS ENVEJECIDOS AL MEDIO AMBIENTE EMPLEANDO CROMATOGRAFÍA LÍQUIDA EN COLUMNA DETERMINAÇÃO DAS FRAÇÕES SARA DE ASFALTOS COLOMBIANOS ENVELHECIDOS AO MÉDIO AMBIENTE EMPREGANDO CROMATOGRAFIA LÍQUIDA EM COLUNA DETERMINATION OF SARA FRACTIONS OF ENVIRONMENTALLY AGED COLOMBIAN ASPHALTS USING LIQUID CHROMATOGRAPHY COLUMN

    Directory of Open Access Journals (Sweden)

    Fredy Alberto Reyes

    2012-06-01

    Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p

  15. Philip Morris Asia Ltd. v. Australia – abuse of rights in investor-state arbitration / Ulf Linderfalk

    Index Scriptorium Estoniae

    Linderfalk, Ulf

    2017-01-01

    Kohtulahendist Philip Morris Asia Ltd. vs Australia. Õiguste kuritarvitamise doktriinist rahvusvahelises õiguses. Austraalia tubakaseadusest, seadusest tulenevatest piirangutest tubakatoodete pakendamisele, kaubamärgi kasutamise piiramisest tubakatoodete pakendil

  16. Implications of Reverse Innovation for Socio-Economic Sustainability: A Case Study of Philips China

    Directory of Open Access Journals (Sweden)

    Juan Shan

    2016-06-01

    Full Text Available The idea of reverse innovation, local innovation happening in emerging markets for the global market, has gained much academic and managerial attention in recent years. The purpose of this study is to understand how reverse innovation has successfully diffused into the product and market development strategies at Philips Inc., a prominent multinational company (MNC of the modern era. Furthermore, the study presents the success achieved by these innovations at both the domestic and global levels, along with their implications regarding socio-economic sustainability in emerging markets. In order to investigate the research questions, a case study of Philips China was conducted involving three product innovations that were found to be suitable examples of reverse innovation. After the study of extant literature on the topic, drawing from research databases, newspaper articles, and company press releases, five semi-structuredinterviews were conducted with key managers and a market practitioner to gain sufficient understanding for this exploratory study. Subsequent case analysis concludes that these innovations are examples of reverse innovation representing a new paradigm change in innovation flow. This flow of innovation from emerging markets to developed markets as confirmed by Corsi’s framework could potentially disrupt developed markets as well as contribute to ensure healthy living conditions for the population living in developing countries. If so, this represents a sustainable socio-economic change in-line with the United Nations' Sustainable Development Goal (SDG of “ensuring healthy lives and promoting well-being for all at all ages.” This is relevant as Philips aspires to be a prominent private sector player in achieving the above-stated goal by defeating non-communicable disease and strengthening local healthcare systems.

  17. Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia

    Directory of Open Access Journals (Sweden)

    Tjitske F. Lawerman

    2017-12-01

    Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced

  18. sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

    DEFF Research Database (Denmark)

    Christner, Martin; Heinze, Constanze; Busch, Michael

    2012-01-01

    to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...

  19. Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

    Science.gov (United States)

    Godwin, Allison; Potvin, Geoff

    2017-01-01

    This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…

  20. Staphylococcus aureus Quorum Regulator SarA Targeted Compound, 2-[(Methylaminomethyl]phenol Inhibits Biofilm and Down-Regulates Virulence Genes

    Directory of Open Access Journals (Sweden)

    P. Balamurugan

    2017-07-01

    Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.

  1. Characteristics of Philips SL-20 linear accelerator used for stereotactic radiosurgery/radiotherapy

    International Nuclear Information System (INIS)

    D'Souza, Harold; Ganesh, T.; Joshi, R.C.; Julka, P.K.; Rath, G.K.; Chander, Subhash; Pant, G.S.

    2002-01-01

    Commissioning of a stereotactic radiosurgery/stereotactic radiotherapy (SRS/SRT) facility on a modified linear accelerator requires validation of mechanical parameters and establishment of parameters, such as tissue maximum ratio (TMR), relative output factors (OF), and off axis ratios (OAR). The mechanical and beam characteristics of Philips SL-20 linear accelerator modified for SRS/SRT were evaluated and presented. The SRS/SRT procedure carried on Philips SL-20 linear accelerator with Brown-Robert-Wells (BRW) and relocatable Gill-Thomas-Cosman (GTC) head frames along with the Radionics planning system was evaluated. The tertiary collimator consists of the actual treatment cones and their sizes vary from 12.5 mm to 40 mm diameter. The alignment of the auxillary collimator axis with mechanical axes and stability of the isocenter of Philips SL-20 machine was evaluated using Iso-Align device and mechanical isocenter standard (MIS). All the mechanical errors of the linear accelerator were within 1 mm, except the stability of the isocenter while rotating the couch. Alignment of auxiliary collimator axis with the central axis, gantry and couch axes were achieved. The TMR, OF and OAR for 6 MV x-rays from Philips SL-20 linear accelerator for different cone sizes were deduced using a Multidata water phantom with 0.015 cc ion chamber. The difference between 50% width of profiles in two major axes (x and y) were within ± 0.4 mm. The cone dimensions were accurate up to 0.7 mm. The penumbra width for different cones varies from 3.1 mm to 3.5 mm. Dose linearity of the monitoring system was ≤ 1% above 5 MU. The mechanical and beam characteristics including dose linearity of the SL-20 machine are presented. The beam characteristics of this machine are comparable with the other modified linear accelerators for SRS/SRT. The shift of isocenter during rotation of couch can be nullified by fine adjusting laser target localizing frame to the laser position using micrometer screws

  2. Philip Roth's The human stain and the destruction of the American dream

    Directory of Open Access Journals (Sweden)

    Miha Vrčko

    2006-12-01

    Full Text Available The paper dissects the notion of the American Dream in Philip Roth's The Human Stain. It looks at how individual tenets of the Dream are carved into the protagonist Coleman Silk, a black man who goes through life pretending to be white. The analysis shows how these same principles are questioned through various incidents in Silk's life and ultimately by his violent death. The result of Roth's scrutinizing is that, as all the underminings come together, the whole concept of the American Dream is symbolically crushed.

  3. The full automation of a Philips 1220 x-ray spectrometer

    International Nuclear Information System (INIS)

    Austen, C.E.

    1976-01-01

    A Philips 1220 X-ray spectrometer (semi-automatic) was fully automated by the addition of a custom-built automatic sample-loader constructed at the National Institute for Metallurgy and a Texas 980 A mini-computer. The mini-computer was interfaced to the existing control circuits of the X-ray spectrometer through a custom-built logic-circuit unit that controls the automatic sample-loader and X-ray spectrometer on instructions received from the mini-computer. The controlling software is written in BASIC

  4. The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters

    International Nuclear Information System (INIS)

    Iazzourene, F.

    1982-01-01

    The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr

  5. Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

    Directory of Open Access Journals (Sweden)

    Helena López

    2013-07-01

    Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.

  6. Os suínos da raça Bísara – oportunidades e desafios

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...

  7. Philip Morris's website and television commercials use new language to mislead the public into believing it has changed its stance on smoking and disease.

    Science.gov (United States)

    Friedman, Lissy C

    2007-12-01

    This paper analyses Philip Morris's evolving website and the legal strategies employed in its creation and dissemination. Internal tobacco documents were searched and examined and their substance verified and triangulated using media accounts, legal and public health research papers, and visits to Philip Morris's website. Various drafts of website language, as well as informal discussion of the website's creation, were located in internal Philip Morris documents. I compared website statements pertaining to Philip Morris's stance on cigarette smoking and disease with statements made in tobacco trials. Philip Morris created and disseminated its website's message that it agreed that smoking causes disease and is addictive in an effort to sway public opinion, while maintaining in a litigation setting its former position that it cannot be proved that smoking causes disease or is addictive. Philip Morris has not changed its position on smoking and health or addiction in the one arena where it has the most to lose-in the courtroom, under oath.

  8. ARTIST (Asian regional tobacco industry scientist team): Philip Morris' attempt to exert a scientific and regulatory agenda on Asia.

    Science.gov (United States)

    Tong, E K; Glantz, S A

    2004-12-01

    To describe how the transnational tobacco industry has collaborated with local Asian tobacco monopolies and companies to promote a scientific and regulatory agenda. Analysis of previously secret tobacco industry documents. Transnational tobacco companies began aggressively entering the Asia market in the 1980s, and the current tobacco industry in Asia is a mix of transnational and local monopolies or private companies. Tobacco industry documents demonstrate that, in 1996, Philip Morris led an organisation of scientific representatives from different tobacco companies called the Asian Regional Tobacco Industry Science Team (ARTIST), whose membership grew to include monopolies from Korea, China, Thailand, and Taiwan and a company from Indonesia. ARTIST was initially a vehicle for PM's strategies against anticipated calls for global smoke-free areas from a World Health Organization secondhand smoke study. ARTIST evolved through 2001 into a forum to present scientific and regulatory issues faced primarily by Philip Morris and other transnational tobacco companies. Philip Morris' goal for the organisation became to reach the external scientific and public health community and regulators in Asia. The Asian tobacco industry has changed from an environment of invasion by transnational tobacco companies to an environment of participation with Philip Morris' initiated activities. With this participation, tobacco control efforts in Asia face new challenges as Philip Morris promotes and integrates its scientific and regulatory agenda into the local Asian tobacco industry. As the local Asian tobacco monopolies and companies can have direct links with their governments, future implementation of effective tobacco control may be at odds with national priorities.

  9. Management of pediatric radiation dose using Philips fluoroscopy systems DoseWise: perfect image, perfect sense

    International Nuclear Information System (INIS)

    Stueve, Dick

    2006-01-01

    Although image quality (IQ) is the ultimate goal for accurate diagnosis and treatment, minimizing radiation dose is equally important. This is especially true when pediatric patients are examined, because their sensitivity to radiation-induced cancer is two to three times greater than that of adults. DoseWise is an ALARA-based philosophy within Philips Medical Systems that is active at every level of product design. It encompasses a set of techniques, programs and practices that ensures optimal IQ while protecting people in the X-ray environments. DoseWise methods include management of the X-ray beam, less radiation-on time and more dose information for the operator. Smart beam management provides automatic customization of the X-ray beam spectrum, shape, and pulse frequency. The Philips-patented grid-controlled fluoroscopy (GCF) provides grid switching of the X-ray beam in the X-ray tube instead of the traditional generator switching method. In the examination of pediatric patients, DoseWise technology has been scientifically documented to reduce radiation dose to <10% of the dose of traditional continuous fluoroscopy systems. The result is improved IQ at a significantly lower effective dose, which contributes to the safety of patients and staff. (orig.)

  10. How Philip Morris unlocked the Japanese cigarette market: lessons for global tobacco control.

    Science.gov (United States)

    Lambert, A; Sargent, J D; Glantz, S A; Ling, P M

    2004-12-01

    The Framework Convention on Tobacco Control includes tobacco advertising restrictions that are strongly opposed by the tobacco industry. Marketing strategies used by transnational tobacco companies to open the Japanese market in the absence of such restrictions are described. Analysis of internal company documents. Between 1982 and 1987 transnational tobacco companies influenced the Japanese government through the US Trade Representative to open distribution networks and eliminate advertising restrictions. US cigarette exports to Japan increased 10-fold between 1985 and 1996. Television advertising was central to opening the market by projecting a popular image (despite a small actual market share) to attract existing smokers, combined with hero-centred advertisements to attract new smokers. Philip Morris's campaigns featured Hollywood movie personalities popular with young men, including James Coburn, Pierce Brosnan, Roger Moore, and Charlie Sheen. Event sponsorships allowed television access despite restrictions. When reinstatement of television restrictions was threatened in the late 1980s, Philip Morris more than doubled its television advertising budget and increased sponsorship of televised events. By adopting voluntary advertising standards, transnational companies delayed a television advertising ban for over a decade. Television image advertising was important to establish a market, and it has been enhanced using Hollywood personalities. Television advertising bans are essential measures to prevent industry penetration of new markets, and are less effective without concurrent limits on sponsorship and promotion. Comprehensive advertising restrictions, as included in the Framework Convention for Tobacco Control, are vital for countries where transnational tobacco companies have yet to penetrate the market.

  11. Validity of automated measurement of left ventricular ejection fraction and volume using the Philips EPIQ system.

    Science.gov (United States)

    Hovnanians, Ninel; Win, Theresa; Makkiya, Mohammed; Zheng, Qi; Taub, Cynthia

    2017-11-01

    To assess the efficiency and reproducibility of automated measurements of left ventricular (LV) volumes and LV ejection fraction (LVEF) in comparison to manually traced biplane Simpson's method. This is a single-center prospective study. Apical four- and two-chamber views were acquired in patients in sinus rhythm. Two operators independently measured LV volumes and LVEF using biplane Simpson's method. In addition, the image analysis software a2DQ on the Philips EPIQ system was applied to automatically assess the LV volumes and LVEF. Time spent on each analysis, using both methods, was documented. Concordance of echocardiographic measures was evaluated using intraclass correlation (ICC) and Bland-Altman analysis. Manual tracing and automated measurement of LV volumes and LVEF were performed in 184 patients with a mean age of 67.3 ± 17.3 years and BMI 28.0 ± 6.8 kg/m 2 . ICC and Bland-Altman analysis showed good agreements between manual and automated methods measuring LVEF, end-systolic, and end-diastolic volumes. The average analysis time was significantly less using the automated method than manual tracing (116 vs 217 seconds/patient, P Automated measurement using the novel image analysis software a2DQ on the Philips EPIQ system produced accurate, efficient, and reproducible assessment of LV volumes and LVEF compared with manual measurement. © 2017, Wiley Periodicals, Inc.

  12. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  13. Avian Diseases: The Creation and Evolution of P. Philip Levine's Enduring Gift.

    Science.gov (United States)

    Calnek, Bruce W

    2015-03-01

    This account has two aims. The first is to provide a tribute to Dr. Pincus Philip Levine, the founder of Avian Diseases. It addresses several facets of the life and times of this remarkable and interesting personality, giving some insight into the why and how he came to establish the journal. It touches on his background; his character; his astute and searching mind; his ability to interact with others; his influence on veterinary, and especially avian, medicine; and his teaching genius and reveals the positive force he was in his interactions with others. Then, it turns to a celebration of the first half-century of the journal that he created, essentially single-handedly, and reviews some of the history regarding the stimulus, birthing pains, and gradual evolution of the journal through a succession of editors, business managers, and supporting casts to the publication that we see today, nearly 50 yr later.

  14. Uranium hydrogeochemical and stream sediment reconnaissance of the Philip Smith Mountains NTMS quadrangle, Alaska

    International Nuclear Information System (INIS)

    1981-09-01

    Results of a hydrogeochemical and stream sediment reconnaissance of the Philip Smith Mountains NTMS quadrangle, Alaska are presented. In addition to this abbreviated data release, more complete data are available to the public in machine-readable form. In this data release are location data, field analyses, and laboratory analyses of several different sample media. For the sake of brevity, many field site observations have not been included in this volume. These data are, however, available on the magnetic tape. Appendices A and B describe the sample media and summarize the analytical results for each medium. The data were subsetted by one of the Los Alamos National Laboratory (LANL) sorting programs into groups of stream sediment and lake sediment samples. For each group which contains a sufficient number of observations, statistical tables, tables of raw data, and 1:1000000 scale maps of pertinent elements have been included in this report

  15. Uranium hydrogeochemical and stream sediment reconnaissance of the Philip Smith Mountains NTMS quadrangle, Alaska

    Energy Technology Data Exchange (ETDEWEB)

    1981-09-01

    Results of a hydrogeochemical and stream sediment reconnaissance of the Philip Smith Mountains NTMS quadrangle, Alaska are presented. In addition to this abbreviated data release, more complete data are available to the public in machine-readable form. In this data release are location data, field analyses, and laboratory analyses of several different sample media. For the sake of brevity, many field site observations have not been included in this volume. These data are, however, available on the magnetic tape. Appendices A and B describe the sample media and summarize the analytical results for each medium. The data were subsetted by one of the Los Alamos National Laboratory (LANL) sorting programs into groups of stream sediment and lake sediment samples. For each group which contains a sufficient number of observations, statistical tables, tables of raw data, and 1:1000000 scale maps of pertinent elements have been included in this report.

  16. When Harry met Zuckerman: self-reflexivity and metafiction in Philip Roth and Woody Allen

    Directory of Open Access Journals (Sweden)

    Thomás Creus

    2006-04-01

    Full Text Available The objective of this essay is to compare the works of novelist Philip Roth and film-maker Woody Allen in what regards their treatment of the highly complex theme of the interrelations between fiction and reality. A comparative analysis of selected Roth’s novels and Allen’s films evinces their recurrent preoccupation with the creation of art and its implications, be it through the choice of writers or artists as main characters, be it through plots that mix real facts with invented ones and imaginary characters with real ones, be it through the use of autobiographical elements in a fictional discourse—all metafictional devices that call attention to the artist’s own process of creation.

  17. Fantasmes et fantômes dans Sabbath’s Theater, de Philip Roth (1995

    Directory of Open Access Journals (Sweden)

    Géraldine CHOUARD

    2003-06-01

    Full Text Available “We are dealing here with death, fuck the flowers!” (120 S’il fallait, dans la littérature américaine, mettre un nom en face du mot fantasme, ce serait celui de Philip Roth, dont l’œuvre se place sous le signe d’une formidable libido. Suivraient ensuite sans doute ceux de Nabokov, Miller, Bukowski, ou Updike qui ont tour à tour fait leur miel des fantasmes les plus divers. Regroupés autour de cette thématique, ces écrivains portent la fiction américaine à un taux de testostérone pour le moin...

  18. The New Secular Humanists: Ronald Dworkin and Philip Kitcher on Life without God

    Directory of Open Access Journals (Sweden)

    Charles Taliaferro

    2015-07-01

    Full Text Available Ronald Dworkin and Philip Kitcher recognize that traditional, religious faith—especially in Christian theistic tradition—has virtues that seem to be missing in a secular worldview. To remedy this apparent deficit, they both propose that a secular worldview can provide a satisfying foundation for a flourishing, meaningful life. Moreover, Kitcher argues that secular humanism is far more justified than a religious worldview because it does not face the problem of diversity that arises in the case of religion. I argue that secular humanism faces the same problem of diversity that Kitcher proposes undermines religious belief. I further argue that Dworkin’s and Kitcher’s secular alternative to a religious worldview is problematic.

  19. Absorptive capacity in solid-state technology and international knowledge transfer : the case of Philips comparative technology transfer and society

    NARCIS (Netherlands)

    Davids, M.; Verbong, G.P.J.

    2007-01-01

    After World War II, the market for vacuum tubes was threatened by the development, first, of transistors and, later, integrated circuits. It was essential for European electronic companies, including the Dutch company Philips Electronics, to adopt American technology to gain a position in the

  20. A group find of the bronze coins struck under Philip II and Alexander III from Svoboda near Plovdiv (Bulgaria)

    Czech Academy of Sciences Publication Activity Database

    Militký, Jiří

    2013-01-01

    Roč. 27, č. 2 (2013), s. 147-160 ISSN 0546-9414 R&D Projects: GA ČR GA13-24707S Institutional support: RVO:67985912 Keywords : Macedonia * Bulgaria * Philip II * hoard Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. How Philip Morris built Marlboro into a global brand for young adults: implications for international tobacco control.

    Science.gov (United States)

    Hafez, N; Ling, P M

    2005-08-01

    To describe Philip Morris' global market research and international promotional strategies targeting young adults. Analysis of previously secret tobacco industry documents. Philip Morris pursued standardised market research and strategic marketing plans in different regions throughout the world using research on young adults with three principle foci: lifestyle/psychographic research, brand studies, and advertising/communication effectiveness. Philip Morris identified core similarities in the lifestyles and needs of young consumers worldwide, such as independence, hedonism, freedom, and comfort. In the early 1990s Philip Morris adopted standardised global marketing efforts, creating a central advertising production bank and guidelines for brand images and promotions, but allowing regional managers to create regionally appropriate individual advertisements. Values and lifestyles play a central role in the global marketing of tobacco to young adults. Worldwide counter marketing initiatives, coupled with strong, coherent global marketing policies such as the Framework Convention on Tobacco Control, are needed to break associations between young adult values and tobacco brands. As globalisation promotes the homogenisation of values and lifestyles, tobacco control messages that resonate with young adults in one part of the world may appeal to young adults in other countries. Successful tobacco control messages that appeal to young people, such as industry denormalisation, may be expanded globally with appropriate tailoring to appeal to regional values.

  2. Philip II’s Quest. The Appointment of Governors-General during the Dutch Revolt (1559-1598

    Directory of Open Access Journals (Sweden)

    V. Soen

    2011-01-01

    Full Text Available Philip II’s Quest: The Appointment of Governors-General during the Dutch Revolt (1559-1598Recent historiographical studies have presented the Habsburg appointment of governors-general during the Dutch Revolt as the outcome of factional infighting at the Spanish Court. While this so-called ‘faction model’ has yielded new insights, it also raises a number of problems. Firstly, in the new model, the role of the dynasty is unduly relegated to the background – even though Philip II’s appointment decisions were mainly driven by dynastic considerations. Secondly, the power struggle at the Spanish Court was not only a conflict between court factions, but also between noble houses vying for prestige and trying to secure positions for their offspring. Thirdly, there is an excessive focus on the Spanish Court, while the feuds between noble houses in the Low Countries also played a role in the interim appointments made during the Revolt. Finally, Philip II always looked for the most suitable candidate in terms of administration and warfare during the Dutch Revolt, in accordance with the constraints of the composite Spanish monarchy. Only the combination of these four (frequently contradictory motives reveals how Philip II’s appointment of governors can be seen as a quest for the right man or woman in the right place.

  3. Bedrijfsmatige bemiddeling. Philips en Unilever en de marketing van radio's, televisies en snacks in Nederland in de twintigste eeuw

    NARCIS (Netherlands)

    de Wit, Onno; Albert de la Bruheze, Adri A.

    2002-01-01

    Mediation practices show a wide variety. This article focuses upon mediation processes initiated by corporations. Within the context of two multinational companies, Philips and Unilever, the development, introduction and diffusion of radio and television sets and snacks in the Netherlands is

  4. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Diego O Andrey

    Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  5. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    OpenAIRE

    Abdullah K. Shehabat

    2016-01-01

    This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...

  6. Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests

    International Nuclear Information System (INIS)

    Eifler, W.; Shepherd, I.M.

    1983-01-01

    Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix

  7. Land-use evaluation for sustainable construction in a protected area: A case of Sara mountain national park.

    Science.gov (United States)

    Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena

    2018-01-15

    The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Interpreting the Dæmonomicon: A Decade of Teaching Philip Pullman’s Northern Lights

    Directory of Open Access Journals (Sweden)

    Jessica Allen Hanssen

    2018-05-01

    Full Text Available Philip Pullman’s His Dark Materials trilogy reinvigorated the high fantasy genre, not least by his invention of the dæmon. In this article I argue that the dæmon concept, when applied as a drawing exercise in the teacher education context, provides important insight into the vast diversity of interests, feelings, and values of ELT student teachers as they prepare to enter their chosen profession. From the years 2007-2017, approximately 200 university students were invited to draw a representation of their ‘dæmon’. The drawings, assembled and analysed as a data set based on markers such as the student teachers’ gender, as well as by content, size, and relative creativity, allow certain patterns and tendencies to become visible, and individual drawings also serve as important reflection points on the novel and the nature of teaching literature. Northern Lights, the first book of His Dark Materials trilogy, makes for excellent reading, and is also a helpful book to use in the teacher education context, to help student teachers learn the conventions of the fantasy genre and understand how knowledge of the genre can enhance their teaching practice. This article therefore presents a long-term learning activity connected to teaching Northern Lights, as a way into working with genre conventions, and also as a point of departure on the subject of the importance of self-reflection in the literature classroom’s interpretative community.

  9. 2013 Philip S. Portoghese Medicinal Chemistry Lectureship: Drug Discovery Targeting Allosteric Sites†

    Science.gov (United States)

    2015-01-01

    The identification of sites on receptors topographically distinct from the orthosteric sites, so-called allosteric sites, has heralded novel approaches and modes of pharmacology for target modulation. Over the past 20 years, our understanding of allosteric modulation has grown significantly, and numerous advantages, as well as caveats (e.g., flat structure–activity relationships, species differences, “molecular switches”), have been identified. For multiple receptors and proteins, numerous examples have been described where unprecedented levels of selectivity are achieved along with improved physiochemical properties. While not a panacea, these novel approaches represent exciting opportunities for tool compound development to probe the pharmacology and therapeutic potential of discrete molecular targets, as well as new medicines. In this Perspective, in commemoration of the 2013 Philip S. Portoghese Medicinal Chemistry Lectureship (LindsleyC. W.Adventures in allosteric drug discovery. Presented at the 246th National Meeting of the American Chemical Society, Indianapolis, IN, September 10, 2013; The 2013 Portoghese Lectureship), several vignettes of drug discovery campaigns targeting novel allosteric mechanisms will be recounted, along with lessons learned and guidelines that have emerged for successful lead optimization. PMID:25180768

  10. Proposal for a heavy ion ECR-source at the PSI-Philips cyclotron

    International Nuclear Information System (INIS)

    Kern, J.

    1989-10-01

    It is proposed by a large community of PSI- and external scientists to install an electron cyclotron resonance (ECR) source for highly charged heavy ions at the PHILIPS (injector I) cyclotron. Such a facility would then allow to produce high intensity ion beams with energies up to 30 MeV/u. A workshop hold in June 1989 clearly showed that with such a machine a large variety of interesting heavy ion experiments could be performed. While at foreign heavy ion centres the main focus is given to basic research in the field of nuclear physics we propose to concentrate the scientific effort at a PSI heavy ion facility mainly onto applications in the fields of atomic physics, chemistry, accelerator mass spectrometry, radiation biology and solid state physics. This is adequate, in view of the broad infrastructure available at PSI together with the existing know-how in many different fields. The proposed machine will thus be of great potential use for a large community. (author) 19 figs., 3 tabs., 82 refs

  11. “What Is Our Story?” Philip Morris’s Changing Corporate Narrative

    Science.gov (United States)

    Malone, Ruth E.

    2015-01-01

    Objectives. We sought to learn how employees reacted to changes in the corporate narrative of Philip Morris Companies (PMC) in the late 1990s and early 2000s. Methods. We analyzed archival internal tobacco industry documents about PMC’s creation of a new corporate story. Results. In response to litigation and public opprobrium, PMC replaced its market success–oriented corporate narrative with a new one centered on responsibility. Although management sought to downplay inconsistencies between the old and new narratives, some employees reportedly had difficulty reconciling them, concerned that the responsibility focus might affect company profitability. However, others embraced the new narrative, suggesting radical ideas to prevent youth smoking. These ideas were not adopted. Conclusions. PMC’s new narrative was unconvincing to many of its employees, who perceived it either as a threat to the company’s continued profits or as incongruous with what they had previously been told. As it had done with the public, PMC misled its employees in explaining a narrative repositioning that would help the company continue business as usual. Moving toward a tobacco endgame will require ongoing discursive and symbolic efforts to disrupt this narrative. PMID:26270280

  12. The skills of erect full-spine radiograph with Philips DR

    International Nuclear Information System (INIS)

    Yang Guangqi; Yang Xufeng; Wu Tengfang; Wen Xingwei

    2009-01-01

    Objective: To investigate the image stitching methods and skills of erect full-spine P-A radiograph with Philips DR. Methods: Proper spinal projecting position and exposure factors were selected to get the radiogragh of full-spine. Three methods were used to stitch images. The image deviation was evaluated with photoshop to judge the quality of the stitching full-spine images. Results: Among ninety-eight patients, the full-spine images were stitched successfully by automatic method in 78 patients. Other stiching images were justified with manual stitching method and were good enough for diagnosis. The border of vertebral body, pedicle of vertebral arch and spinous process were revealed clearly in 96 patients. The shift of vertebral body at stitching point was within 1 mm in 83 patients, 2mm in 11 patients, 3mm in 2 patients. Conclusion: Full spine radiography with DDR can provide clinical diagnosis information with reliable images. High quality and reliable full-spine images can be got with proper spinal projecting position, appropriate image postprocess software and suitable stitching method. (authors)

  13. Philip Meyer, o outsider que criou o Jornalismo de Precisão

    Directory of Open Access Journals (Sweden)

    Marília Gehrke

    2017-05-01

    Full Text Available A importância da trajetória de Philip Meyer para os estudos de jornalismo é o ponto principal desta entrevista. Ele é o criador do Jornalismo de Precisão, conceito que aproxima o jornalismo da ciência por meio de métodos científicos sociais, e que, também, dá nome a um de seus livros, publicado pela primeira vez em 1973. Ainda que o Jornalismo de Precisão não demande, necessariamente, o uso de computadores, Meyer começou a trabalhar com as máquinas antes de sua popularização, nos protestos de Detroit, em 1967, depois de passar nove meses na Universidade de Harvard. Utilizando amostra na narrativa jornalística, Meyer e a equipe do jornal Detroit Free Press receberam um Prêmio Pulitzer um ano depois. O Jornalismo de Precisão ainda é um conceito utilizado, mas hoje mais associado ao jornalismo de dados. Nessa entrevista, respondida por email, Meyer não só relembra aspectos de sua carreira e fala sobre a prática jornalística, como o uso de dados, transparência e hipótese, bem como revela suas percepções sobre o futuro do jornalismo.

  14. Fiscal versus social responsibility: how Philip Morris shaped the public funds divestment debate

    Science.gov (United States)

    Wander, N; Malone, R E

    2006-01-01

    Calls for institutional investors to divest (sell off) tobacco stocks threaten the industry's share values, publicise its bad behaviour, and label it as a politically unacceptable ally. US tobacco control advocates began urging government investment and pension funds to divest as a matter of responsible social policy in 1990. Following the initiation of Medicaid recovery lawsuits in 1994, advocates highlighted the contradictions between state justice departments suing the industry, and state health departments expanding tobacco control programmes, while state treasurers invested in tobacco companies. Philip Morris (PM), the most exposed US company, led the divestment opposition, consistently framing the issue as one of responsible fiscal policy. It insisted that funds had to be managed for the exclusive interest of beneficiaries, not the public at large, and for high share returns above all. This paper uses tobacco industry documents to show how PM sought to frame both the rhetorical contents and the legal contexts of the divestment debate. While tobacco stock divestment was eventually limited to only seven (but highly visible) states, US advocates focused public attention on the issue in at least 18 others plus various local jurisdictions. This added to ongoing, effective campaigns to denormalise and delegitimise the tobacco industry, dividing it from key allies. Divestment as a delegitimisation tool could have both advantages and disadvantages as a tobacco control strategy in other countries. PMID:16728755

  15. Probabilistic model fitting for spatio-temporal variability studies of precipitation: the Sara-Brut system - a case study

    International Nuclear Information System (INIS)

    Dorado Delgado, Jennifer; Burbano Criollo, Juan Carlos; Molina Tabares, Jose Manuel; Carvajal Escobar, Yesid; Aristizabal, Hector Fabio

    2006-01-01

    In this study, space and time variability of monthly and annual rainfall was analyzed for the downstream influence zone of a Colombian supply-regulation reservoir, Sara-Brut, located on the Cauca valley department. Monthly precipitation data from 18 gauge stations and for a 29-year record (1975-2003) were used. These data were processed by means of time series completion, consistency analyses and sample statistics computations. Theoretical probabilistic distribution models such as Gumbel, normal, lognormal and wake by, and other empirical distributions such as Weibull and Landwehr were applied in order to fit the historical precipitation data set. The fit standard error (FSE) was used to test the goodness of fit of the theoretical distribution models and to choose the best of this probabilistic function. The wake by approach showed the best goodness of fit in 89% of the total gauges taken into account. Time variability was analyzed by means of wake by estimated values of monthly and annual precipitation associated with return periods of 1,052, 1,25, 2, 10, 20 and 50 years. Precipitation space variability is presents by means of ArcGis v8.3 and using krigging as interpolation method. In general terms the results obtained from this study show significant distribution variability in precipitation over the whole area, and particularity, the formation of dry and humid nucleus over the northeastern strip and microclimates at the southwestern and central zone of the study area were observed, depending on the season of year. The mentioned distribution pattern is likely caused by the influence of pacific wind streams, which come from the Andean western mountain range. It is expected that the results from this work be helpful for future planning and hydrologic project design

  16. Commentary on Adele Tutter's "Design as dream and self-representation: Philip Johnson and the Glass House of Atreus".

    Science.gov (United States)

    Danze, Elizabeth A; Sonnenberg, Stephen M

    2012-06-01

    In this discussion of Adele Tutter's "Design as Dream and Self-Representation: Philip Johnson and the Glass House of Atreus" (JAPA 59/3), the architect Elizabeth Danze and the psychoanalyst Stephen Sonnenberg highlight what they see as the most important of Tutter's contributions as regards an understanding of Johnson's work. They then discuss those contributions as they illuminate the study of the relationship of architecture and design, on the one hand, and psychoanalysis on the other.

  17. The Philip Morris Genome Project: a guide to tracking alliances of the world´s largest cigarette company

    Directory of Open Access Journals (Sweden)

    Alan Blum

    2018-03-01

    Full Text Available Background Beginning in the 1980s, tobacco control efforts shifted from school-based and clinic-based education about the dangers of smoking to direct confrontation of the tobacco industry. But the industry also evolved by developing innovative promotional campaigns, adopting new corporate identities, and forging alliances with other industries and charitable organizations. Methods To document the extent of the commercial, civic, political, academic, military,and cultural ties cultivated by the world´s largest cigarette manufacturer, Philip Morris, a continuous, 35-year ethnographic analysis was conducted, involving daily monitoring of the global business press; monthly review of tobacco industry trade publications; scrutiny of annual company reports; and attendance at 20 shareholders´ meetings, four international tobacco industry trade expositions, and over 200 sports, arts, and ethnic minority events sponsored by the company. Results 48 Philip Morris manufacturing facilities in 32 countries produce more than 800 billion cigarettes a year for 180 markets..A pioneer in sponsoring popular programs on the new medium of television in the 1950s; the company circumvented the 1971 ban on TV cigarette advertising by creating sporting events that were internationally televised. By acquiring beer and food companies In the 1980s, Philip Morris retained influence over the mass media covetous of advertising revenue. In 2002 the company changed its name to Altria to diminish the tobacco stigma. It makes the world´s top cigarette brand, Marlboro, and holds 28% of the global market excluding China. The company has forged an extensive network of alliances with agricultural, marketing, chemical, pharmaceutical, financial, packaging, entertainment, shipping, and technology companies, as well as ties to hundreds of museums, arts organizations, universities, libraries, and charities combating problems such as domestic violence, hunger, pollution, illiteracy, and

  18. Evaluation of the polarization properties of a Philips-type prism for the construction of imaging polarimeters

    Science.gov (United States)

    Fernandez-Borda, R.; Waluschka, E.; Pellicori, S.; Martins, J. V.; Ramos-Izquierdo, L.; Cieslak, J. D.; Thompson, P.

    2009-08-01

    The design and construction of wide FOV imaging polarimeters for use in atmospheric remote sensing requires significant attention to the prevention of artificial polarization induced by the optical elements. Surface, coatings, and angles of incidence throughout the system must be carefully designed in order to minimize these artifacts because the remaining instrumental bias polarization is the main factor which drives the final polarimetric accuracy of the system. In this work, we present a detailed evaluation and analysis to explore the possibility of retrieving the initial polarization state of the light traveling through a generic system that has inherent instrumental polarization. Our case is a wide FOV lens and a splitter device. In particular, we chose as splitter device a Philips-type prism, because it is able to divide the signal in 3 independent channels that could be simultaneously analyze to retrieve the three first elements of the Stoke vector (in atmospheric applications the elliptical polarization can be neglected [1]). The Philips-type configuration is a versatile, compact and robust prism device that is typically used in three color camera systems. It has been used in some commercial polarimetric cameras which do not claim high accuracy polarization measurements [2]. With this work, we address the accuracy of our polarization inversion and measurements made with the Philips-type beam divider.

  19. Performance characteristics of 3D GSO PET/CT scanner (Philips GEMINI PET/CT)

    International Nuclear Information System (INIS)

    Kim, Jin Su; Lee, Jae Sung; Lee, Byeong Il; Lee, Dong Soo; Chung, June Key; Lee, Myung Chul

    2004-01-01

    Philips GEMINI is a newly introduced whole-body GSO PET/CT scanner. In this study, performance of the scanner including spatial resolution, sensitivity, scatter fraction, noise equivalent count ratio (NECR) was measured utilizing NEMA NU2-2001 standard protocol and compared with performance of LSO, BGO crystal scanner. GEMINI is composed of the Philips ALLEGRO PET and MX8000 D multi-slice CT scanners. The PET scanner has 28 detector segments which have an array of 29 by 22 GSO crystals (4*6*20 mm), covering axial FOV of 18 cm. PET data to measure spatial resolution, sensitivity, scatter fraction, and NECR were acquired in 3D mode according to the NEMA NU2 protocols (coincidence window: 8 ns, energy window : 409∼664 keV). For the measurement of spatial resolution, images were reconstructed with FBP using ramp filter and an iterative reconstruction algorithm, 3D RAMLA. Data for sensitivity measurement were acquired using NEMA sensitivity phantom filled with F-18 solution and surrounded by 1∼5 aluminum sleeves after we confirmed that dead time loss did not exceed 1%. To measure NECR and scatter fraction, 1110 MBq of F-18 solution was injected into a NEMA scatter phantom with a length of 70 cm and dynamic scan with 20-min frame duration was acquired for 7 half-lives. Oblique sinograms were collapsed into transaxial slices using single slice rebinning method, and true to background (scatter + random) ratio for each slice and frame was estimated. Scatter fraction was determined by averaging the true to background ratio of last 3 frames in which the dead time loss was below 1%. Transverse and axial resolutions at 1 cm radius were (1) 5.3 and 6.5 mm (FBP), (2) 5.1 and 5.9 mm (3D RAMLA). Transverse radial, transverse tangential, and axial resolution at 10 cm were (1) 5.7, 5.7, and 7.0 mm (FBP), (2) 5.4, 5.4, and 6.4 mm (3D RAMLA). Attenuation free values of sensitivity were 3,620 counts/sec/MBq at the center of transaxial FOV and 4,324 counts/sec/MBq at 10 cm offset

  20. The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

    International Nuclear Information System (INIS)

    Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan

    2013-01-01

    Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques

  1. SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-04-01

    The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

  2. Aggregating territories, integrating elites. The Southern Netherlands and the Monarchy of Philip III (1598-1621

    Directory of Open Access Journals (Sweden)

    Alicia ESTEBAN ESTRÍNGANA

    2011-07-01

    Full Text Available Normal 0 21 false false false ES X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabla normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi; mso-fareast-language:EN-US;} This article studies how Philip III managed his royal patronage in the years before the return of the Southern Netherlands into the Spanish sovereignty in 1621 (honours, grants, court offices, military habits. The king tried to assure the success of this return stimulating and satisfying the profits expectancies of the Flemish elites, who could see this return as a positive decision for their interests. The details of the elites integration politics designed and implemented by the Crown to bring back this former patrimonial territory to the Spanish Monarchy demonstrate the practical values of some forms of belonging and some goals of identity adherence, as a service at the Royal Houses or the Catholicism’s defence.

  3. "A good personal scientific relationship": Philip Morris scientists and the Chulabhorn Research Institute, Bangkok.

    Science.gov (United States)

    Mackenzie, Ross; Collin, Jeff

    2008-12-23

    This paper examines the efforts of consultants affiliated with Philip Morris (PM), the world's leading transnational tobacco corporation, to influence scientific research and training in Thailand via the Chulabhorn Research Institute (CRI). A leading Southeast Asian institute for environmental health science, the CRI is headed by Professor Dr. Her Royal Highness Princess Chulabhorn, the daughter of the King of Thailand, and it has assumed international significance via its designation as a World Health Organization (WHO) Collaborating Centre in December 2005. This paper analyses previously confidential tobacco industry documents that were made publicly available following litigation in the United States. PM documents reveal that ostensibly independent overseas scientists, now identified as industry consultants, were able to gain access to the Thai scientific community. Most significantly, PM scientist Roger Walk has established close connections with the CRI. Documents indicate that Walk was able to use such links to influence the study and teaching of environmental toxicology in the institute and to develop relations with key officials and local scientists so as to advance the interests of PM within Thailand and across Asia. While sensitivities surrounding royal patronage of the CRI make public criticism extremely difficult, indications of ongoing involvement by tobacco industry consultants suggest the need for detailed scrutiny of such relationships. The establishment of close links with the CRI advances industry strategies to influence scientific research and debate around tobacco and health, particularly regarding secondhand smoke, to link with academic institutions, and to build relationships with national elites. Such strategies assume particular significance in the national and regional contexts presented here amid the globalisation of the tobacco pandemic. From an international perspective, particular concern is raised by the CRI's recently awarded status

  4. A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta

    OpenAIRE

    Carvalho, Marieta

    2014-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...

  5. Philip McLaren and the Indigenous-Australian Crime Novel

    Directory of Open Access Journals (Sweden)

    Cornelis Martin Renes

    2017-01-01

    Full Text Available This paper locates the postcolonial crime novel as a space for disenfranchised groups to write back to the marginalisation inherent in the process of colonisation, and explores the example of Australia. From its inception in the mid-19th century, Australian crime fiction reflected upon the challenging harshness and otherness of the Australian experience for the free and convict settler, expelled from the metropole. It created a series of popular subgenres derived from the convict narrative proper, while more ‘standard’ modes of crime fiction, popularised in and through British and American crime fiction, were late to develop. Whereas Australian crime fiction has given expression to the white experience of the continent in manifold ways, up until recently it made no room for Indigenous voices – with the exception of the classic Inspector Napoleon Bonaparte series written by the prolific Arthur Upfield in the first half of the 20th century. For the longest time, this absence reflected the dispossession, dispersal and disenfranchisement of the colonised Indigenous peoples at large; there were neither Aboriginal voices nor Aboriginal authors, which made the textual space of the Australian crime novel a discursive terra nullius. This paper will look at the only Indigenous-Australian author to date with a substantial body of work in crime fiction, Philip McLaren, and elucidate how his four crime novels break new ground in Australian crime fiction by embedding themselves within a political framework of Aboriginal resilience and resistance to neo/colonialism. Written as of the 1990s, McLaren’s oeuvre is eclectic in that it does not respond to traditional formats of Australian crime fiction, shifts between generic subtypes and makes incursions into other genres. The paper concludes that McLaren’s oeuvre has not been conceived of as the work of a crime writer per se, but rather that its form and content are deeply informed by the racist violence

  6. "A good personal scientific relationship": Philip Morris scientists and the Chulabhorn Research Institute, Bangkok.

    Directory of Open Access Journals (Sweden)

    Ross Mackenzie

    2008-12-01

    Full Text Available This paper examines the efforts of consultants affiliated with Philip Morris (PM, the world's leading transnational tobacco corporation, to influence scientific research and training in Thailand via the Chulabhorn Research Institute (CRI. A leading Southeast Asian institute for environmental health science, the CRI is headed by Professor Dr. Her Royal Highness Princess Chulabhorn, the daughter of the King of Thailand, and it has assumed international significance via its designation as a World Health Organization (WHO Collaborating Centre in December 2005.This paper analyses previously confidential tobacco industry documents that were made publicly available following litigation in the United States. PM documents reveal that ostensibly independent overseas scientists, now identified as industry consultants, were able to gain access to the Thai scientific community. Most significantly, PM scientist Roger Walk has established close connections with the CRI. Documents indicate that Walk was able to use such links to influence the study and teaching of environmental toxicology in the institute and to develop relations with key officials and local scientists so as to advance the interests of PM within Thailand and across Asia. While sensitivities surrounding royal patronage of the CRI make public criticism extremely difficult, indications of ongoing involvement by tobacco industry consultants suggest the need for detailed scrutiny of such relationships.The establishment of close links with the CRI advances industry strategies to influence scientific research and debate around tobacco and health, particularly regarding secondhand smoke, to link with academic institutions, and to build relationships with national elites. Such strategies assume particular significance in the national and regional contexts presented here amid the globalisation of the tobacco pandemic. From an international perspective, particular concern is raised by the CRI's recently

  7. Validation of a Piezoelectric Sensor Array-Based Device for Measurement of Carotid-Femoral Pulse Wave Velocity: The Philips Prototype.

    Science.gov (United States)

    Xu, Shao-Kun; Hong, Xiang-Fei; Cheng, Yi-Bang; Liu, Chang-Yuan; Li, Yan; Yin, Bin; Wang, Ji-Guang

    2018-03-01

    Multiple piezoelectric pressure mechanotransducers topologized into an array might improve efficiency and accuracy in collecting arterial pressure waveforms for measurement of pulse wave velocity (PWV). In the present study, we validated a piezoelectric sensor array-based prototype (Philips) against the validated and clinically widely used Complior device (Alam Medical). We recruited 33 subjects with a wide distribution of PWV. For the validation, PWV was measured sequentially with the Complior device (four times) and the Philips prototype (three times). With the 99 paired PWV values, we investigated the agreement between the Philips prototype and the Complior device using Pearson correlation analysis and Bland-Altman plot. We also performed analysis on the determinants and reproducibility of PWV measured with both devices. The correlation coefficient for PWV measured with the two devices was 0.92 ( p prototype slightly overestimated PWV by 0.24 (± 2 standard deviations, ± 1.91) m/s, especially when PWV was high. The correlation coefficient between the difference and the average of the Philips and Complior measurements was 0.21 ( p = 0.035). Nonetheless, they had similar determinants. Age, mean arterial pressure, and sex altogether explained 81.6 and 83.9% of the variance of PWV values measured with the Philips prototype and Complior device, respectively. When the two extremes of the three PWV values measured with the Philips prototype and the Complior device were investigated, the coefficients of variation were 8.26 and 3.26%, respectively. Compared with the Complior device, the Philips prototype had similar accuracy, determinants, and reproducibility in measuring PWV.

  8. Philip Finkelpearl. Court and Country in the Plays of Fletcher and Beaumont Princeton: Princeton UP, 1990 Philip Finkelpearl. Court and Country in the Plays of Fletcher and Beaumont Princeton: Princeton UP, 1990

    Directory of Open Access Journals (Sweden)

    Craig Bernthal

    2008-04-01

    Full Text Available Este livro apresenta as mais recentes e talvez definitivo sobre uma parcela Philip Finkelpearl argumento foi fazendo desde 1971: que as peças de Beaumont e Flecher "não são sinais de Jacobean a decadência do teatro ", mas sim "tem que comentar as decadência da idade ". Finkelpearl produto lucidamente em uma forma empírica para provar seu ponto, apresentando-se como muitos "Teimosa factos", como ele pode mestre em apoio do seu argumento, que analisa: "os colaboradores família origens, o seu posicionamento social, seus amigos ligações, as influências das suas peças e, acima de todas as provas dos jogos propriamente ditos. Este livro apresenta as mais recentes e talvez definitivo sobre uma parcela Philip Finkelpearl argumento foi fazendo desde 1971: que as peças de Beaumont e Flecher "não são sinais de Jacobean a decadência do teatro ", mas sim "tem que comentar as decadência da idade ". Finkelpearl produto lucidamente em uma forma empírica para provar seu ponto, apresentando-se como muitos "Teimosa factos", como ele pode mestre em apoio do seu argumento, que analisa: "os colaboradores família origens, o seu posicionamento social, seus amigos ligações, as influências das suas peças e, acima de todas as provas dos jogos propriamente ditos.

  9. When Harry met Zuckerman: self-reflexivity and metafiction in Philip Roth and Woody Allen When Harry met Zuckerman:self-reflexivity and metafiction in Philip Roth and Woody Allen

    Directory of Open Access Journals (Sweden)

    Thomás Creus

    2008-04-01

    Full Text Available The objective of this essay is to compare the works of novelist Philip Roth and film-maker Woody Allen in what regards their treatment of the highly complex theme of the interrelations between fiction and reality. A comparative analysis of selected Roth’s novels and Allen’s films evinces their recurrent preoccupation with the creation of art and its implications, be it through the choice of writers or artists as main characters, be it through plots that mix real facts with invented ones and imaginary characters with real ones, be it through the use of autobiographical elements in a fictional discourse—all metafictional devices that call attention to the artist’s own process of creation. The objective of this essay is to compare the works of novelist Philip Roth and film-maker Woody Allen in what regards their treatment of the highly complex theme of the interrelations between fiction and reality. A comparative analysis of selected Roth’s novels and Allen’s films evinces their recurrent preoccupation with the creation of art and its implications, be it through the choice of writers or artists as main characters, be it through plots that mix real facts with invented ones and imaginary characters with real ones, be it through the use of autobiographical elements in a fictional discourse—all metafictional devices that call attention to the artist’s own process of creation.

  10. Katherine Philips, Aphra Behn, and Sylvia Plath: “a passionate journey” towards “a revolution in female manners”

    Directory of Open Access Journals (Sweden)

    Giada Cacciavilni

    2010-06-01

    Full Text Available Katherine Philips, Aphra Behn, and Sylvia Plath were artists who struggled during their lives to express their thoughts and ideas. In addition to this, being women, they found it hard to be recognised as writers and their fight against social conventions and norms is now considered of huge importance since they managed to open doors for women that came after them. Katherine Philips started a feminine revolution which was taken over by Aphra Behn, and by Sylvia Plath about three centuries later. The three authors rebelled against the feminine mystique of their time and the subsequent domestification of women. In addition to this, they refused to be men’s shadows and raised a new awareness of women as active subjects that could finally use their voices to express themselves. The aim of this essay is to explore and interpret the ways in which these three women managed to subvert the prescribed role that society had in store for them by touching on different topics related to gender and the relationship between men and women. I will focus on their outlook on marriage and on women’s roles in society.

  11. A comparison between Philips and Tomtec for left ventricular deformation and volume measurements in neonatal intensive care patients.

    Science.gov (United States)

    de Waal, Koert; Phad, Nilkant

    2018-03-01

    Two-dimensional speckle tracking echocardiography is an emerging technique for analyzing cardiac function in newborns. Strain is a highly reliable and reproducible parameter, and reference values have been established for term and preterm newborns. Its implementation into clinical practice has been slow, partly due to lack of inter-vendor consistency. Our aim was to compare recent versions of Philips and Tomtec speckle tracking software for deformation and semiautomated volume and area measurements in neonatal intensive care patients. Longitudinal and circumferential deformation and cavity dimensions (volume, area) were determined off line from apical and short-axis images in 50 consecutive newborns with a median birthweight of 760 g (range 460-3200 g). Absolute mean endocardial global longitudinal strain measurements were similar between vendors, but with wide limits of agreement (Philips -18.9 [2.1]%, Tomtec -18.6 [2.5]%, bias -0.3 [1.7]%, and limits of agreement -3.6%-3.1%). Longitudinal strain rate and circumferential measurements showed poor correlation. All volume and area measurements correlated well between the vendors, but with significant bias. Global longitudinal strain measurements compared well between vendors but wide limits of agreement, suggesting that longitudinal measurements are preferred using similar hardware and software. © 2017, Wiley Periodicals, Inc.

  12. The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

    Directory of Open Access Journals (Sweden)

    John M Morrison

    2012-03-01

    Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.

  13. Identification of new proton-rich rare earth nuclei by means of the coupled system helium jet-isotope separator of SARA

    International Nuclear Information System (INIS)

    Ollivier, T.

    1986-01-01

    In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr

  14. Análise SWOT global da exploração dos suínos da raça Bísara

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...

  15. The Living Tomorrow Project: how Philip Morris has used a Belgian tourist attraction to promote ventilation approaches to the control of second hand smoke

    Science.gov (United States)

    Pilkington, P; Gilmore, A

    2004-01-01

    Study objective: To examine the involvement of Philip Morris in Living Tomorrow 2 and determine the rationale behind its involvement. Design: Research was conducted through a web based search of internal tobacco industry documents made publicly available through litigation. Main results: For approximately €1 000 000 Philip Morris (now Altria) became a co-initiator of Living Tomorrow 2, a tourist complex in Belgium that aims to demonstrate how we will be living in the future. In addition to promoting the company and its grocery products, Philip Morris is using the complex and its website to promote ventilation as a means of accommodating smokers and non-smokers in the indoor environment. Particular emphasis was placed on the bar and restaurant areas. Despite the rationale for its involvement, Philip Morris fails to acknowledge its role as a cigarette manufacturer. As a form of corporate sponsorship Philip Morris thought its involvement could evade any European tobacco advertising ban. Conclusions: Philip Morris is using a tourist attraction to promote its views on control of second hand smoke (SHS) and accommodation of smokers and non-smokers in the indoor environment. However, ventilation does not deal with the health effects of SHS. Policymakers must be cognisant of the devious tactics the industry employs to promote its own agenda, especially in relation to indoor air quality and smoking in public places. Tobacco control legislation should be continually modified and strengthened in response to the changing activities of the tobacco industry as it strives to evade existing legislation and deter the advent of new legislation. PMID:15564621

  16. Fast and slow neutrons in an 18-MV photon beam from a Philips SL/75-20 linear accelerator

    International Nuclear Information System (INIS)

    Gur, D.; Rosen, J.C.; Bukovitz, A.G.; Gill, A.W.

    1978-01-01

    Fast- and slow-neutron contamination in an 18-MV photon beam from a Philips SL/75-20 linear accelerator has been measured. Aluminum and indium foils were activated to determine fast- and slow-neutron fluence, which were largely independent of field sizes. Measured fast-neutron fluences were typically 13.9 x 10 4 and 4.4 x 10 4 neutrons/cm 2 /rad of x ray inside and 5 cm outside the field, respectively. Slow-neutron fluences, 1.3 x 10 4 neutrons/cm 2 /rad of x ray, remained relatively constant inside and outside the field. The reported results are about three times higher than neutron fluences recently reported with a betatron operated at the same energy

  17. O PROJETO NATURALISTA DE DAVID HUME À LUZ DA EPISTEMOLOGIA CONTEMPORÂNEA: WILLARD QUINE E PHILIP KITCHER

    Directory of Open Access Journals (Sweden)

    Claudiney José de Sousa

    2017-06-01

    Full Text Available A partir de comparações entre a epistemologia de Hume e os trabalhos de naturalistas contemporâneos, como Willard O. Quine e Philip Kitcher, procuraremos destacar, neste artigo, em que sentido seria possível identificar a revolução epistemológica empreendida por Hume, em seu estudo da natureza humana, como uma espécie de naturalismo, que anteciparia as discussões recentes do tema. A partir dessas discussões, acreditamos poder apresentar mais claramente a sugestão de que, embora Hume não defenda explicitamente este modo de conceber a empresa filosófica, seu projeto filosófico pode, em alguma medida, ser encarado como um programa naturalista, que antecede e inspira o que hoje conhecemos como naturalismo epistemológico.

  18. System upgrade on Philips Allura FD20 angiography systems: effects on patient skin dose and static image quality

    International Nuclear Information System (INIS)

    Ryckx, Nick; Sans-Merce, Marta; Meuli, Reto; Zerlauth, Jean-Baptiste; Verdun, Francis R.

    2016-01-01

    Fluoroscopically guided procedures might be highly irradiating for patients, possibly leading to skin injuries. In such a context, every effort should be done to lower patient exposure as much as possible. Moreover, patient dose reduction does not only benefit to the patient but also allows reducing staff exposure. In this framework, Philips Healthcare recently introduced a system upgrade for their angiography units, called 'AlluraClarity'. The authors performed air kerma rate measurements for all available fluoroscopy modes and air kerma per frame measurements for the digital subtraction angiography protocols, along with subjective spatial resolution and low-contrast detectability assessments using a standard QA phantom. Air kerma reductions ranging from 25.5 to 84.4 % were found, with no significant change in image quality when switching from a standard operating mode to an upgraded version. These results are confirmed by the comparison of actual patient exposures for similar procedures. (authors)

  19. SU-F-T-94: Plan2pdf - a Software Tool for Automatic Plan Report for Philips Pinnacle TPS

    Energy Technology Data Exchange (ETDEWEB)

    Wu, C [Sutter Medical Foundation, Roseville, CA (United States)

    2016-06-15

    Purpose: To implement an automatic electronic PDF plan reporting tool for Philips Pinnacle treatment planning system (TPS) Methods: An electronic treatment plan reporting software is developed by us to enable fully automatic PDF report from Pinnacle TPS to external EMR programs such as MOSAIQ. The tool is named “plan2pdf”. plan2pdf is implemented using Pinnacle scripts, Java and UNIX shell scripts, without any external program needed. plan2pdf supports full auto-mode and manual mode reporting. In full auto-mode, with a single mouse click, plan2pdf will generate a detailed Pinnacle plan report in PDF format, which includes customizable cover page, Pinnacle plan summary, orthogonal views through each plan POI and maximum dose point, DRR for each beam, serial transverse views captured throughout the dose grid at a user specified interval, DVH and scorecard windows. The final PDF report is also automatically bookmarked for each section above for convenient plan review. The final PDF report can either be saved on a user specified folder on Pinnacle, or it can be automatically exported to an EMR import folder via a user configured FTP service. In manual capture mode, plan2pdf allows users to capture any Pinnacle plan by full screen, individual window or rectangular ROI drawn on screen. Furthermore, to avoid possible patients’ plan mix-up during auto-mode reporting, a user conflict check feature is included in plan2pdf: it prompts user to wait if another patient is being exported by plan2pdf by another user. Results: plan2pdf is tested extensively and successfully at our institution consists of 5 centers, 15 dosimetrists and 10 physicists, running Pinnacle version 9.10 on Enterprise servers. Conclusion: plan2pdf provides a highly efficient, user friendly and clinical proven platform for all Philips Pinnacle users, to generate a detailed plan report in PDF format for external EMR systems.

  20. SU-F-T-94: Plan2pdf - a Software Tool for Automatic Plan Report for Philips Pinnacle TPS

    International Nuclear Information System (INIS)

    Wu, C

    2016-01-01

    Purpose: To implement an automatic electronic PDF plan reporting tool for Philips Pinnacle treatment planning system (TPS) Methods: An electronic treatment plan reporting software is developed by us to enable fully automatic PDF report from Pinnacle TPS to external EMR programs such as MOSAIQ. The tool is named “plan2pdf”. plan2pdf is implemented using Pinnacle scripts, Java and UNIX shell scripts, without any external program needed. plan2pdf supports full auto-mode and manual mode reporting. In full auto-mode, with a single mouse click, plan2pdf will generate a detailed Pinnacle plan report in PDF format, which includes customizable cover page, Pinnacle plan summary, orthogonal views through each plan POI and maximum dose point, DRR for each beam, serial transverse views captured throughout the dose grid at a user specified interval, DVH and scorecard windows. The final PDF report is also automatically bookmarked for each section above for convenient plan review. The final PDF report can either be saved on a user specified folder on Pinnacle, or it can be automatically exported to an EMR import folder via a user configured FTP service. In manual capture mode, plan2pdf allows users to capture any Pinnacle plan by full screen, individual window or rectangular ROI drawn on screen. Furthermore, to avoid possible patients’ plan mix-up during auto-mode reporting, a user conflict check feature is included in plan2pdf: it prompts user to wait if another patient is being exported by plan2pdf by another user. Results: plan2pdf is tested extensively and successfully at our institution consists of 5 centers, 15 dosimetrists and 10 physicists, running Pinnacle version 9.10 on Enterprise servers. Conclusion: plan2pdf provides a highly efficient, user friendly and clinical proven platform for all Philips Pinnacle users, to generate a detailed plan report in PDF format for external EMR systems.

  1. The Character as Text in Philip Massinger’s A New Way to Pay Old Debts Le Personnage comme texte dans A New Way to Pay Old Debts de Philip Massinger

    Directory of Open Access Journals (Sweden)

    Wendy Ribeyrol

    2009-06-01

    Full Text Available Dans A New Way to Pay Old Debts de Philip Massinger la réputation est perçue comme une feuille blanche sur laquelle le personnage doit écrire le récit de sa vie. L’idée de la vie d’un homme comme livre ou comme feuille de papier est fort ancienne, elle figure aussi bien dans la Bible que dans les livres d’emblèmes des XVIe et XVIIe siècles. Au moment de la mort, l’homme laisse ainsi à la postérité un texte édifiant dont il aura été l’auteur (auctor. Cet article démontre  qu’il faut néanmoins faire une distinction entre l’homme, qui prend plume et rédige son propre texte, et la femme qui doit attendre passivement qu’un autre compose le sien.

  2. Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973

    Directory of Open Access Journals (Sweden)

    Guillermina Feudal

    2017-12-01

    Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.

  3. Through tobacco industry eyes: civil society and the FCTC process from Philip Morris and British American Tobacco's perspectives.

    Science.gov (United States)

    Gonzalez, Mariaelena; Green, Lawrence W; Glantz, Stanton A

    2012-07-01

    To analyse the models Philip Morris (PM) and British American Tobacco (BAT) used internally to understand tobacco control non-governmental organizations (NGOs) and their relationship to the global tobacco control policy-making process that resulted in the Framework Convention for Tobacco Control (FCTC). Analysis of internal tobacco industry documents in the Legacy Tobacco Document Library. PM contracted with Mongoven, Biscoe, and Duchin, Inc. (MBD, a consulting firm specialising in NGO surveillance) as advisors. MBD argued that because NGOs are increasingly linked to epistemic communities, NGOs could insert themselves into the global policy-making process and influence the discourse surrounding the treaty-making process. MBD advised PM to insert itself into the policy-making process, mimicking NGO behaviour. BAT's Consumer and Regulatory Affairs (CORA) department argued that global regulation emerged from the perception (by NGOs and governments) that the industry could not regulate itself, leading to BAT advocating social alignment and self-regulation to minimise the impact of the FCTC. Most efforts to block or redirect the FCTC failed. PM and BAT articulated a global policy-making environment in which NGOs are key, non-state stakeholders, and as a result, internationalised some of their previous national-level strategies. After both companies failed to prevent the FCTC, their strategies began to align. Multinational corporations have continued to successfully employ some of the strategies outlined in this paper at the local and national level while being formally excluded from ongoing FCTC negotiations at the global level.

  4. Corporate Image and Public Health: An Analysis of the Philip Morris, Kraft, and Nestlé Websites

    Science.gov (United States)

    SMITH, ELIZABETH

    2012-01-01

    Companies need to maintain a good reputation to do business; however, companies in the infant formula, tobacco, and processed food industries have been identified as promoting disease. Such companies use their websites as a means of promulgating a positive public image, thereby potentially reducing the effectiveness of public health campaigns against the problems they perpetuate. The author examined documents from the websites of Philip Morris, Kraft, and Nestlé for issue framing and analyzed them using Benoit’s typology of corporate image repair strategies. All three companies defined the problems they were addressing strategically, minimizing their own responsibility and the consequences of their actions. They proposed solutions that were actions to be taken by others. They also associated themselves with public health organizations. Health advocates should recognize industry attempts to use relationships with health organizations as strategic image repair and reject industry efforts to position themselves as stakeholders in public health problems. Denormalizing industries that are disease vectors, not just their products, may be critical in realizing positive change. PMID:22420639

  5. The utility of the Philips SRI-100 real time portal imaging device in a case of postoperative irradiation for prevention of heterotopic bone formation following total hip replacement

    International Nuclear Information System (INIS)

    Kiffer, J.D.; Quong, G.; Lawlor, M.; Schumer, W.; Aitken, L.; Wallace, A.

    1994-01-01

    The new Radiation Oncology Department at the Heidelberg Repatriation Hospital in Melbourne, Australia commenced operation in June 1992. As part of quality control the Philips SL-15 linear accelerator was fitted with the Philips SRI-100 Real Time Portal Imaging Device (RTPID), the first such apparatus in Australia. One of its major advantages over older systems is its ability to provide a permanent hard copy of the image of the field treated. The computer image can be immediately manipulated and enhanced on the screen (with respect to such qualities as brightness and contrast) prior to the printing of the hard copy. This is a significant improvement over the more cumbersome older port films that required developing time, without any pre-assessment of the image quality. The utility of the Philips SRI-100 RTPID is demonstrated in the case of a patient irradiated soon after total hip replacement, as prophylaxis against heterotopic bone formation (HBF). The rapidity and quality of image production is a major advantage in these patients where post operative pain may result in positional change between film exposure and image production. Extremely accurate shielding block position is essential to shield the prosthesis(and allow bone ingrowth for fixation) whilst avoiding inadvertent shielding of the areas at risk for HBF. A review of the literature on this topic is provided. 14 refs., 4 figs

  6. Through tobacco industry eyes: civil society and the FCTC process from Philip Morris and British American Tobacco’s perspectives

    Science.gov (United States)

    Gonzalez, Mariaelena; Green, Lawrence W; Glantz, Stanton A

    2011-01-01

    Objective To analyse the models Philip Morris (PM) and British American Tobacco (BAT) used internally to understand tobacco control non-governmental organizations (NGOs) and their relationship to the global tobacco control policy-making process that resulted in the Framework Convention for Tobacco Control (FCTC). Methods Analysis of internal tobacco industry documents in the Legacy Tobacco Document Library. Results PM contracted with Mongoven, Biscoe, and Duchin, Inc. (MBD, a consulting firm specialising in NGO surveillance) as advisors. MBD argued that because NGOs are increasingly linked to epistemic communities, NGOs could insert themselves into the global policy-making process and influence the discourse surrounding the treaty-making process. MBD advised PM to insert itself into the policy-making process, mimicking NGO behaviour. BAT’s Consumer and Regulatory Affairs (CORA) department argued that global regulation emerged from the perception (by NGOs and governments) that the industry could not regulate itself, leading to BAT advocating social alignment and self-regulation to minimise the impact of the FCTC. Most efforts to block or redirect the FCTC failed. Conclusions PM and BAT articulated a global policy-making environment in which NGOs are key, non-state stakeholders, and as a result, internationalised some of their previous national-level strategies. After both companies failed to prevent the FCTC, their strategies began to align. Multinational corporations have continued to successfully employ some of the strategies outlined in this paper at the local and national level while being formally excluded from ongoing FCTC negotiations at the global level. PMID:21636611

  7. A practical method to standardise and optimise the Philips DoseRight 2.0 CT automatic exposure control system.

    Science.gov (United States)

    Wood, T J; Moore, C S; Stephens, A; Saunderson, J R; Beavis, A W

    2015-09-01

    Given the increasing use of computed tomography (CT) in the UK over the last 30 years, it is essential to ensure that all imaging protocols are optimised to keep radiation doses as low as reasonably practicable, consistent with the intended clinical task. However, the complexity of modern CT equipment can make this task difficult to achieve in practice. Recent results of local patient dose audits have shown discrepancies between two Philips CT scanners that use the DoseRight 2.0 automatic exposure control (AEC) system in the 'automatic' mode of operation. The use of this system can result in drifting dose and image quality performance over time as it is designed to evolve based on operator technique. The purpose of this study was to develop a practical technique for configuring examination protocols on four CT scanners that use the DoseRight 2.0 AEC system in the 'manual' mode of operation. This method used a uniform phantom to generate reference images which form the basis for how the AEC system calculates exposure factors for any given patient. The results of this study have demonstrated excellent agreement in the configuration of the CT scanners in terms of average patient dose and image quality when using this technique. This work highlights the importance of CT protocol harmonisation in a modern Radiology department to ensure both consistent image quality and radiation dose. Following this study, the average radiation dose for a range of CT examinations has been reduced without any negative impact on clinical image quality.

  8. Turning free speech into corporate speech: Philip Morris' efforts to influence U.S. and European journalists regarding the U.S. EPA report on secondhand smoke.

    Science.gov (United States)

    Muggli, Monique E; Hurt, Richard D; Becker, Lee B

    2004-09-01

    Previously secret internal tobacco company documents show that the tobacco industry launched an extensive multifaceted effort to influence the scientific debate about the harmful effects of secondhand smoke. Integral to the industry's campaign was an effort to derail the Environmental Protection Agency's (EPA) risk assessment on environmental tobacco smoke (ETS) by recruiting a network of journalists to generate news articles supporting the industry's position and pushing its public relations messages regarding the ETS issue. Searches of previously secret internal tobacco industry records were conducted online and at the Minnesota Tobacco Document Depository. In addition, searches on the World Wide Web were conducted for each National Journalism Center alumnus. Lexis-Nexis was used to locate news stories written by the journalists cited in this paper. Philip Morris turned to its public relations firm Burson Marsteller to "build considerable reasonable doubt em leader particularly among consumers" about the "scientific weaknesses" of the EPA report. A Washington, DC, media and political consultant Richard Hines was a key player in carrying out Burson Marsteller's media recommendations of "EPA bashing" for Philip Morris. In March 1993, Philip Morris' vice president of corporate affairs policy and administration reported to Steve Parrish, vice president and general counsel of Philip Morris, that their consultant was "responsible for a number of articles that have appeared in em leader major news publications regarding EPA and ETS." In addition to placing favorable stories in the press through its consultant, Philip Morris sought to expand its journalist network by financially supporting a U.S. school of journalism; the National Journalism Center (NJC). Philip Morris gleaned "about 15 years worth of journalists at print and visual media throughout the country em leader to get across [its] side of the story" resulting in "numerous pieces consistent with our point of

  9. Philip A. Parilla | NREL

    Science.gov (United States)

    materials," Appl. Phys. A: Mater. Sci. Process. 122, 1-18 (2016), DOI: 10.1007/s00339-016-9654-1. K.E ), DOI: 10.1007/s00339-015-9537-x. B.R. Ortiz, C.M. Crawford, R.W. McKinney, P.A. Parilla, and E.S

  10. Sharing AIS Related Anomalies (SARA)

    Science.gov (United States)

    2016-03-01

    78 6.3.7 SQL Versus NoSQL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 6.4 Data Processing...43 6.1 Overview of SQL and NoSQL differences, from [56]. . . . . . . . . . . . . . . . . . 82 A.1 Description of the ship anomaly upload use...constraints must be considered. These requirements, however, can only be defined when lower level implementation decisions, such as SQL versus NoSQL

  11. Severe accident recriticality analyses (SARA)

    DEFF Research Database (Denmark)

    Frid, W.; Højerup, C.F.; Lindholm, I.

    2001-01-01

    with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality-both super-prompt power bursts and quasi steady-state power......Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies......, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g(-1), was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s(-1). In most cases, however, the predicted energy deposition was smaller, below...

  12. Quentin Skinner, Staten og friheten. Oslo: Res Publica, 2011. José Luis Martí and Philip Pettit, A Political Philosophy in Public Life. Civic Republicanism in Zapatero's Spain. Princeton: Princeton University Press, 2010 (Simon Laumann Jørgensen)

    DEFF Research Database (Denmark)

    Jørgensen, Simon Laumann

    2012-01-01

    Anmeldelse af Quentin Skinner, Staten og friheten, Oslo: Res Publica 2011, 199 NOK & José Luis Martí & Philip Pettit, A Political Philosophy in Public Life. Civic Republicanism in Zapatero’s Spain, Princeton: Princeton University Press 2010, $ 24.95......Anmeldelse af Quentin Skinner, Staten og friheten, Oslo: Res Publica 2011, 199 NOK & José Luis Martí & Philip Pettit, A Political Philosophy in Public Life. Civic Republicanism in Zapatero’s Spain, Princeton: Princeton University Press 2010, $ 24.95...

  13. Notas sobre Feral y las cigüeñas, de Fernando Alonso, y la "Historia del califa cigüeña" (Wilhelm Hauff, Sara Cone Bryant

    Directory of Open Access Journals (Sweden)

    Hans Christian Hagedorn

    2011-01-01

    Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.

  14. Aplikasi Metode Lean Six Sigma Untuk Usulan Improvisasi Lini Produksi Dengan Mempertimbangkan Faktor Lingkungan. Studi Kasus: Departemen GLS (General Lighting Services PT. Philips Lighting Surabaya

    Directory of Open Access Journals (Sweden)

    Miftachul Arifin

    2012-09-01

    Full Text Available Departemen GLS (General Lighting Services PT. Philips Lighting Surabaya merupakan produsen lampu pijar. Pada pelaksanaan proses produksinya, perusahaan menemui beberapa kendala yang terkait dengan waste. Analisis lean six sigma dengan menggunakan value stream mapping menunjukkan terjadi defect di mesin finishing dan waiting di mesin mounting. EHS waste juga muncul yang mengindikasikan adanya dampak terhadap lingkungan dan kesehatan serta keselamatan pekerja. Pencarian akar permasalahan dilakukan dengan menggunakan tools RCA (5 whys dan FMEA hingga memunculkan 15 penyebab utama terjadinya ketiga waste tersebut. Pembentukan tim Total productive maintenance, penelitian perbaikan kualitas bulb dan flare, serta eksperimen pengurangan jumlah jenis coil menjadi usulan alternatif yang bisa dilakukan perusahaan. Dengan menggunakan konsep value management didapatkan alternatif terbaik dengan melakukan pembentukan dan pelatihan tim Total productive maintenance. Alternatif ini meningkatkan nilai sigma defect dari 2,92 menjadi 3,08 dan sigma waiting dari 2,83 menjadi 2,89. Indikator dampak lingkungan juga mengindikasikan penurunan yang sejalan.

  15. Two Millian Arguments: Using Helen Longino’s Approach to Solve the Problems Philip Kitcher Targeted with His Argument on Freedom of Inquiry

    Directory of Open Access Journals (Sweden)

    Jaana Eigi

    2012-12-01

    Full Text Available Philip Kitcher argued that the freedom to pursue one's version of the good life is the main aim of Mill's argument for freedom of expression. According to Kitcher, in certain scientific fields, political and epistemological asymmetries bias research toward conclusions that threaten this most important freedom of underprivileged groups. Accordingly, Kitcher claimed that there are Millian grounds for limiting freedom of inquiry in these fields to protect the freedom of the underprivileged.I explore Kitcher's argument in light of the interpretation Helen Longino gave to Mill's argument. She argued that free critical dialogue in the community allows bias to be overcome, through intersubjective criticism of hypotheses and the background assumptions that frame them.I suggest that Longino's approach allows for the identification of the fundamental problems of the research programs Kitcher targeted, and for the rejection of their claims to knowledge. Thus it is possible to address Kitcher's problem without limiting freedom of speech.

  16. Comparative study of reconstruction filters for cranio examinations of the Philips system and its influence on the quality of the tomographic image

    International Nuclear Information System (INIS)

    Silveira, V.C.; Kodlulovich, S.; Delduck, R.S.; Oliveira, L.C.G.

    2011-01-01

    The aim of this study was to evaluate different reconstruction algorithm (kernels) applied for head examinations. The research was carried out using 40-slice MDCT (Philips, Brilliance 40 CT scanner) and an ACR Phantoms to evaluate the image quality. The doses were estimated applying the coefficients obtained by IMPACT .The study showed that independently of the filter used the values of CT number have no change. The low contrast showed that the choice of correct filter might result a decrease of 9% of doses values. For special resolution, the sharp filter showed a better response for low m As. The noise value of image to certain filters smooth has no changed, even by reducing the m As values. (author)

  17. Apropiación y alienación: consideraciones hermenéutico-existenciales a propósito de la Pastoral americana de Philip Roth

    Directory of Open Access Journals (Sweden)

    Germán Darío Vélez López

    2013-01-01

    Full Text Available Partiendo de una formulación básica de algunos elementos relevantes de la hermenéutica fenomenológica de Heidegger, el presente artículo propone una lectura de la obra del escritor norteamericano Philip Roth titulada Pastoral americana, que lo hizo acreedor al premio Pulitzer en 1989. El propósito cen- tral de esa lectura consiste en mostrar de qué manera fenómenos existenciales elementales como estar-lejos (Wegsein, estar-despierto (Wachsein, estar-ahí (Dasein permiten una articulación propia del sentido de la obra de Roth en la que ésta manifiesta su particular compromiso existencial.

  18. SU-E-T-596: P3DVHStats - a Novel, Automatic, Institution Customizable Program to Compute and Report DVH Quantities On Philips Pinnacle TPS

    International Nuclear Information System (INIS)

    Wu, C

    2015-01-01

    Purpose: To implement a novel, automatic, institutional customizable DVH quantities evaluation and PDF report tool on Philips Pinnacle treatment planning system (TPS) Methods: An add-on program (P3DVHStats) is developed by us to enable automatic DVH quantities evaluation (including both volume and dose based quantities, such as V98, V100, D2), and automatic PDF format report generation, for EMR convenience. The implementation is based on a combination of Philips Pinnacle scripting tool and Java language pre-installed on each Pinnacle Sun Solaris workstation. A single Pinnacle script provide user a convenient access to the program when needed. The activated script will first export DVH data for user selected ROIs from current Pinnacle plan trial; a Java program then provides a simple GUI interface, utilizes the data to compute any user requested DVH quantities, compare with preset institutional DVH planning goals; if accepted by users, the program will also generate a PDF report of the results and export it from Pinnacle to EMR import folder via FTP. Results: The program was tested thoroughly and has been released for clinical use at our institution (Pinnacle Enterprise server with both thin clients and P3PC access), for all dosimetry and physics staff, with excellent feedback. It used to take a few minutes to use MS-Excel worksheet to calculate these DVH quantities for IMRT/VMAT plans, and manually save them as PDF report; with the new program, it literally takes a few mouse clicks in less than 30 seconds to complete the same tasks. Conclusion: A Pinnacle scripting and Java language based program is successfully implemented, customized to our institutional needs. It is shown to dramatically reduce time and effort needed for DVH quantities computing and EMR reporting

  19. Comparison of different tube-of-response (TOR) models for resolution recovery in PET image reconstruction for the Philips Ingenuity TF PET/MR

    Energy Technology Data Exchange (ETDEWEB)

    Lougovski, Alexandr; Hofheinz, Frank; Van Den Hoff, Jorg [Helmholtz-Center Dresden-Rossendorf, Institute of Radiopharmaceutical Cancer Research, PET Center, Dresden (Germany)

    2015-05-18

    Recently, we have proposed a method for on-the-fly system matrix computation where the tube-of-response (TOR) is approximated as a cylinder with constant density (TORCD) and the cubic voxels are replaced by spheres. We could show that with this model the PET image quality can be notably improved compared to the vendor provided image reconstruction of our Philips Ingenuity-TF PET/MR. In this work we address the question whether image quality can be further improved by using a variable density TOR (TOR-VD). The radial variability of TOR-VD was modelled by a Kaiser-Bessel function. Free parameters of this density model were used to optimize image properties regarding resolution, noise, and Gibbs artifacts. Additional, a TOR-VD model accounting for position dependent effects along the TOR caused by the finite solid angles of the detectors is under investigation. Phantom measurement were performed with a Philips Ingenuity-TF PET/MR scanner. Listmode data were reconstructed using TOR-CD and TORVD, respectively on two different grids with cubic voxel size of 2 mm and 4 mm. Image quality was assessed with resolution-noise curves and investigation of the radial position dependence of the spatial resolution. For 2 mm voxels, TOR-VD consistently yields a slight improvement of the investigated image quality measures compared to TOR-CD. For 4 mm voxels both models lead essentially to the same results. These findings can be understood as a consequence of the relative size of voxel and TOR. For typical whole body studies (4 mm voxel size) a variable TOR does not improve image quality beyond what is achievable with a constant density TOR. For smaller voxel size the image quality can indeed be somewhat improved with a variable TOR but at the expense of drastically increased computation time.

  20. SU-E-T-596: P3DVHStats - a Novel, Automatic, Institution Customizable Program to Compute and Report DVH Quantities On Philips Pinnacle TPS

    Energy Technology Data Exchange (ETDEWEB)

    Wu, C [Sutter Medical Foundation, Roseville, CA (United States)

    2015-06-15

    Purpose: To implement a novel, automatic, institutional customizable DVH quantities evaluation and PDF report tool on Philips Pinnacle treatment planning system (TPS) Methods: An add-on program (P3DVHStats) is developed by us to enable automatic DVH quantities evaluation (including both volume and dose based quantities, such as V98, V100, D2), and automatic PDF format report generation, for EMR convenience. The implementation is based on a combination of Philips Pinnacle scripting tool and Java language pre-installed on each Pinnacle Sun Solaris workstation. A single Pinnacle script provide user a convenient access to the program when needed. The activated script will first export DVH data for user selected ROIs from current Pinnacle plan trial; a Java program then provides a simple GUI interface, utilizes the data to compute any user requested DVH quantities, compare with preset institutional DVH planning goals; if accepted by users, the program will also generate a PDF report of the results and export it from Pinnacle to EMR import folder via FTP. Results: The program was tested thoroughly and has been released for clinical use at our institution (Pinnacle Enterprise server with both thin clients and P3PC access), for all dosimetry and physics staff, with excellent feedback. It used to take a few minutes to use MS-Excel worksheet to calculate these DVH quantities for IMRT/VMAT plans, and manually save them as PDF report; with the new program, it literally takes a few mouse clicks in less than 30 seconds to complete the same tasks. Conclusion: A Pinnacle scripting and Java language based program is successfully implemented, customized to our institutional needs. It is shown to dramatically reduce time and effort needed for DVH quantities computing and EMR reporting.

  1. Comparison of different tube-of-response (TOR) models for resolution recovery in PET image reconstruction for the Philips Ingenuity TF PET/MR

    International Nuclear Information System (INIS)

    Lougovski, Alexandr; Hofheinz, Frank; Van Den Hoff, Jorg

    2015-01-01

    Recently, we have proposed a method for on-the-fly system matrix computation where the tube-of-response (TOR) is approximated as a cylinder with constant density (TORCD) and the cubic voxels are replaced by spheres. We could show that with this model the PET image quality can be notably improved compared to the vendor provided image reconstruction of our Philips Ingenuity-TF PET/MR. In this work we address the question whether image quality can be further improved by using a variable density TOR (TOR-VD). The radial variability of TOR-VD was modelled by a Kaiser-Bessel function. Free parameters of this density model were used to optimize image properties regarding resolution, noise, and Gibbs artifacts. Additional, a TOR-VD model accounting for position dependent effects along the TOR caused by the finite solid angles of the detectors is under investigation. Phantom measurement were performed with a Philips Ingenuity-TF PET/MR scanner. Listmode data were reconstructed using TOR-CD and TORVD, respectively on two different grids with cubic voxel size of 2 mm and 4 mm. Image quality was assessed with resolution-noise curves and investigation of the radial position dependence of the spatial resolution. For 2 mm voxels, TOR-VD consistently yields a slight improvement of the investigated image quality measures compared to TOR-CD. For 4 mm voxels both models lead essentially to the same results. These findings can be understood as a consequence of the relative size of voxel and TOR. For typical whole body studies (4 mm voxel size) a variable TOR does not improve image quality beyond what is achievable with a constant density TOR. For smaller voxel size the image quality can indeed be somewhat improved with a variable TOR but at the expense of drastically increased computation time.

  2. Structurally bound sulfide and sulfate in apatite from the Philips Mine iron oxide - apatite deposit, New York, USA: A tracer of redox changes

    Science.gov (United States)

    Sadove, G.; Konecke, B.; Fiege, A.; Simon, A. C.

    2017-12-01

    Multiple competing hypotheses attempt to explain the genesis of iron oxide-apatite (IOA) ore deposits. Many studies have investigated the chemistry of apatite because the abundances of F and Cl can distinguish magmatic vs. hydrothermal processes. Recent experiments demonstrate that apatite incorporates S6+, S4+, and S2-, and that total sulfur (∑S) as well as the S6+/∑S ratio in apatite vary systematically as a function of oxygen fugacity [1], providing information about sulfur budget and redox. Here, we present results from X-ray absorption near-edge structure (XANES) spectroscopy at the S K-edge, electron microprobe analyses, cathodoluminescence (CL) imaging, and element mapping of apatite from the Philip's Mine IOA deposit, southern Adirondack Mountains, USA. The Philip's Mine apatite contains inclusions of pyrite and pyrrhotite, where the latter includes iron oxide and Ni-rich domains. The apatite also contains inclusions of monazite, and exhibits complex CL zonation coincident with variations in the abundances of REE and S. The presence of monazite fingerprints fluid-mediated dissolution-reprecipitation of originally REE-enriched apatite [2]. The S XANES spectra reveal varying proportions of structurally bound S6+ and S2-, as the S6+/∑S ratio ranges from sulfide-only to sulfate-only. Notably, sulfide-dominated domains contain higher S contents than sulfate-dominated regions. These observations are consistent with co-crystallization of apatite and monosulfide solid solution (MSS) at reducing conditions, followed by decomposition of MSS to pyrrhotite, pyrite and intermediate solid solution (ISS, which is not preserved; [3]). Metasomatism of that assemblage by an oxidized fluid resulted in formation of monazite in apatite and iron oxide domains in pyrrhotite. We conclude that the deposit formed by a H2S-Fe-rich volatile phase, possibly evolved from a rather primitive magmatic source, which is consistent with the low Ti content of magnetite. The deposit was

  3. An examination of the effect on cigarette prices and promotions of Philip Morris USA penalties to stores that sell cigarettes to minors.

    Science.gov (United States)

    Feighery, E C; Schleicher, N C; Ribisl, K M; Rogers, T

    2009-12-01

    The purpose of this study was to assess the potential impact of public policies to regulate price discounting strategies on retail cigarette prices and advertising. Philip Morris USA (PM USA) has a policy designed to sanction stores violating state laws banning illegal tobacco sales to minors by temporarily suspending price discounting incentives. This study examined the impact of those sanctions on retail cigarette prices and sales promotion advertising. In November 2006, the California Attorney General's Office informed PM USA that 196 stores were found guilty of illegal underage sales. Of these, 109 stores that participated in the PM USA Retail Leaders Program were notified that their merchandising and/or promotional resources would be suspended for the month of April 2007. The remaining 87 stores were not sanctioned and served as a comparison group. Trained raters assessed advertising and prices of selected PM USA brands in these stores pre-penalty and during the penalty phase. There were no significant differences between sanctioned and non-sanctioned stores on median changes in price and sales promotion advertising from the pre-penalty to the penalty phase. The lack of impact on cigarette prices and advertising indicate that the PM USA policy may be flawed in its design or execution. If public policies are developed to restrain cigarette price discounting strategies, they should be crafted to ensure compliance and preclude possible compensatory actions by retailers.

  4. Comparative study of reconstruction filters for cranio examinations of the Philips system and its influence on the quality of the tomographic image; Estudo comparativo dos filtros de reconstrucao para exames de cranio do sistema Philips e sua influencia na qualidade da imagem tomografica

    Energy Technology Data Exchange (ETDEWEB)

    Silveira, V.C.; Kodlulovich, S.; Delduck, R.S., E-mail: simone@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil); Oliveira, L.C.G. [Universidade Federal do Rio de Janeiro (CT/UFRJ), RJ (Brazil). Centro de Tecnologia

    2011-07-01

    The aim of this study was to evaluate different reconstruction algorithm (kernels) applied for head examinations. The research was carried out using 40-slice MDCT (Philips, Brilliance 40 CT scanner) and an ACR Phantoms to evaluate the image quality. The doses were estimated applying the coefficients obtained by IMPACT .The study showed that independently of the filter used the values of CT number have no change. The low contrast showed that the choice of correct filter might result a decrease of 9% of doses values. For special resolution, the sharp filter showed a better response for low m As. The noise value of image to certain filters smooth has no changed, even by reducing the m As values. (author)

  5. Modelos de Composição e Percepção de Xenakis: Concret PH e o Pavilhão Philips

    Directory of Open Access Journals (Sweden)

    Danilo Rossetti

    2012-05-01

    Full Text Available Este artigo aborda os modelos de composição e percepção de Xenakis. Segundo o próprio compositor, seu modelo de composição é baseado em distintas formalizações iniciais (estruturas fora-do-tempo, cujo objetivo é gerar dados musicais (estruturas no-tempo, tendo muitas vezes como referência o novo paradigma da ciência moderna do século XX. Por outro lado, a questão da sensibilidade musical é abordada por Xenakis a partir de um viés fundamentado na fenomenologia. Para ilustrar esta dualidade em seu processo criativo, abordaremos analiticamente o processo composicional de sua obra eletroacústica Concret PH (1958 e sua difusão no interior do Pavilhão Philips, cuja concepção de espacialidade se dá a partir do conceito de “gesto eletrônico”. Para a discussão teórica sobre seu modelo perceptivo, trazemos algumas considerações sobre espaço e tempo originárias de Kant e Merleau-Ponty. Já para a análise de Concret PH, nos reportaremos ao modelo de representação sonora de Gabor e ao conceito de trama de Xenakis, além de análises espectrais.

  6. Currency exposure management within Philips

    NARCIS (Netherlands)

    Ronner, AE; Trappeniers, DAM; Bruni, F; Fair, DE; OBrien, R

    1996-01-01

    It is a major challenge to embed modern financial technology in the continuously changing organisational structure of a multinational company. The processes generating cash flow are to be controlled and proper forecasting models are to be implemented. Based on quarterly rolling forecasts the basic

  7. PM 3655 PHILIPS Logic analyzer

    CERN Multimedia

    A logic analyzer is an electronic instrument that captures and displays multiple signals from a digital system or digital circuit. A logic analyzer may convert the captured data into timing diagrams, protocol decodes, state machine traces, assembly language, or may correlate assembly with source-level software. Logic Analyzers have advanced triggering capabilities, and are useful when a user needs to see the timing relationships between many signals in a digital system.

  8. A validation of carbon fiber imaging couch top modeling in two radiation therapy treatment planning systems: Philips Pinnacle3 and BrainLAB iPlan RT Dose

    International Nuclear Information System (INIS)

    Njeh, Christopher F; Parker, Jason; Spurgin, Joseph; Rhoe, Elizabeth

    2012-01-01

    Carbon fiber (CF) is now the material of choice for radiation therapy couch tops. Initial designs included side metal bars for rigidity; however, with the advent of IGRT, involving on board imaging, new thicker CF couch tops without metal bars have been developed. The new design allows for excellent imaging at the expense of potentially unacceptable dose attenuation and perturbation. We set out to model the BrainLAB imaging couch top (ICT) in Philips Pinnacle 3 treatment planning system (TPS), to validate the already modeled ICT in BrainLAB iPlan RT Dose treatment planning system and to compute the magnitude of the loss in skin sparing. Using CF density of 0.55 g/cm 3 and foam density of 0.03 g/cm 3 , we demonstrated an excellent agreement between measured dose and Pinnacle 3 TPS computed dose using 6 MV beam. The agreement was within 1% for all gantry angle measured except for 120 o , which was 1.8%. The measured and iPlan RT Dose TPS computed dose agreed to within 1% for all gantry angles and field sizes measured except for 100 o where the agreement was 1.4% for 10 cm × 10 cm field size. Predicted attenuation through the couch by iPlan RT Dose TPS (3.4% - 9.5%) and Pinnacle 3 TPS (2% - 6.6%) were within the same magnitude and similar to previously reported in the literature. Pinnacle 3 TPS estimated an 8% to 20% increase in skin dose with increase in field size. With the introduction of the CF couch top, it estimated an increase in skin dose by approximately 46 - 90%. The clinical impact of omitting the couch in treatment planning will be dependent on the beam arrangement, the percentage of the beams intersecting the couch and their angles of incidence. We have successfully modeled the ICT in Pinnacle 3 TPS and validated the modeled ICT in iPlan RT Dose. It is recommended that the ICT be included in treatment planning for all treatments that involve posteriors beams. There is a significant increase in skin dose that is dependent on the percentage of the beam

  9. A validation of carbon fiber imaging couch top modeling in two radiation therapy treatment planning systems: Philips Pinnacle3 and BrainLAB iPlan RT Dose

    Directory of Open Access Journals (Sweden)

    Njeh Christopher F

    2012-11-01

    Full Text Available Abstract Background Carbon fiber (CF is now the material of choice for radiation therapy couch tops. Initial designs included side metal bars for rigidity; however, with the advent of IGRT, involving on board imaging, new thicker CF couch tops without metal bars have been developed. The new design allows for excellent imaging at the expense of potentially unacceptable dose attenuation and perturbation. Objectives We set out to model the BrainLAB imaging couch top (ICT in Philips Pinnacle3 treatment planning system (TPS, to validate the already modeled ICT in BrainLAB iPlan RT Dose treatment planning system and to compute the magnitude of the loss in skin sparing. Results Using CF density of 0.55 g/cm3 and foam density of 0.03 g/cm3, we demonstrated an excellent agreement between measured dose and Pinnacle3 TPS computed dose using 6 MV beam. The agreement was within 1% for all gantry angle measured except for 120o, which was 1.8%. The measured and iPlan RT Dose TPS computed dose agreed to within 1% for all gantry angles and field sizes measured except for 100o where the agreement was 1.4% for 10 cm × 10 cm field size. Predicted attenuation through the couch by iPlan RT Dose TPS (3.4% - 9.5% and Pinnacle3 TPS (2% - 6.6% were within the same magnitude and similar to previously reported in the literature. Pinnacle3 TPS estimated an 8% to 20% increase in skin dose with increase in field size. With the introduction of the CF couch top, it estimated an increase in skin dose by approximately 46 - 90%. The clinical impact of omitting the couch in treatment planning will be dependent on the beam arrangement, the percentage of the beams intersecting the couch and their angles of incidence. Conclusion We have successfully modeled the ICT in Pinnacle3 TPS and validated the modeled ICT in iPlan RT Dose. It is recommended that the ICT be included in treatment planning for all treatments that involve posteriors beams. There is a significant

  10. The University of Salamanca under Philip II in statistic data La Universidad de Salamanca bajo Felipe II en estadísticas

    Directory of Open Access Journals (Sweden)

    Francisco Javier ALEJO MONTES

    2013-07-01

    Full Text Available This paper is a statistical comparative study between the students who were registering in the University of Salamanca and who were obtaining each of three degrees that could be obtained in the University. It fills an existing emptiness in the University of Salamanca historiography, since a comparative study was necessary in the epoch of Philip II. The study analyzes the university matriculation, the requirements to formalize it, the order in which there were staying new recruits and the statistical contributed information. Likewise, there are analyzed and compare the statistical information contributed for each of three degrees that could be obtained in the University of Salamanca, which they were that of graduate, that of licentiate and that of doctor or teacher. It appreciates clearly the importance that had each of the faculties, being clearly the most valued the Faculty of Canon law and that less, that of Medicine.El presente artículo es un estudio estadístico comparativo entre los estudiantes que se matriculaban en la Universidad de Salamanca y los que obtenían cada uno de los tres grados que se podían obtener en la Universidad. Llena un vacío existente en la historiografía universitaria salmantina, ya que era necesario un estudio comparativo en la época de Felipe II. El estudio analiza la matrícula universitaria, los requisitos para formalizarla, el orden en el que quedaban inscritos y los datos estadísticos aportados. Asimismo, se analizan y comparan los datos estadísticos aportados para cada uno de los tres grados que se podían obtener en la Universidad de Salamanca, que eran el de bachiller, el de licenciado y el de doctor o maestro. Con ello, se aprecia claramente la importancia que tenía cada una de las Facultades, siendo claramente la más valorada la Facultad de Derecho Canónico y la que menos, la de Medicina.

  11. El liderazgo transformacional de los directivos y las actitudes de los docentes hacia el compromiso organizacional en la Institución Educativa N° 5084 "Carlos Philips Previ" Callao 2010- 2011

    OpenAIRE

    Minaya Canales, Manuel Segundo

    2014-01-01

    Se ha diseñado un estudio descriptivo correlacional con el objetivo de determinar la relación que existe entre el liderazgo transformacional de los directivos y las actitudes de compromiso organizacional de los docentes en la Institución Educativa Nº 5084 “Carlos Philips Previ” Callao. La muestra estuvo constituida por 39 empleados de la Institución Educativa, entre docentes y personal directivo. Para la medición de la variable Liderazgo transformacional se diseñó un instrumento compuesto de ...

  12. Gifts reserved for age: a Lacanian study of comedy in Philip Roth’s Exit Ghost = Dons reservados para a idade madura: um estudo lacaniano sobre a comédia em O fantasma sai de cena (2007, de Philip Roth

    Directory of Open Access Journals (Sweden)

    James Milton Mellard

    2010-01-01

    Full Text Available The critical problem surrounding Philip Roth’s recent Exit Ghost (2007, the ninth and projected by the author as the final Zuckerman novel, is how it can function as comedy when one major character is dying of brain cancer and its protagonist is seventy-one years old, beginning to receive an elderly male’s gifts reserved for age –prostate cancer, prostate surgery, impotence, and incontinence – and, despite all, falls in love with a thirty-year-old married woman. A sequel to The Ghost Writer (1979, the first Zuckerman novel, whose character relations it repeats, Exit Ghost has comparatively less humor than its predecessor but there is humor enough. Moreover, and more important, it fits the genre of comedy because of the functions it gives to the classically traditional motifs of the phallus, castration, age versus youth, Eros and Thanatos, and the like. It is from a Lacanian critical perspective that it can be shown how the novel moves toward comedy’s conventional happy ending because of the duality of meanings attached to the matter of castration, the way in which Roth/Zuckerman displaces the object of desire from the young woman and finds it – enjoyment, jouissance – in the very process of writing itself.O grande problema para a crítica de O fantasma sai de cena, até agora o penúltimo romance de Philip Roth, concebido como o último envolvendo Nathan Zuckerman, é classificá-lo como comédia, e um de seus mais importantes personagens está morrendo de câncer no cérebro e o protagonista tem 71 anos e já está recebendo os dons reservados para a idade madura masculina, ou seja, câncer de próstata, cirurgia prostática, impotência, incontinência urinária e, apesar de tudo, apaixona-se por uma mulher casada, de 30 anos. Sendo uma continuação da série iniciada por The Ghost Writer (1979, o primeiro romance em que aparece o personagem Zuckerman, cujas relações com os demaispersonagens se repetem, O fantasma sai de cena

  13. 1980 Annual status report: super-SARA

    International Nuclear Information System (INIS)

    1981-01-01

    The essential tasks of the JRC for the SUPERSARA project during 1980 were therefore twofold: 1. Actuation of an international Task Force with which to: a. discuss in depth the test objectives and the relationships between the SSTP and the world mosaic of activities in the field of LWR fuel behaviour; b. establish a consensus test matrix; c. identify and discuss the major technological problems affecting the feasibility of attaining the consensus test objectives, especially for the boil-down SFD tests. A Task Force with these objectives was necessary in order to provide the elements for a Council decision on phase II. 2. Conservation of the rythm of the main contractor (UKAEA-Harwell) and subcontractors for the timely fabrication of loop components and the timely design of those new aspects of the plant necessary for the boil-down SFD tests

  14. Ergenlik Dönemi Okuma Tutumu Ölçeği’nin Türkçe’ye Uyarlanması The Adaptasyon Of Survey Of Adolescent Reading Attitudes (Sara Into Turkish

    Directory of Open Access Journals (Sweden)

    Muhammet BAŞTUĞ

    2013-07-01

    Full Text Available The aim of this study is to adapt the Survey of Adolescent Reading Attitudes SARA to Turkish, which was developed by McKenna, Conradi, Lawrance, Jang, and Meyer (2012, and to test it for validity and reliability. The rationale is that the scale involves one’s attitude towards digital reading. The sample was comprised of 702 sixth,seventh and eighth grade students in Konya- 343 of them being femaleand the remaining 359 being male. The original scale had 18 items infour sub-dimensions, namely academic reading in digital settings (AD,recreational reading in digital settings (RD, academic reading in printsettings (AP and recreational reading in print settings (RP. Theexploratory factor analysis and confirmatory factor analysis revealedthat the four original sub-dimensions were retained when two itemswere omitted. Cronbach’s alpha coefficients were 0.691, 0.802, 0.690,0.660 and 0.623 for the overall scale, RD, RP, AP and AD respectively.The results suggest that the adapted scale is reliable and valid. The 15-item finalized version is appropriate for the Turkish language and use inTurkey. In the development of reading environments and materials,identification of students’ attitudes toward reading in a multidimensionalway is expected to make great contributions to morequalified learning environments. Bu araştırmanın amacı, McKenna, Conradi, Lawrence, Jang ve Meyer (2012 tarafından geliştirilen Ergenlik Dönemi Okuma Tutumu Ölçeği’nin geçerlik ve güvenirliğinin yapılarak Türkçe’ye uyarlanmasıdır. Ölçeğin dijital okumaya karşı tutumu da kapsaması sebebiyle uyarlama çalışmasının uygun olacağı düşünülmüştür. Çalışma grubunu Konya ilinde yer alan ve 6,7 ve 8. Sınıflara devam eden 343’ü kız, 359’u erkek toplam 702 öğrenci oluşturmuştur. Ölçeğin orjinali 18 maddeden ve “Akademik Dijital, Serbest Dijital, Akademik Kağıt ve Serbest Kağıt” olmak üzere 4 alt boyuttan olu

  15. Spanish Zimbardo Time Perspective Inventory Construction and Validity among Higher Education Students

    Science.gov (United States)

    Usart, Mireia; Romero, Margarida

    2014-01-01

    Introduction: The study of "Time Orientation" (TO) has been focused on how to measure this construct and its effects on human behavior. Defined as a fundamental psychological variable, TO is multidimensional, sensible to cultural differences and age. Although its relation to learning, it deserves further study in the different Higher…

  16. Memories of Future Masculine Identities: A Comparison of Philip K. Dick’s “We Can Remember it for you Wholesale”, the 1990 Film Total Recall and its 2012 Remake

    Directory of Open Access Journals (Sweden)

    Amaya Fernández-Menicucci

    2014-12-01

    Full Text Available Recent remakes of iconic science fiction films such as Total Recall, far from merely reproducing cultural landscapes from the past, are actively producing new constructions of categories of identity such as gender and sexuality. In particular, in the two filmic adaptations of Philip K. Dick’s short story “We Can Remember it for you Wholesale” by Paul Verhoeven in 1990 and Len Wiseman in 2012, memory is a metaphor for the historical accountability of hegemonic masculinity—or the lack thereof. Dick’s original text and both Total Recall adaptations can be read as revisionist approaches to the past through a dystopian vision of the future, which, in turn, is but a projection of present anxieties of masculinities in crisis. A comparative analysis of the amnesiac heroes presented in these three sci-fi texts will thus offer an insight into the way in which futuristic action men ‘recall’ present and past discourses on power. Indeed, memory constitutes the narrative mechanism that allows collective and individual realities to be questioned and re-imagined through the intra-textual and inter-textual references present in the three texts in question.

  17. Expanding the Role of Emergency Medical Services in Homeland Security

    Science.gov (United States)

    2013-03-01

    this technology has the potential to provide a psychological advantage to be ahead of the event and to provide life saving and public calming...Brown, Larry E. Beutler, James N. Breckenridge, and Philip G. Zimbardo. Psychology of Terrorism. New York: Oxford University Press, 2007. Brown...Physicians and the National Association of State EMS Directors, 2011. Chapman, Wendy W., John N. Dowling, Atar Baer, David L. Buckeridge, Dennis

  18. Every Story Tells a Story That Has Already Been Told: Intertextuality and Intermediality in Philip Pullman’s Spring-Heeled Jack and in Kevin Brooks’ iBoy

    Directory of Open Access Journals (Sweden)

    Michael C. Prusse

    2014-05-01

    Full Text Available Training English teachers involves acquainting them with suitable texts for their future classrooms. Ideally such texts touch upon matters that children and young adults respond to and such literature also offers learning opportunities both for the pre-service teachers and their students. It can be argued that such learning opportunities can be found when analysing superheroes, when considering the impact of the new media on young people or when focusing on the blending of different genres and texts. The two novels selected for this purpose are Philip Pullman’s Spring-Heeled Jack (1989 and Kevin Brooks’ iBoy (2010. The former is a hybrid of a traditional and a graphic novel and resorts to intertextual allusions, for instance by means of quotes at the beginning of each chapter. The latter text also resorts to quotations – but from different sources, namely almost exclusively from the worldwide web. While iBoy may at first sight look rather conventional as a novel, it nevertheless reveals its provenance from the digital age in the numbering of the chapters in the binary system. Young readers (and their teachers may thus discover the pleasures of literary reading when following Pullman’s superhero (taken from a Victorian penny-dreadful across London. Brooks’ hybrid protagonist, by contrast, a first-person narrator, allows readers to gain insights into the problematic side of his role and his powers. Ultimately these rather conventional novels succeed in capturing their readers’ attention and somewhat contradict critics who predict the arrival of a more hypertextual approach to reading because of the impact of the new media.

  19. ‘Hawaii, Hawaii/ Like a dream/ So I came/ But my tears/ Are flowing now/In the canefields’: Beauty’s Price in Philip Kan Gotanda’s Ballad of Yachiyo

    Directory of Open Access Journals (Sweden)

    María Isabel Seguro

    2009-06-01

    Full Text Available Oftentimes popular culture depicts Hawaii as an ideal paradise, represented by images of ‘[p]alm trees, a distant mountain (frequently a smoking volcano, and a hula maiden, all surmounted by a splendid full moon’ (Brown 1994. Such a picture clearly contrasts with the labour song quoted in the title of this article, which reflects the exploitation, mainly of Asian workers, in the sugar-cane plantation system—the original basis for (white American prosperity in the islands since the mid-nineteenth century. Philip Kan Gotanda’s play, Ballad of Yachiyo, which premièred at Berkeley Repertory Theatre in 1995, takes place within a Japanese community in early twentieth-century Hawaii. It is loosely based on the silenced story of the playwright’s aunt who committed suicide for bringing shame to the family as a result of an extra-marital pregnancy. Gotanda considers that this particular work is not so much about politics, but about ‘a tone’ and a ‘kind of beautiful sadness’ (1997. Despite the author’s words, Ballad of Yachiyo inevitably has embedded within a political message insofar as it makes references, for example, to working conditions in the sugar plantations, the formation of the first inter-ethnic (Japanese/Filipino trade unions and the expectations of Japanese immigrants in search of the mythical paradise Hawaii was meant to be. That is, by recovering what was once a lost voice, Gotanda reconstructs part of his family’s memory as forming part of Hawaii’s recent history.

  20. Kliendisuhte juhtimine algab kliendi tundmisest / Philip Kotler

    Index Scriptorium Estoniae

    Kotler, Philip

    2003-01-01

    Peatükk P. Kotleri raamatust "Turundusvaatenurgad Ast Zni". Autori sõnul seisneb kliendisuhte turundus riist- ja tarkvara hankimises, mis võimaldab ettevõttel saada detailset informatsiooni igast kliendist, mida saab omakorda kasutada paremaks turundustegevuseks. Põhjustest, miks pole ettevõtted kliendisuhte juhtimise süsteemide rakendamise tulemustega rahul

  1. Turunduse meistriklass / Philip Kotler ; interv. Stuart Crainer

    Index Scriptorium Estoniae

    Kotler, Philip

    2004-01-01

    Turunduse rollist ettevõtte tegevuses, Interneti ja kommunikatsioonitehnoloogiate mõjust turunduse arengule, kliendisuhete haldamisest ning ettevõtte sotsiaalsest vastutusest. Lisa: Turunduse ees seisavad paljud suured väljakutsed

  2. Presión Monárquica y Resistencia Municipal: Jerez de la Frontera contra el Gobierno de Felipe IV Royal pressure and municipal resistance: Jerez de la Frontera against the Government of Philip IV

    Directory of Open Access Journals (Sweden)

    Jose Manuel DÍAZ BLANCO

    2012-12-01

    Full Text Available Este artículo intenta narrar y explicar los sucesos ocurridos en Jerez de la Frontera el año de 1637, cuando el Cabildo de la ciudad intentó resistirse a las innovaciones de la política fiscal de la Monarquía después del estallido de la guerra entre Francia y España. Para conseguir este objetivo, la primera parte resalta la crisis económica sufrida por Jerez desde finales del siglo XVI y presta una atención singular al principal proyecto de dinamización comercial de la ciudad: la construcción de un canal entre el Guadalquivir y el Guadalete, fracasado por el rechazo de la Monarquía. La segunda parte narra los acontecimientos de 1637 y propone explicar la violencia política como una consecuencia de la falta de apoyo que la ciudad había recibido del Gobierno. Este cuadro permite situar Jerez en el mapa de las convulsiones políticas que la historiografía ha detectado en la Castilla de Felipe IV.This article intends to tell and explain the events happened at Jerez de la Frontera in 1637, when the town council –Cabildo– of the city resisted to the innovations of the Monarchy’s fiscal policy after the war between Spain and France. The first part of the article sheds light on the economic crisis suffered by Jerez since the end of the sixteenth century and pays special attention to the main project of commercial revitalization of the city: the building of a channel between the rivers Guadalquivir and Guadalete, which failed due to the Monarchy’s opposition. The second part of the article tells the events of 1637 and intends to explain the political violence as a consequence of the city’s lack of support of the government. This picture allows situating Jerez in the map of the political upheavals that the historiography has detected in Philip IV’s Castile.

  3. Application of low-tube current with iterative model reconstruction on Philips Brilliance iCT Elite FHD in the accuracy of spinal QCT using a European spine phantom.

    Science.gov (United States)

    Wu, Yan; Jiang, Yaojun; Han, Xueli; Wang, Mingyue; Gao, Jianbo

    2018-02-01

    To investigate the repeatability and accuracy of quantitative CT (QCT) measurement of bone mineral density (BMD) by low-mAs using iterative model reconstruction (IMR) technique based on phantom model. European spine phantom (ESP) was selected and measured on the Philips Brilliance iCT Elite FHD machine for 10 times. Data were transmitted to the QCT PRO workstation to measure BMD (mg/cm 3 ) of the ESP (L1, L2, L3). Scanning method: the voltage of X-ray tube is 120 kV, the electric current of X-ray tube output in five respective groups A-E were: 20, 30, 40, 50 and 60 mAs. Reconstruction: all data were reconstructed using filtered back projection (FBP), IR levels of hybrid iterative reconstruction (iDose 4 , levels 1, 2, 3, 4, 5, 6 were used) and IMR (levels 1, 2, 3 were used). ROIs were placed in the middle of L1, L2 and L3 spine phantom in each group. CT values, noise and contrast-to-noise ratio (CNR) were measured and calculated. One-way analysis of variance (ANOVA) was used to compare BMD values of different mAs and different IMR. Radiation dose [volume CT dose index (CTDI vol ) and dose length product (DLP)] was positively correlated with tube current. In L1 with low BMD, different mAs in FBP showed P0.05, indicating no difference in BMD. And P>0.05 was observed among BMD of spine phantom in L1, L2 and L3 under same mAs joined with varied iterative reconstruction. The BMD in L1 varied greatly during FBP reconstruction, and less variation was observed in reconstruction of IMR [1] and IMR [2]. The BMD of L2 changed more during FBP reconstruction, where less was observed in IMR [2]. The BMD of L3 varied greatly during FBP reconstruction, and was less varied in all levels of iDose 4 and reconstruction of IMR [2]. In addition, along with continuous mAs incensement, the CNRs in various algorithms continued to increase. Among them, CNR with the FBP algorithm is the lowest, and CNR of the IMR [3] algorithm is the highest. Repeated measurements of BMD with QCT in the ESP

  4. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    Directory of Open Access Journals (Sweden)

    Mihael Černetič

    2015-02-01

    Full Text Available The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is analysed from the perspective of mindfulness. Within the course of therapy, parallels were observed between the client's increased mindfulness, improved internal and external contact, strengthened Adult ego state, mastery of introjections, as well as diminished feelings of guilt, improved mood, self care and ability to engage in appropriate separation and individuation. These gains support the conclusion that Integrative Psychotherapy and mindfulness are inherently related and that explicit incorporation of mindfulness may enhance the therapeutic process of Integrative Psychotherapy.

  5. Discovery of carbon nanotubes. Sara ni carbon nanotube e

    Energy Technology Data Exchange (ETDEWEB)

    Iijima, S

    1994-01-20

    This paper describes the following matters on carbon nanotubes (CNt): CNt is discovered in carbon deposits generated in the tip of a negative electrode during DC arc discharge between carbon electrodes. CNt has a construction in which cylinders made of normally several layers are superposed, based on cylindrical crystals in a single layer with six-member rings of carbon atoms laid out. Spiral arrangement of carbon six-member rings has been discovered in the single-layered crystals. Five-member rings exist in a location where the CNt tip is closed, and seven-member rings in a location where the CNt presents a saddle-like curve, without exceptions. It is introduced theoretically that the electronic structure of the single-layered CNt depends on the cylinder diameter and spiral pitch. Replacing part of the carbon negative electrode with iron, and vaporizing iron and carbon simultaneously through arc discharge can result in a single-layered CNt with a diameter of 1 nm. Heating the CNt deposited with metallic lead in an oxygen atmosphere can form CNt containing lead compounds. 19 refs., 9 figs.

  6. AFSC/REFM: Alaska Stock Assessment Results Archive (SARA)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Each year over 50 Alaskan groundfish stock assessments report the condition of Alaskan fisheries resources in the U.S. Exclusive Economic Zone. Stock assessment...

  7. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    OpenAIRE

    Mihael Černetič

    2015-01-01

    The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is ana...

  8. Gene : CBRC-SARA-01-0604 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available and polyadenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82107.1| cleavage and poly...adenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82108.1| cleavage and polyadenylat...ion specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] 3e-16 77% MSTVPTVSCTS...TDRWGLVGTGRCYGSGRGGSMLASCGELSQAIALPKPVLSGHQAGSDPAGSSLYLVLPEGRCLPSVPAHVCPGTAEPAQHSQTPLQRELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVCPWAGVPRAGRPGPQAQPALSFRCMQWPPAPIRHAPASHA ...

  9. 92 Negativization in Bassa Language Imoh Philip Manda* Abstract ...

    African Journals Online (AJOL)

    Ike Odimegwu

    three basic strategies used in negativizing sentence structures, two of which attach to the ... knowledge in the linguistic literature and create an awareness of how it operates in ... and morphosyntactic theories iv. ... Morava (1977:168) quotes.

  10. Nähtamatu revolutsioon / David R. Smith ; interv. Philip Ball

    Index Scriptorium Estoniae

    Smith, David R.

    2007-01-01

    Tehisstruktuuriga metamaterjalid võivad põhjapanevalt muuta telekommunikatsiooni, andmekandjaid ja isegi päikeseenergeetikat, kinnitab Dukeѫi ülikooli töörühma juht David R. Smith. Artikkel üldpealkirja all: 10 tulevikutehnoloogiat 2007

  11. Heidi's and Philip's Stories: Transitions to Post-Secondary Education

    Science.gov (United States)

    Wilson, Heidi; Bialk, Philip; Freeze, Trevi B.; Freeze, Rick; Lutfiyya, Zana M.

    2012-01-01

    Building a meaningful and valued life for individuals with learning disabilities requires the sustained, diligent and coordinated efforts of family members, supporters, educators and the individuals themselves. In this article, the formative childhood and adolescent experiences of two young adults with learning disabilities, leading to their…

  12. Dapo Adelugba and Philip Ogo Ujomu, eds., . Dakar, CODESRIA ...

    African Journals Online (AJOL)

    ANBR

    The failure of military might, intelligence-gathering capabilities and economic prowess to guarantee the security of the world's most powerful nations ... international) security, Ujomu argues, fails principally because the multiple impulses lurking behind the very notion of security form a shifting configuration that is not.

  13. Amayo Uzo Philip's Akwaeke Na Odum and Sacred Tradition

    African Journals Online (AJOL)

    Ike Odimegwu

    promotion of indigenous arts and culture of the people. This perhaps, is .... adversely influence the perception and understanding of the ... parents and friends, that there is no perfect husband, except ... ready to do anything to win her to himself.

  14. Competition protection and Philip Kotler’s strategic recommendations

    OpenAIRE

    Fornalczyk, Anna

    2011-01-01

    P. Kotler’s recommendations of modern marketing tell managers how to achieve and maintain a dominant market position. Some of the recommended activities may, however, infringe European and Polish competition law. Objections are not raised by market success achieved as a result of high product quality, good customer care, high market shares, continuous product improvements, new product release, entry onto fast growing markets, and exceeding customer expectations. Competition law...

  15. Pidgin in the Colonial Governance of Northern Nigeria Philip Atsu

    African Journals Online (AJOL)

    ANDCORPgh changing the world

    2015-03-15

    Mar 15, 2015 ... 7Arabic literacy for political agents was essential because the language ... Other elements are 'kuku boy' (steward), 'kuku meti' (cook meat), 'ruge' (rogue), ..... The colonized as child: British and French colonial rule in Africa.

  16. Public Lecture | Philipe Lebrun | "Particle accelerators" | 2 September

    CERN Multimedia

    2014-01-01

    "Les accélérateurs de particules : vecteurs de découvertes, moteurs de développement", by Dr. Philippe Lebrun.   2 September 2014 - 7:30 p.m. Globe of Science and Innovation Particle accelerators have been used in fundamental research for over a century, allowing physicists to discover elementary particles and study them at increasingly smaller scales. Making use of emerging technologies whose progress they helped to stimulate, they developed exponentially throughout the 20th century to become major tools for research today, not only in particle physics but also – as powerful radiation sources for probing matter – in atomic and molecular physics, condensed matter physics and materials science. They have also found applications in society, where they are increasingly used in a wide range of fields including applied sciences, medicine (research and clinical applications) and industry. The lecture will cover examples ...

  17. Chaos returns as new Latvian Saiema convenes / Philip Birzulis

    Index Scriptorium Estoniae

    Birzulis, Philip

    2011-01-01

    Enne Läti uue seimi esimest istungit astusid 6 parlamendiliiget Valdis Zatlersi parteist välja, kuna ei olnud rahul koalitsiooni poolt esitatud ministrikandidaatidega. Seimi spiikriks valiti taas Solvita Aboltina. Statistikat praeguse seimi koosseisu kohta

  18. My early days in photobiology with Philip Hanawalt

    International Nuclear Information System (INIS)

    Setlow, Richard B.

    2005-01-01

    Phil and I started our careers on somewhat similar scientific paths. I had an undergraduate degree in physics from Swarthmore College and a Ph.D. degree in physics from Yale for research in the field for ultraviolet spectroscopy. Phil received an undergraduate degree in Physics from Oberlin College, joined the Yale Physics Department in 1954, and transferred to the new Biophysics Department in 1955. We began our interactions then by virtue of the fact that Phil had to take a Laboratory Course in Experimental Physics, one part of which was spectroscopy in which I was the instructor. One of my principal interests was in the effects of different wavelengths of ultraviolet (UV) radiation on proteins, viruses and bacterial cells. So what was more natural than for Phil to dream up a Ph.D. research project to investigate the effects of different wavelengths of UV on macromolecular synthesis in Escherichia coli. I became his mentor with expertise in UV, whereas he did most of the microbiological/biochemical work. Thus began a collaboration and a communicating friendship, the latter going on for 50 years. That communication was essential in elucidating some of the important steps in nucleotide excision repair-a field in which Phil is a pre-eminent scholar and investigator

  19. Philip Glass, Scott Walker ja Sigur Ros! / Immo Mihkelson

    Index Scriptorium Estoniae

    Mihkelson, Immo, 1959-

    2007-01-01

    Pimedate Ööde 11. filmifestivali muusikafilme - Austraalia "Glass: Philipi portree 12 osas" (rež. Scott Hicks), Islandi "Sigur Ros kodus" (rež. Dean DeBois), Suurbritannia "Scott Walker: 30 Century Man" (rež. Stephen Kijak)

  20. Cross-cultural dimensions : organisational culture in Philip Morris, Lietuva

    OpenAIRE

    Grundey, Dainora

    2008-01-01

    Business globalization raised the new priorities for cross-cultural management theory and practice. The goal of this article is according to cross-cultural management and organizational culture theories to propose a new model of organizational culture with cross-cultural dimensions. The objectives of the paper are as follows: a) to disclose the essence of cross-cultural management and organizational culture; b) to carry out the empirical research of organizational culture in a selected Lithua...

  1. Instability and Nonlinearity in the Euro-area Philips Curve

    NARCIS (Netherlands)

    A. Musso; A. Stracca; D.J.C. van Dijk (Dick)

    2009-01-01

    textabstractThis paper provides a comprehensive analysis of the functional form of the euro-area Phillips curve over the past three decades. In particular, compared with previous literature, we analyze the stability of the relationship in detail, especially as regards the possibility of a

  2. The political-economic education of the rulers in the discourses to the king Philip III by Pedro de Valencia (1555-1620 La educación político-económica del gobernante en los discursos al rey Felipe III de Pedro de Valencia (1555-1620

    Directory of Open Access Journals (Sweden)

    Jesús Luis PARADINAS FUENTES

    2013-02-01

    Full Text Available Present-day economical crisis resembles partly that one suffered in Spain at the beginning of the 17th century. In those days, the Spanish Crown, which like all modern States had needed to carry out new functions such as deciding the ell into a deep economic crisis. Many treatises and discourses, several of them addressed to the king Philip III were written to change the economic policy of the State, which was considered responsible for the evils affecting Spain. Some of these texts have been studied by the historians of economics, but not by the historians of education, however they can be, in our opinion, included in that literary genre whose objective was the education of the princes. In this work we will analyse the writings dedicated to that king by the Spanish humanist Pedro de Valencia with the aim of educating the rulers of the Monarchy so that they could acquire the necessary intellectual and moral virtues to accomplish their duties. There are in his texts many teachings that are still valid nowadays.La crisis económica actual tiene ciertos paralelismos con la que sufrió España en el comienzo del siglo XVII. En aquel tiempo, la Corona española, que como todos los Estados modernos para poder consolidarse había tenido necesidad de cumplir nuevas funciones como las de decidir la política fiscal y la monetaria, entró en una profunda crisis económica. Con la intención de cambiar la política económica del Estado, a la que se hacía responsable de los males que aquejaban a España, se redactaron multitud de discursos y tratados, muchos de los cuales se dirigieron directamente al rey Felipe III. Algunos de estos escritos han sido estudiados por los historiadores de la economía, pero no por los de la educación, a pesar de que, según nuestra opinión, pueden incluirse dentro del género de literatura que tenía como objetivo la educación de los príncipes. En este trabajo vamos a analizar los que dedicó a dicho monarca el

  3. Short version of the Zimbardo Time Perspective Inventory (ZTPI-short) with and without the Future-Negative scale, verified on nationally representative samples

    Czech Academy of Sciences Publication Activity Database

    Košťál, Jaroslav; Klicperová-Baker, Martina; Lukavská, K.; Lukavský, Jiří

    2016-01-01

    Roč. 25, č. 2 (2016), s. 169-192 ISSN 0961-463X Institutional support: RVO:68081740 Keywords : ZTPI * ZTPI-short * time perspective * temporal orientation * representative sample Subject RIV: AN - Psychology Impact factor: 1.206, year: 2016

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1| unnamed protein product [Mus musculus] gb|EAW65549.1| non imprinted in Prader-Willi/Angelman syndrome 1, ...isoform CRA_a [Homo sapiens] gb|EAW65551.1| non imprinted in Prader-Willi/Angelman syndrome 1, isoform CRA_a... [Homo sapiens] gb|ABM82178.1| non imprinted in Prader-Willi/Angelman syndrome 1 ...[synthetic construct] gb|ABM85364.1| non imprinted in Prader-Willi/Angelman syndrome 1 [synthetic construct] CAD97953.1 1e-113 81% ...

  5. Sara Lipton in Conversation with Eva Janáčová. [Interview

    Czech Academy of Sciences Publication Activity Database

    Janáčová, Eva; Lipton, S.

    2017-01-01

    Roč. 65, č. 1 (2017), s. 66-70 ISSN 0049-5123 Institutional support: RVO:68378033 Keywords : Judaism * Middle Ages * art Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Arts, Art history

  6. Low energy neutral atom imaging on the Moon with the SARA ...

    Indian Academy of Sciences (India)

    (LENA) imaging mass spectrometer, which will perform remote sensing of the lunar surface via detection of neutral atoms in the energy range from 10eV to 3keV from a 100km polar orbit. ..... as studying the existence of ion void regions around.

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1549 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndent protein export [Herminiimonas arsenicoxydans] emb|CAL63167.1| twin-arginine translocase subunit, sec-i...ndependent protein export [Herminiimonas arsenicoxydans] YP_001101288.1 2.0 37% ...

  8. The State Authorization Reciprocity Agreement (SARA): A Good Idea Whose Time Has Come

    Science.gov (United States)

    Longanecker, David; Hill, Marshall A.

    2014-01-01

    In this article the authors argue that states need a new way to oversee the delivery of postsecondary distance education across state borders. They assert that the current process is too spotty to assure consistent consumer protection and too cumbersome and expensive for institutions. Because education is not specified in the US Constitution as a…

  9. „Banalita“ dobra a strukturální hřích

    Directory of Open Access Journals (Sweden)

    Vojtěch Mašek

    2016-07-01

    Full Text Available Following the book Lucifer Effect (2007 written by the American social psychologist Philip Zimbardo, the study explores his central idea that human character can be easily manipulated and corrupted by force of ‘total situations’ and ‘systems’ and that ‘banal’ good and ‘banal’ evil are closely interlinked. Zimbardo’s position is confronted with the Catholic teaching of the ‘social’ and ‘structural sin’ and followed up by a broader philosophical reflection on the phenomenon of structural sin in ‘modern’ and ‘postmodern’ historical contexts. The idea of structural sin is developed into a hermeneutically interpreted category of a destructive ‘existential movement’ on the boundary of personal and institutionally mediated relationships.

  10. O naturalismo de Jürgen Habermas e de Philip Pettit The naturalism of Jürgen Habermas and Philip Pettit

    Directory of Open Access Journals (Sweden)

    André Berten

    2013-01-01

    Full Text Available As competências cognitivas pressupostas pelas atualizações sociais (relações, discursos, interpretações significam a atribuição aos seres humanos de uma certa racionalidade. Essa racionalidade pode ser concebida seja na perspectiva de uma filosofia da história de tipo evolucionista (Habermas, seja numa perspectiva da filosofia da mente (Pettit. Nas duas perspectivas, o tipo de questionamento é quase transcendental, no sentido de que se trata de revelar as condições de possibilidade das operações cognitivas reais efetuadas pelos agentes. Em última instância, as condições de possibilidade devem ser entendidas como "natureza". A questão é a de saber se, metodologicamente, um monismo naturalista é possível, ou se um dualismo de perspectivas não seria imprescindível.Cognitive abilities presupposed by social performances (relations, speeches, interpretations mean the attribution to human beings of a certain rationality. This rationality can be understood in terms of a type of evolutionary philosophy of history (Habermas, or in terms of the perspective of the philosophy of mind (Pettit. In both perspectives, the type of questioning is almost transcendental in the sense that it is able to reveal the possibility of cognitive operations performed by real actors. Ultimately, the conditions of possibility must be understood as "nature." The question is whether, methodologically, a naturalistic monism is possible, or if a dualism of perspectives would not be indispensable.

  11. Philips high tension generator (x-ray machine) testing for baby ebm (electron beam machine) project

    International Nuclear Information System (INIS)

    Norman Awalludin; Leo Kwee Wah; Abu Bakar Mhd Ghazali

    2005-01-01

    This paper describes the test of the HT system (from X-ray machine) for usage of the mini EBM (Electron Beam Machine). It consists the procedures of the installation, the safety procedures when deals with HT, modification of the system for testing purpose and the technique/method for testing the HT system. As a result, the voltage for the HT system and the electron gun (filament) current can be measured. Based on the results, suitability of the machine for baby EBM could be confirmed. (Author)

  12. Visitor Report Bangalore: A Europeans impressions on healthcare and Philips research in India

    NARCIS (Netherlands)

    Müller, M.

    2011-01-01

    India is a country that defies generalization. It is so big, so diverse and so overwhelming that it’s easy to come back with one’s preconceptions simply confirmed. You think of India as an awakening giantwith world-beating companies? India hosts scores of futuristic technology parks with new

  13. Geef SBS-voetzoekers geen kans: Philip Wallage reageert op Pheijffer en Hoogenboom

    NARCIS (Netherlands)

    Wallage, P.

    2009-01-01

    Marcel Pheijffer en Bob Hoogenboom betoogden in het meinummer dat compliance vooral niet moet ontaarden in het exact naleven van wetten en regels, omdat creative compliance onvermijdelijk leidt tot schijnzekerheden en calculerend gedrag. Het betoog klopt, maar de negatieve conclusie dat we de luxe

  14. 78 FR 42064 - Before Commissioners: Jon Wellinghoff, Chairman; Philip D. Moeller, John R. Norris, Cheryl A...

    Science.gov (United States)

    2013-07-15

    ... Transmission Organizations (Joint ISOs/RTOs) filed a joint motion to intervene out-of-time and comments on NERC's Petition.\\13\\ In support of their request for leave to intervene out-of-time, Joint ISOs/RTOs... the January 30, 2013 close of the intervention and comment period. Joint ISOs/RTOs maintain that their...

  15. Migratsiooniga kaasnevad probleemid Euroopa Liidu idalaienemisel / Kaia Philips, Marit Priinits, Andres Võrk

    Index Scriptorium Estoniae

    Philips, Kaia, 1969-

    2003-01-01

    Olulisematest migratsiooni tõuke- ja tõmbeteguritest võrreldes nii Eesti kui Euroopa Liidu liikmesriikide demograafilist situatsiooni ja inimkapitaliga varustatust, tööhõive ja tööpuuduse erinevusi, sissetulekute taset ja palkade erinevusi. Soovitusi tööturu- ja migratsioonipoliitika vallas

  16. Assessment of a Philips' Pendo Diagnost and Traumob C system for skull radiography

    International Nuclear Information System (INIS)

    1983-03-01

    The design of the system assessed introduces a number of innovations for positioning for skull radiography. These include: facilities for rotation of the table about the isocentre of the X-ray beam, digital indication of angular and linear movement, stationary cross light positioning aids for lateral and frontal projections, and vertical movement of the table top. The report commends the features of the design which allow precise, reproducible positioning with minimal patient disturbance for skull and casualty radiography. These features include the clever light aids mentioned above, the ability to view the patient through the cassette holders, well positioned controls for the effectively braked movements, and a variable-height, floating-top and wheeled patient-table. (author)

  17. A variable frequency three phase inverter for use with Philips cryogenerators

    International Nuclear Information System (INIS)

    Carter, R.C.

    1977-10-01

    This report describes a solid state inverter designed to power the helium circulators on the cryogenerators used on the Rapid Cycling Vertex Detector at the Rutherford Laboratory. In these cryogenerators cold helium is pumped around the refrigeration loop by a small three phase induction motor. The motor requires a supply of 220 volts, 40 mA per phase, and varying in frequency between 200 and 300 Hz, depending on the length and general characteristics of the loop and transfer line. (author)

  18. Bird surveys at Stokes Point and Philips Bay, Yukon in 1983. No. 40

    Energy Technology Data Exchange (ETDEWEB)

    Dickson, D L; Dickson, H L; Aiudi, G M

    1988-01-01

    The distribution, abundance, and habitat preferences of birds were studied at Stokes Point, Phillips Bay and King Point in the northern Yukon in 1983. These data were gathered to assist in decisions about future development of a port to support marine drilling activities in the Beaufort Sea. Nesting bird densities at Stokes Point were similar to those found elsewhere on the Yukon Coastal Plain due to the similarity in habitat. The lagoon at Stokes Point was locally important to molting ducks. Several species occurred in higher densities at Phillips Bay than elsewhere on the Plain, mainly due to the deltas and spits created by rivers flowing into the Bay. These deltas were locally important to such species as molting non-breeding tundra swans, Canada geese, and ducks. During ground surveys in June, habitat was classified into 13 types and the nesting density for each bird species calculated for each habitat type. Overall bird densities were more than 3 times higher in lowland than in upland habitats. Passerine densities and species were highest in the tall shrub type of habitat found primarily in stream and river valleys. The Yukon Coastal Plain is an important nesting area for the stilt sandpiper, which has a limited breeding range. The Plain is also nationally important for nesting long-billed dowitchers and yellow wagtails, both fairly common in the study area but with very limited breeding distribution within Canada. The Plain is also internationally important to fall staging snow geese. 38 refs., 17 figs., 35 tabs.

  19. From lagging indicators to leading indicators : design of a leading indicator dashboard for Philips Lighting

    NARCIS (Netherlands)

    Cai, Yongjian

    2011-01-01

    KPI (Key Performance Indicators) such as customer service level and stock level are commonly used in industry to measure the supply chain performance. Supply chain managers have a decided preference for these "lagging" indicators since they only measure the final outcomes that result from their

  20. Do Cyborg Dreams Emancipate Sheep? (with Apologies to Philip K. Dick).

    Science.gov (United States)

    Bromley, Hank

    A full investigation into how and why the expression of potential benefits of computers in schools is hindered would need to consider many aspects, but one point that should be considered is the ever-tightening integration of educational institutions into the global economy. Evidence of the accelerating assimilation of schools into the economy…

  1. Rationality and the Role of the University: A Response to Philip Higgs.

    Science.gov (United States)

    Waghid, Y.

    2002-01-01

    Challenges Higgs'"ambivalent" position about the role of the university (presented in a previous article), contending that the university can still retain its character as "a community of reason" (Higgs' main argument) without abandoning its social role vis-a-vis nation building. (EV)

  2. The performance characteristics of the Philips Gemini PET/CT scanner

    International Nuclear Information System (INIS)

    O'Keefe, G.J.; Papenfuss, A.T.; Scott, A.M.; Rowe, C.C.

    2002-01-01

    Full text: The Department of Nuclear Medicine, Centre for PET at the ARMC is commissioning a next generation PET/CT scanner based on gadolinium silicic dioxide (GSO) crystal technology to replace the BGO crystal PET scanner that has been in operation since 1992. The Gemini PET/CT scanner is a fully 3D PET system which offers significantly increased resolution and sensitivity allowing wholebody scans in under 30 minutes. Until the late 90's, PET scanners were largely used with septa for neurological imaging and the performance characteristics of PET scanners were presented according to the NEMA-NU2-94 standard which specifically addresses the performance of PET scanners for neurological applications. PET is now largely used without septa for oncological imaging and as such, the NEMA-NU2-94 standard does not adequately reflect performance. The NEMA-NU2-2001 standard was designed to incorporate the effects of out-of-FOV activity and its contribution to performance by virtue of the increased scatter and randoms that result when performing wholebody scans without the use of septa. As part of the acceptance program of the Allegro/Gemini systems, the NEMA-NU2-2001 standard will be used to characterise the spatial resolution, sensitivity, randoms and scatter contributions and the Noise Equivalent Count rate (NECr). These results will be presented and compared with the ECAT 951/31R performance characteristics. Copyright (2002) The Australian and New Zealand Society of Nuclear Medicine Inc

  3. Päevad : [luuletused] / Philip Larkin ; inglise keelest tlk. Maarja Kangro

    Index Scriptorium Estoniae

    Larkin, Philip

    2007-01-01

    Sisu: Päevad ; Mitte midagi öelda ; See olgu värss ; Uurimus lugemisharjumustest ; Hommage valitsusele ; Vesi ; Vajakud ; Viige üks koju lastele ; Jutt voodis ; Kõrged aknad ; Sa jätkad elu ; Kui. Orig.: Days ; Nothing to be said ; This be the verse ; A study of reading habits ; Homage to a government ; Water ; Wants ; Take one home for the kiddies ; Talking in bed ; High windows ; Continuing to live ; If

  4. A Conversation with Henry DePhilips, MD: The Doctor in the Teladoc House.

    Science.gov (United States)

    Wehrwein, Peter

    2017-04-01

    The CMO of Teladoc, one of the country's largest telemedicine providers, certainly knows how to sing the praises of the industry, and handle devil's advocate kind of questions as well. Most of Teledoc's customers are commercial insurers and employers. Medicare? Not so much. Medicaid makes "perfect sense."

  5. A Tale of Two Cities : Valga and Valka celebrating reunification / Philip Birzulis

    Index Scriptorium Estoniae

    Birzulis, Philip

    2008-01-01

    Valga ja Valka tähistasid linnadevahelise piiri kadumist seoses Schengeni õigusruumiga ühinemisega. Üritusel osalesid ka Eesti president Toomas Hendrik Ilves ja Läti president Valdis Zatlers. Vt. samas: History of Walk

  6. Performance study of Philips digital silicon photomultiplier coupled to scintillating crystals

    CERN Document Server

    Liu, Z.; Auffray, E.; Lecoq, P.; Paganoni, M.

    2016-01-01

    Silicon photomultipliers (SiPMs) and scintillators are often arranged in the shape of arrays in Positron Emission Tomography (PET) systems. Digital SiPMs provide signal readout in single photon avalanche diode (SPAD) level. From the photon count rate measurement of each SPAD cell of digital SiPM, we found that the output scintillating photons distribute in an area larger than the scintillator physical coupling area. Taking advantage of the possibility to enable/disable individual cells of the digital SiPM, a group of Lutetium-yttrium oxyorthosilicate (LYSO) crystals with different dimensions coupled to a digital SiPM was used to study the influence of using different SiPM active area on the number of photons detected, energy resolution and coincidence time resolution (CTR). For the same crystal coupled to the digital SiPM, the larger the active area of digital SiPM, the higher the number of photons detected. The larger active area of the digital SiPM also results in a better energy resolution after saturation...

  7. Philips Electronics synchronizes its supply chain to end the bullwhip effect

    NARCIS (Netherlands)

    Kok, de A.G.; Janssen, F.B.S.L.P.; van Doremalen, J.B.M.; Wachem, van E.; Clerkx, M.J.R.; Peeters, W.

    2005-01-01

    Demand variability increases as one moves up a supply chain. The demand for finished products is less variable than for subassemblies, which is less variable than for individual components. This phenomenon is known as the bullwhip or Forrester effect. It increases inventory unnecessarily and makes

  8. Optimization of the raw material supply chain for Philips TL factories

    NARCIS (Netherlands)

    Rodrigues, Iana Araujo

    2009-01-01

    The globalization results in more complex and dynamic supply chains. While Asia becomes the first sourcing alternative for many companies, supply chains need to be redesigned in order to reduce costs, improve performance, increase flexibility and expand collaboration among the parties involved. It

  9. TU-PIS-Exhibit Hall-4: Philips Pinnacle3 clinical solutions for adaptive radiotherapy

    International Nuclear Information System (INIS)

    Bzdusek, K.

    2015-01-01

    Brachytherapy devices and software are designed to last for a certain period of time. Due to a number of considerations, such as material factors, wear-and-tear, backwards compatibility, and others, they all reach a date when they are no longer supported by the manufacturer. Most of these products have a limited duration for their use, and the information is provided to the user at time of purchase. Because of issues or concerns determined by the manufacturer, certain products are retired sooner than the anticipated date, and the user is immediately notified. In these situations, the institution is facing some difficult choices: remove these products from the clinic or perform tests and continue their usage. Both of these choices come with a financial burden: replacing the product or assuming a potential medicolegal liability. This session will provide attendees with the knowledge and tools to make better decisions when facing these issues. Learning Objectives: Understand the meaning of “end-of-life or “life expectancy” for brachytherapy devices and software Review items (devices and software) affected by “end-of-life” restrictions Learn how to effectively formulate “end-of-life” policies at your institution Learn about possible implications of “end-of-life” policy Review other possible approaches to “end-of-life” issue

  10. Elavas teatris on iga näitleja kunstnik / Philip Brehse ; interv. Karol Kallas

    Index Scriptorium Estoniae

    Brehse, Philip

    2007-01-01

    Endine New Yorgi eksperimentaalse teatritrupi Living Theatre liige selle teatri põhimõtetest. Praegu on P. Brehse Pärnus külas Non Gratal, kelle partnerorganisatsiooni Open Space Performunion liige ta on

  11. How Philip Morris unlocked the Japanese cigarette market: lessons for global tobacco control

    OpenAIRE

    Lambert, A; Sargent, J; Glantz, S; Ling, P

    2004-01-01

    Background: The Framework Convention on Tobacco Control includes tobacco advertising restrictions that are strongly opposed by the tobacco industry. Marketing strategies used by transnational tobacco companies to open the Japanese market in the absence of such restrictions are described. Methods: Analysis of internal company documents. Findings: Between 1982 and 1987 transnational tobacco companies influenced the Japanese government through the US Trade Representative to open distribution net...

  12. TU-PIS-Exhibit Hall-4: Philips Pinnacle3 clinical solutions for adaptive radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Bzdusek, K.

    2015-06-15

    Brachytherapy devices and software are designed to last for a certain period of time. Due to a number of considerations, such as material factors, wear-and-tear, backwards compatibility, and others, they all reach a date when they are no longer supported by the manufacturer. Most of these products have a limited duration for their use, and the information is provided to the user at time of purchase. Because of issues or concerns determined by the manufacturer, certain products are retired sooner than the anticipated date, and the user is immediately notified. In these situations, the institution is facing some difficult choices: remove these products from the clinic or perform tests and continue their usage. Both of these choices come with a financial burden: replacing the product or assuming a potential medicolegal liability. This session will provide attendees with the knowledge and tools to make better decisions when facing these issues. Learning Objectives: Understand the meaning of “end-of-life or “life expectancy” for brachytherapy devices and software Review items (devices and software) affected by “end-of-life” restrictions Learn how to effectively formulate “end-of-life” policies at your institution Learn about possible implications of “end-of-life” policy Review other possible approaches to “end-of-life” issue.

  13. Performance study of Philips digital silicon photomultiplier coupled to scintillating crystals

    International Nuclear Information System (INIS)

    Liu, Z.; Pizzichemi, M.; Paganoni, M.; Auffray, E.; Lecoq, P.

    2016-01-01

    Silicon photomultipliers (SiPMs) and scintillators are often arranged in the shape of arrays in Positron Emission Tomography (PET) systems. Digital SiPMs provide signal readout in single photon avalanche diode (SPAD) level. From the photon count rate measurement of each SPAD cell of digital SiPM, we found that the output scintillating photons distribute in an area larger than the scintillator physical coupling area. Taking advantage of the possibility to enable/disable individual cells of the digital SiPM, a group of Lutetium-yttrium oxyorthosilicate (LYSO) crystals with different dimensions coupled to a digital SiPM was used to study the influence of using different SiPM active area on the number of photons detected, energy resolution and coincidence time resolution (CTR). For the same crystal coupled to the digital SiPM, the larger the active area of digital SiPM, the higher the number of photons detected. The larger active area of the digital SiPM also results in a better energy resolution after saturation correction. The best energy resolution full width half maximum (FWHM) obtained for the 2×2×5mm 3 , 2×2×10 mm 3 , 2×2×15mm 3 , 2×2×20mm 3 LYSO crystals was 10.7%, 11.6%, 12.1%, 12.5%, respectively. For crystals with different cross sections coupled to the digital SiPM, we found that the larger the cross section of coupling area, the more photons were detected and thus a better energy resolution was obtained. The CTR of crystals fully wrapped with Teflon or without wrapping was measured by positioning two identical crystals facing each other. A larger area of digital SiPM improves the CTR and the CTR reaches the plateau when the active area is larger than 2.2×2.2mm 2 with both two configurations of wrapping. The best CTR value for the 2×2×5mm 3 , 2×2×10mm 3 , 2×2×15mm 3 , 2×2×20mm 3 LYSO crystals was 128.9 ps, 148.4 ps, 171.6 ps, 177.9 ps, respectively. The measurements performed lead us to conclude that optimising the coupling between crystal and SiPM to extract more scintillating photons can improve the energy resolution and CTR

  14. Philip Morrise tantsuauhinnad läksid moodsale tantsule / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2003-01-01

    Aasta 2002 tegija auhind läks ZUGA ühendatud tantsijatele lavastuse "Walking home solo" eest, läbilöögi auhinna sai R. Keerd lavastuse "Salapärased kõlad nii norskavas öös" eest ning teenete auhinna tantsuteater Fine 5 kümneaastase viljaka töö eest

  15. Race, Feminine Power, and the Vietnam War in Philip Red Eagle's "Red Earth"

    Science.gov (United States)

    Andrews, Scott

    2004-01-01

    In her book "The Remasculinization of America," Susan Jeffords discusses the dynamics of how differences such as race and class are erased in filmic and literary representations of the Vietnam War. She asserts that one difference is not overcome by the battlefield: gender, a barrier that is depicted in the literature as natural and…

  16. Preliminary evaluation of the MLAA algorithm with the Philips Ingenuity PET/MR

    International Nuclear Information System (INIS)

    Lougovski, Alexandr; Schramm, Georg; Maus, Jens; Hofheinz, Frank; Ho, Jörg van den

    2014-01-01

    Combined PET/MR is a promising tool for simultaneous investigation of soft tissue morphology and function. However, contrary to CT, MR images do not provide information on photon attenuation in tissue. In the currently available systems issue is solved by synthesizing attenuation maps from MR images using segmentation algorithms. This approach has been shown to provide reason-able results in most cases. However, sporadically occurring segmentation errors can cause serious problems. Recently, algorithms for simultaneous estimation of attenuation and tracer distribution (MLAA) have been introduced. So far, validity of MLAA has mainly been demonstrated in simulated data. We have integrated the MLAA algorithm [2] into the THOR reconstruction []. An evaluation of MLAA was performed using both phantom and patient data acquired with the Ingenuity PET/MR.

  17. O naturalismo de Jürgen Habermas e de Philip Pettit

    Directory of Open Access Journals (Sweden)

    André Berten

    2013-01-01

    Full Text Available As competências cognitivas pressupostas pelas atualizações sociais (relações, discursos, interpretações significam a atribuição aos seres humanos de uma certa racionalidade. Essa racionalidade pode ser concebida seja na perspectiva de uma filosofia da história de tipo evolucionista (Habermas, seja numa perspectiva da filosofia da mente (Pettit. Nas duas perspectivas, o tipo de questionamento é quase transcendental, no sentido de que se trata de revelar as condições de possibilidade das operações cognitivas reais efetuadas pelos agentes. Em última instância, as condições de possibilidade devem ser entendidas como "natureza". A questão é a de saber se, metodologicamente, um monismo naturalista é possível, ou se um dualismo de perspectivas não seria imprescindível.

  18. Mäluteater / Donald Philip Verene ; tõlk. Tõnu Viik

    Index Scriptorium Estoniae

    Verene, Donald Philip

    2002-01-01

    Tutvustatakse Giulio Camillo (elas 16. saj.) raamatus "L'idea del theatro" kirjeldatud mäluteatrit, mis kujutab endast retoorilistel kinnismotiividel ja mütoloogilistel kujunditel põhinevat mälusüsteemi

  19. 75 FR 67770 - Sara Lee Corporation Including On-Site Leased Workers From EDS, Hewitt Packard, Sapphire...

    Science.gov (United States)

    2010-11-03

    ..., Deductions, Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial... this certification to include workers providing shared financial and information technology services at..., Deductions, Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial...

  20. In Ukraine, Fear of Being a Resurgent Russiaѫs Next Target / Nicholas Kulish, Sara Rhodin

    Index Scriptorium Estoniae

    Kulish, Nicholas

    2008-01-01

    Gruusia ja Venemaa vaheline konflikt on suurendanud ebakindlust Venemaa suhtes ka Ukrainas, Poolas ja Balti riikides. Eesti president Toomas Hendrik Ilves leiab, et Gruusia sündmustel on tõsised tagajärjed rahvusvahelise rahu jaoks. Vabariigi President töövisiidil Gruusias 12.-13.08.2008

  1. Feminism and Childcare: A Roundtable with Sara de Benedictis, Gideon Burrows, Tracey Jensen, Jill Rutter and Victoria Showunmi

    OpenAIRE

    Jo Littler; Alison Winch

    2016-01-01

    This is an edited transcript of a roundtable event held at City University London in late 2014. The point of this seminar was to ask: what progress have we made towards men and women equally sharing the childcare? Rearranging the domestic division of labour was a crucial issue foregrounded by second-wave feminism: but how much progress has actually been made since then? Second-wave feminists and beyond have recently been vocal in replying: ‘not so much.’ For example, Bea Campbell has argued t...

  2. Motivating the European voter: Parties, issues and campaigns in European Parliament elections / Sara B. Hobolt, Jae-Jae Spoon

    Index Scriptorium Estoniae

    Hobolt, Sara B.

    2012-01-01

    Valijate käitumisest Euroopa Parlamendi (EP) valimistel liikmesriikides (sh Eesti), valijakäitumise erinevustest võrreldes siseriiklike valimistega ja parteide mõjust valijakäitumisele. Tabelid, joonised

  3. 76 FR 72197 - Before Commissioners: Jon Wellinghoff, Chairman; Philip D. Moeller, John R. Norris, and Cheryl A...

    Science.gov (United States)

    2011-11-22

    ..., control, or restore the Bulk-Power System. See North American Electric Reliability Corporation, 119 FERC... in the planning horizon, as a means of improving the long-term reliability of the Bulk-Power System..., by contrast, should be focused on improving the long-term reliability of the Bulk-Power System...

  4. The primary assessment tool at Philips electronics : capturing real options and organizational risk in technology portfolio management

    NARCIS (Netherlands)

    Lint, L.J.O.

    2000-01-01

    I develop an extended scoring approach to build a balanced portfolio of new technology projects under uncertainty at early stages of development. My contribution is twofold. First, I show how the tool incorporates the option approach to decision making to create contingent claims on future market

  5. The 2014 Philip S. Portoghese Medicinal Chemistry Lectureship: The "Phenylalkylaminome" with a Focus on Selected Drugs of Abuse.

    Science.gov (United States)

    Glennon, Richard A

    2017-04-13

    The phenylalkylamine, particularly the phenylethylamine, moiety is a common structural feature found embedded in many clinically approved agents. Greater still is its occurrence in drugs of abuse. The simplest phenylethylamine, 2-phenylethylamine itself, is without significant central action when administered at moderate doses, but fairly simple structural modifications profoundly impact its pharmacology and result in large numbers of useful pharmacological tools, agents with therapeutic potential, and in drugs of abuse (e.g., hallucinogens, central stimulants, empathogens), the latter of which are the primary focus here. In vivo drug discrimination techniques and in vitro receptor/transporter methods have been applied to understand the actions of these phenylalkylamines and their mechanisms of action. Thus far, depending upon pendent substituents, certain receptors (e.g., serotonin receptors) and monoamine transporters (i.e., serotonin, dopamine, and norepinephrine transporters) have been implicated as playing major roles in the actions of these abused agents in a complex and, at times, interwoven manner.

  6. Millenarian prophecy and the mythification of Philip III at the time of the expulsion of the Moriscos

    OpenAIRE

    Magnier, Grace

    2003-01-01

    Los apologistas católicos, en sus obras escritas en la década después de la expulsión de los moriscos, intentaron mitificar al rey Felipe III. Le imputaron el papel del Emperador de los Últimos Días, personaje mítico derivado de las profecías sibilinas medievales (la Tiburtina y la de San Metodio) y de la exégesis bíblica milenaria de Joachim de Fiore. También le atribuyeron el rol del Rey León de España, que relacionaron con el León de Judá; ambas figuras míticas habían de reconquistar Jerus...

  7. Analysis of the Energy Performance of the Chesapeake Bay Foundation's Philip Merrill Environmental Center

    Energy Technology Data Exchange (ETDEWEB)

    Griffith, B.; Deru M.; Torcellini, P.; Ellis, P.

    2005-04-01

    The Chesapeake Bay Foundation designed their new headquarters building to minimize its environmental impact on the already highly polluted Chesapeake Bay by incorporating numerous high-performance energy saving features into the building design. CBF then contacted NREL to perform a nonbiased energy evaluation of the building. Because their building attracted much attention in the sustainable design community, an unbiased evaluation was necessary to help designers replicate successes and identify and correct problem areas. This report focuses on NREL's monitoring and analysis of the overall energy performance of the building.

  8. Process Qualification Strategy for Advances Embedded Non Volatile Memory Technology : The Philips' 0.18um Embedded Flash Case

    NARCIS (Netherlands)

    Tao, Guoqiao; Scarpa, Andrea; van Dijk, Kitty; Kuper, Fred G.

    2003-01-01

    A qualification strategy for advanced embedded non-volatile memory technology has been revealed. This strategy consists of: a thorough understanding of the requirements, extensive use and frequent update of the FMEA (failure mode effect analysis), a qualification plan with excellent coverage of all

  9. A decision support system for selecting IT audit areas using a capital budgeting approach / Dewald Philip Pieters

    OpenAIRE

    Pieters, Dewald Philip

    2015-01-01

    Internal audit departments strive to control risk within an organization. To do this they choose specific audit areas to include in an audit plan. In order to select areas, they usually focus on those areas with the highest risk. Even though high risk areas are considered, there are various other restrictions such as resource constraints (in terms of funds, manpower and hours) that must also be considered. In some cases, management might also have special requirements. Traditionally this area...

  10. Tööjõu vaba liikumine - probleem või võimalus Eestile? / Epp Kallaste, Kaia Philips

    Index Scriptorium Estoniae

    Kallaste, Epp

    2003-01-01

    Ülevaade migratsiooni teguritest, migratsiooni suuruse prognoosist Eestis Euroopa Liiduga ühinemisel ning selle mõjust Eesti tööturule. Diagrammid: Võõrtööjõu osakaal Euroopa riikides; Tunnipalk kandidaatriikides ja Euroopa Liidus 2000. aastal; Tööpuuduse määr 2002. aasta juulis (vanusegrupp 15-64). Tabelid: Uuringute hinnangud potentsiaalsele migratsioonile Euroopa Liidu kandidaatriikide tööjõu vaba liikumise printsiibi rakendumisel; Teistes Euroopa riikides elavad Eesti kodanikud aastal 2000

  11. Performance appraisal and fair compensation of academic staff in higher educational institutions / Kulno Türk, Kaia Philips

    Index Scriptorium Estoniae

    Türk, Kulno, 1954-

    2005-01-01

    Autorite hinnangul üldised arengud teadmistepõhise ühiskonna suunas muudavad eriti oluliseks akadeemilise personali motivatsiooni ja jätkuva tootlikkuse tõstmise ning töötajate töösoorituse juhtimise süsteemi väljatöötamise. Tabelid

  12. Reviews of recent publications

    Directory of Open Access Journals (Sweden)

    2009-06-01

    Full Text Available Sara Lennox. Cemetery of the Murdered Daughters: Feminism, History, and Ingeborg Bachmann by Kristin T. Vander Lugt Birgit Tautz. Reading and Seeing Ethnic Differences in the Enlightenment: From China to Africa by Susanne Kelley Patrick Greaney. Untimely Beggar. Poverty and Power from Baudelaire to Benjamin by Christine Rinne Philip Payne, Graham Bartram, and Galin Tihanov, eds. A Companion to the Works of Robert Musil by Geoffrey C. Howes Jennifer Willging. Telling Anxiety: Anxious Narration in the Work of Marguerite Duras, Annie Ernaux, Nathalie Sarraute and Anne Hébert by Natalie Edwards Michael Lucey. Never Say I: Sexuality and the First Person in Colette, Gide, and Proust by Elissa Gelfand Anthony Waine. Changing Cultural Tastes. Writers and the Popular in Modern Germany by Katrin Völkner Susan Ireland and Patrice Proulx, eds. Textualizing the Immigrant Experience in Contemporary Quebec by Amy Hubbell Cristina Peri Rossi. State of Exile . Trans. Marilyn Buck. by Reina Ruiz

  13. Larger, Higher-level Academic Institutions in the US Do Not Necessarily Have Better-resourced Library Web Teams. A Review of: Connell, Ruth Sara.

    Directory of Open Access Journals (Sweden)

    Suzanne Lewis

    2008-12-01

    Full Text Available Objective – To discover how library Web teams’ staffing, backgrounds, tools, and professional development differ among various types of academic libraries.Design – Survey.Setting – Academic libraries in the United States.Subjects – Academic library Web team members.Methods – A systematic sample of every twelfth institution on The Carnegie Classification of Institutions of Higher Education list was used to establish a sample group. A Web search was carriedout to identify each institution’s library Web site and contact information for the Web site designer or most appropriate alternative person. Institutions were excluded from the sample if they had no Web site at all, had no library Web site, had a Web site that did not mention a library, or had a Spanish language Web site. In September 2006 an e-mail was sent to the contact for each institution in the sample group asking them to participate in an online survey. A follow up e-mail was sent two weeks later and the survey closed after one month. The survey respondents were asked to identify their institutions so that analysis of the results in relation to the sizeand type of institution could be carried out. The researchers used a simplified version of the Carnegie classification to sort the responding institutions into five main groups.Main Results – The systematic sample consisted of 288 institutions (sample size 6.5%. The profile of the responding institutions was as follows: associate’s colleges (35.5%, baccalaureate colleges (18.2%, master’s colleges and universities (20.9%, doctorate-granting universities (9% and special focus institutions (15.5%. A total of 110 institutions completed the survey, yielding a response rate of 38.19%, although not all respondents answered all the survey questions. The final sample of 110 was 2.5% of the total 4384 institutions on the Carnegielist. Seventy-one per cent of institutions with multiple libraries shared Web teams, with two-year colleges more likely (91.7% to share a Web team than four-year or above institutions (60.9%. The majority of responding institutions (94.4% used in-house library Web site design, with only 5.6% of respondents outsourcing this task.Nearly half (49% of respondents indicated that library Web design was done by one person and even the larger libraries did not necessarily have larger Web teams. Very few Web team members (4.9% had Web design as their primary role; the majority (83.5% indicated that it was just one component of their job. Web team members from master’s- and doctorate-granting institutions were more likely to have taught themselves Web design, while those from associate, baccalaureate and special focus colleges were more likely to have taken Web design courses. For all respondents, the most commonly listed quality for selection to the Web team was an interest in Web design and the most valued skill for library Web designers was the ability to organise information effectively.Knowledge of Web authoring software and basic HTML coding were the most commonly listed knowledge requirements for Web team members. A significant number of respondents indicated that they or other Web team members did not have access to Web authoring (36.9% and image editing (52% software. Generally (except for two very large institutions, the larger institutions were more likely to use database-driven systems for their library Web sites and the smaller institutions were more likely to use content management systems. Associate’s and special focus colleges were less likely than other types of institutions to use either database driven or content management systems. Associate’s institutions were more likely to achieve ADA (Americans with Disabilities Act Web accessibility compliance. Only 48.6% of respondents utilised usability testing during Web site design.Conclusion – The author expected that institutions providing higher levels of education would have better-resourced Web design and training, but the results of the survey did not support this expectation. One reason why associate’s colleges performed better than other institutions in some areas of Web design may be that these colleges tend to offer more Web design and computer technology courses than baccalaureate, master’s and doctorate-granting institutions. Web site design and testing attracted fewer resources than might be expected in academic libraries. Across all types of institutions, Web design tended to be the responsibility of a small team or one person, with most Web designers having other responsibilities apart from the library’s Web site. Just over half of the institutions surveyed did not implement usability testing of their library Web sites.

  14. The National Shipbuilding Research Program, 1990 Ship Production Symposium, Paper No. 4B-1: Solving SARA Compliance with Computerized Hazardous Materials Tracking

    National Research Council Canada - National Science Library

    Johnston, Don; Schoenleber, Dave

    1990-01-01

    ...) has forced facilities to keep track of hazardous materials as never before. EPCRA contains five major reporting requirements including planning notification, emergency release notification, Material Safety Data Sheet (MSDS...

  15. MULTICULTURALISM AND RELIGIOUS-BASED CONFLICT: EVENTS OF CONFLICT BASED ON ETHNICITY, RELIGION, RACE, AND INTER-GROUP RELATIONS (SARA IN THE CITY OF PONTIANAK

    Directory of Open Access Journals (Sweden)

    Lailial Muhtifah

    2013-06-01

    Full Text Available There is a tendency of similar idea that caught the conflict prevention and management efforts nowadays to the articles of the Charter of Medina which was religious-based and containing the theory of civil society. It I mostly on the handling of conflict which tends to take preventive measures and to stop the conflict directly, as well as making a comprehensive synergistic effort to mange conflict. Conflict prevention is a core component of a comprehensive Conflict Management Program. This paper explores the conflict that occurred in Ponianak between a group of people from ethnic Dayak and members of an Islamic organization in 2012 which includes an important lesson for the people of West Kalimantan, both for the government and the community elements especially in dealing with a dispute between different groups of people. An integrative prevention has been proven to be able to answer the question of handling a conflict that has a potential to escalate into a full-scale riot. This work concludes that an integrative conflict handling model may become a viable alternative model to be adopted by the community of West Kalimantan in particular and other societies in general. A synergic integrative conflict handling model that reflects local wisdom of the people of Pontianak is expected to inspire real peace for various communities with a multicultural background. Key words: multicultural, religious-based conflict, ethnicity, religion

  16. Tumedad ained kirjanduses ja päriselt / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare

    2007-01-01

    Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005

  17. The European single currency project and the concept of convergence for European welfare states – the ideal and the reality / Philip Haynes

    Index Scriptorium Estoniae

    Haynes, Philip

    2013-01-01

    Artiklis analüüsitakse, kas euroalasse kuuluvad riigid (sh Eesti) on heaolult (nt tööhõive, vaesusrisk, sotsiaalkulud per head jne.) lähenenud üksteisele ning millised on seda soodustavad tegurid

  18. 圖書館事業與交流/Location Choice Patterns of Computer Use in the United States/Zhixian Yi; Philip Q. Yang

    Directory of Open Access Journals (Sweden)

    Zhixian Yi; Philip Q. Yang Zhixian Yi; Philip Q. Yang

    2009-10-01

    Full Text Available There is little research on the patterns of computer use outside home or work. This study examines who is more or less likely to use a computer at a location other than work or home by using the 2002–2004 General Social Survey data and logistic regression analysis. Demographic variables (such as age, race, marital status, and region, socioeconomic status (such as education and family income, self employment, and satisfaction with financial situation are significant predictors of computer use at locations other than home or work; but occupation and gender make no difference. The findings will help institutions to provide computer infrastructure support and services for customers in public places, and especially help schools and libraries to improve computer labs and services. 過去在探討非居家或上班電腦使用地點的研究微之又微。本文針對2002-2004 年總體社會調查資料進行對數回歸分析,分析更可能或不可能在家外或工作外使用電腦的族群。研究結果顯示,人口變量如年齡、種族、婚姻狀況、地區,社經地位(教育程度、家庭收入),是否自謀職業,是否對財政狀況滿意等,為解釋是否在家外或工作外使用電腦的有效自變量,然而職業和性別的影響則不顯著。本研究結果對於社會機構在公共場所提供計算機基礎設施和服務,以及對學校和圖書館改善電腦使用室及服務具有參考價值。 頁次:116-130

  19. Case note: HvJ EU (zaaknr. C-446/09, C-495/09, LJN BU7493: Philips/Nokia)

    NARCIS (Netherlands)

    Hugenholtz, P.B.

    2013-01-01

    Verzoeken om een prejudiciële beslissing ingediend door de Rechtbank van eerste aanleg te Antwerpen en de Court of Appeal, England and Wales, (Civil Division) bij beslissingen van 4 respectievelijk 26 november 2009. Bestrijding van binnenbrengen in de Unie van namaakgoederen en door piraterij

  20. Effect of inherent misalignment and head motion in neurological PET/MR with the Philips Ingenuity TF – phantom and patient study

    Energy Technology Data Exchange (ETDEWEB)

    Teuho, Jarmo; Johansson, Jarkko; Saunavaara, Virva; Kemppainen, Nina; Teräs, Mika [Turku PET Centre, Turku University Hospital, Turku (Finland)

    2014-07-29

    The aim of the study was to evaluate the effect of misalignment and head motion on image quantification in PET/MR with a novel brain phantom and a healthy control group. The phantom was imaged at two time points in PET/MR, concurrently with PET and PET/CT. Phantom images were evaluated visually and the relative difference in hemispheric accumulation was calculated. Difference in cortical accumulation in a healthy control group was evaluated from non-attenuation corrected (NAC) and MR attenuation corrected (MRAC) images. Regional ROI mean values from F{sup 18}-FDG ratio images and regional hemispheric asymmetries were calculated. Controls were divided to high and low asymmetry groups. A student’s t-test (p<0.005) for group difference and NAC versus MRAC data was performed. Finally, mean PET-MR registration parameters were measured. Only the first phantom scan exhibited asymmetry in lateral frontal cortex (17%) and temporal cortex (19%). Correcting the misalignment of 2.63mm reduced the asymmetry to less than 5%, to a level seen in PET and PET/CT. A significant asymmetry was found in the temporal and parietal cortex between groups in MRAC data with no significant asymmetry in NAC data. Asymmetries in affected MRAC data in temporal and parietal cortex were 9.4% and 11.7%. NAC data from both groups had asymmetry less than 5% in all regions. Both groups had significant y- and z-translation, while only the asymmetry group had significant z-rotation and x-translation. The shift in x-, y-, or z-direction in both groups was less than 4 mm, with no significant differences. Thus, PET-MRAC misalignment may cause under- and overestimation of attenuation in the lines of response on opposite sides of the cortical regions, resulting to asymmetric difference between the hemispheres. Our findings stress the need for novel QC procedures for PET-MR alignment and suggest confirming the quality of PET-MRAC alignment from PET-NAC images.

  1. Shifting from Ziegler-Natta to Philips-type catalyst? A simple and safe access to reduced titanium systems for ethylene polymerization

    KAUST Repository

    Popoff, Nicolas

    2011-09-22

    Silica-supported titanium(IV) chloride is readily reduced by Mashima and co-workers\\' reagent (1-methyl-3,6-bis(trimethylsilyl)-1,4-cyclohexadiene) to afford materials active in ethylene polymerisation without need of aluminum alkyl cocatalyst. © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Shifting from Ziegler-Natta to Philips-type catalyst? A simple and safe access to reduced titanium systems for ethylene polymerization.

    Science.gov (United States)

    Popoff, Nicolas; Espinas, Jeff; Gouré, Eric; Boyron, Olivier; Le Roux, Erwan; Basset, Jean-Marie; Gauvin, Régis M; De Mallmann, Aimery; Taoufik, Mostafa

    2011-12-01

    Silica-supported titanium(IV) chloride is readily reduced by Mashima and co-workers' reagent (1-methyl-3,6-bis(trimethylsilyl)-1,4-cyclohexadiene) to afford materials active in ethylene polymerisation without need of aluminum alkyl cocatalyst. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Leading a multinational is history in practice: The use of invented traditions and narratives at AkzoNobel, Shell, Philips and ABN AMRO

    NARCIS (Netherlands)

    Kroeze, R.; Keulen, S.

    2013-01-01

    This article states that the distinctiveness of business history and its convincingness can be improved by the concept of invented tradition and narrative. After a theoretical overview it suggests that the narrative approach explains the way leaders operate in practice. It argues that with a

  4. 2015 Philip S. Portoghese Medicinal Chemistry Lectureship. Curing Hepatitis C Virus Infection with Direct-Acting Antiviral Agents: The Arc of a Medicinal Chemistry Triumph.

    Science.gov (United States)

    Meanwell, Nicholas A

    2016-08-25

    The development of direct-acting antiviral agents that can cure a chronic hepatitis C virus (HCV) infection after 8-12 weeks of daily, well-tolerated therapy has revolutionized the treatment of this insidious disease. In this article, three of Bristol-Myers Squibb's HCV programs are summarized, each of which produced a clinical candidate: the NS3 protease inhibitor asunaprevir (64), marketed as Sunvepra, the NS5A replication complex inhibitor daclatasvir (117), marketed as Daklinza, and the allosteric NS5B polymerase inhibitor beclabuvir (142), which is in late stage clinical studies. A clinical study with 64 and 117 established for the first time that a chronic HCV infection could be cured by treatment with direct-acting antiviral agents alone in the absence of interferon. The development of small molecule HCV therapeutics, designed by medicinal chemists, has been hailed as "the arc of a medical triumph" but may equally well be described as "the arc of a medicinal chemistry triumph".

  5. Study of the dependence of resolution temporal activity for a Philips gemini TF PET/CT scanner by applying a statistical analysis of time series

    International Nuclear Information System (INIS)

    Sanchez Merino, G.; Cortes Rpdicio, J.; Lope Lope, R.; Martin Gonzalez, T.; Garcia Fidalgo, M. A.

    2013-01-01

    The aim of the present work is to study the dependence of temporal resolution with the activity using statistical techniques applied to the series of values time series measurements of temporal resolution during daily equipment checks. (Author)

  6. The Relativity of Free Will and Liability of the Tobacco Industry – Deconstruction of a Myth. Brazilian Meditations on the United States v. Philip Morris et al. Case

    Directory of Open Access Journals (Sweden)

    Eugênio Facchini Neto

    2016-12-01

    Full Text Available This essay analyzes one of the main arguments put forward by the tobacco industry to support the absence of liability for damages caused by tobacco addiction: the free will of the smoker. Through the contribution of other sciences, it seeks to demonstrate how young people, targeted audience of marketing campaigns of the tobacco industry, were extremely vulnerable to tobacco industry maneuvers to attract them to their products. It also demonstrates the addictive effects of nicotine and how it practically neutralizes the ability of an adult deciding to stop the addiction. At the end, it sustains the relativization of the principle of free will.

  7. Tööjõu vaba liikumine : kas tõsine oht Eesti tööturule? / Epp Kallaste, Kaia Philips

    Index Scriptorium Estoniae

    Kallaste, Epp

    2004-01-01

    Eesti inimeste suhtumisest ja selle muutumisest EL-i riikides töötamisse, tuginedes SaarPolli 2000. ja 2003. aasta küsitlustele. Eesti tööjõu senisest ajutisest töökogemusest välismaal. Tabelid. Diagramm

  8. Gazing at places we have never been: landscape, heritage and identity: a comment on Jörg Rekittke and Philip Paar: 'Past pictures: landscape visualization with digital tools'

    NARCIS (Netherlands)

    van der Laarse, R.; Bloemers, T.; Kars, H.; van der Valk, A.; Wijnen, M.

    2010-01-01

    Acknowledging the paradigmatic impact of new digital techniques, this contribution questions the depoliticized conceptualization of landscape in modern landscape visualizations from a theoretical and historical perspective. Long after the earlier periods of formal gardening and landscaping, the

  9. Leping tikkijaga = Контракт вышивальщика / Philip Vlasov

    Index Scriptorium Estoniae

    Vlasov, Philip

    2010-01-01

    Itaalia uue põlvkonna kunstnikust Francesco Vezzolist. Lõpetas 1995. aastal "Central St. Martin's School of Art" Londonis, elab ja töötab Milaanos. Kunstniku töövõtted on tikkimine, fotokollaaž, video, performance'id, reklaam, teleshow, film. Kasutab oma projektides kuulsusi

  10. Genome Sequences of Mycobacteriophages Amgine, Amohnition, Bella96, Cain, DarthP, Hammy, Krueger, LastHope, Peanam, PhelpsODU, Phrank, SirPhilip, Slimphazie, and Unicorn.

    Science.gov (United States)

    Anders, Kirk R; Barekzi, Nazir; Best, Aaron A; Frederick, Gregory D; Mavrodi, Dmitri V; Vazquez, Edwin; Amoh, Nana Yaa A; Baliraine, Frederick N; Buchser, William J; Cast, Thomas P; Chamberlain, Carmen E; Chung, Hui-Min; D'Angelo, William A; Farris, Christian T; Fernandez-Martinez, Mariceli; Fischman, Haley D; Forsyth, Mark H; Fortier, Anna G; Gallo, Kara F; Held, Greta J; Lomas, Miguel A; Maldonado-Vazquez, Natalia Y; Moonsammy, Claudia H; Namboote, Peace; Paudel, Sudip; Polley, Sarah-Elizabeth M; Reyes, Gabriella M; Rubin, Michael R; Saha, Margaret S; Stukey, Joseph; Tobias, Tristan D; Garlena, Rebecca A; Stoner, Ty H; Cresawn, Steven G; Jacobs-Sera, Deborah; Pope, Welkin H; Russell, Daniel A; Hatfull, Graham F

    2017-12-07

    We report the genome sequences of 14 cluster K mycobacteriophages isolated using Mycobacterium smegmatis mc²155 as host. Four are closely related to subcluster K1 phages, and 10 are members of subcluster K6. The phage genomes span considerable sequence diversity, including multiple types of integrases and integration sites. Copyright © 2017 Anders et al.

  11. EC-seal products: seals and sensibilities (TBT aspects of the panel and Appellate Body reports) / Philip I. Levi, Donald H. Regan

    Index Scriptorium Estoniae

    Levi, Philip I.

    2015-01-01

    Maailma Kaubandusorganisatsiooni Tehniliste kaubandustõkete leping (TBT) ja selle järgimine hülgetoodete importimisel ja turustamisel Norrast ja Kanadast Euroopa Liitu. EL määrused keelustavad hülgetooted

  12. Academic dreamers to leaders: The emergence of the mathematics and science for minority students ((MS)(2)) program at Philips Academy Andover

    Science.gov (United States)

    Beckham, Jerrell K.

    (MS)2 is a summer program for high achieving minority students interested in math and science careers. It was started in 1977. The Program is located at Phillips Academy in Andover Massachusetts. Phillips Academy is one of the nation's oldest college preparatory schools. The school was founded in 1778. Current U.S. President George Bush attended Phillips Academy and his father before him. The students in (MS)2 attend Phillips Academy in the summertime, along with regular Summer Session students. The (MS)2 Program represents about a fifth of the students at Phillips Academy Summer Session. At present the program is made up of African Americans, Latinos, and Native American students who attend a number of different public schools throughout the nation. This dissertation explores the experiences of students in this program spanning nearly a quarter of a central. My research seeks to understand and shred additional light on how certain outreach programs might help along the pipeline in regard to improving minority representation in mathematics and science fields. Also, this narrative hopes to not only paints a more complex pictures of the experiences of minorities in schools, but seeks to serve the larger public interest by challenging some of the popular renditions and myths of the failure of Blacks, Latino/as, and Native Americans in schooling (Ogbu 2003), as oppose to certain aspects of schooling and society continuing to failing them.

  13. Motion-Compensated Estimation of Delivered Dose during External BeamRadiation Therapy: Implementation in Philips’ Pinnacle3 Treatment Planning System

    NARCIS (Netherlands)

    Bharat, S.; Parikh, P.; Noel, C.; Meltsner, M.; Bzdusek, K.; Kaus, M.

    2012-01-01

    Purpose: Recent research efforts investigating dose escalation techniques for three-dimensional conformal radiation therapy (3D CRT) andintensity modulated radiation therapy (IMRT) have demonstrated great benefit when high-dose hypofractionated treatment schemes are implemented16,21. The use of

  14. Implications of the Dynamics of the New Networked Economy for E-Business Start-Ups: The Case of Philips' Access Point.

    Science.gov (United States)

    Tovstiga, George; Fantner, Ernest J.

    2000-01-01

    Examines implications of the networked economy for e-commerce business start-ups. Revisits the notion of "value" and "value creation" in a network context. Examines "value" relative to technological innovation. Looks at implications of the network environment for the organization and transformation of the enterprise's…

  15. Muusikamaailm : Ozawa festival Matsumotos. Pidustused Utrechtis ülehomseni. Philip Glassi uusteos Salzburgis. Alexandre Lagoya surnud. Frangiz Ali-Zade asutamine Luzernis. Wolfgang Wagner 80 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    H.Saito mälestusfestivalist "Saito Kinen" 29.08-12.09 Jaapanis. Utrechti varajase muusika pidustustest 27.08-5.09. P.Glassi teose "Requiem, Bardo and Nimanakaya" maailmaesiettekandest Salzburgi suvefestivalil 28.08. A. Lagoya elust ja tegevusest. Luzerni festivali resideerivaks heliloojaks oli F.Ali-Zade. W. Wagneri tegevusest impressaariona

  16. Cross-Cultural Competency in the General Purpose Force: Training Strategies and Implications for Future Operations

    Science.gov (United States)

    2013-04-09

    the Behavioral and Social Sciences Research Report 1951, October 2011. 29 Zimbardo, Phillip. The Lucifer Effect : Understanding How...12. 13 Phillip Zimbardo, The Lucifer Effect : Understanding How Good People Turn Evil, (New York, NY: Random House, Inc., 2007), p. 353-355. Dr...culture and language will enhance the effectiveness of the GPF. Using the same body of research, this paper will delineate the key However, the

  17. Study of the dependence of resolution temporal activity for a Philips gemini TF PET/CT scanner by applying a statistical analysis of time series; Estudio de la dependencia de la resolucion temporal con la actividad para un escaner PET-TAC philips gemini TF aplicando un analisis estadistico de series temporales

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez Merino, G.; Cortes Rpdicio, J.; Lope Lope, R.; Martin Gonzalez, T.; Garcia Fidalgo, M. A.

    2013-07-01

    The aim of the present work is to study the dependence of temporal resolution with the activity using statistical techniques applied to the series of values time series measurements of temporal resolution during daily equipment checks. (Author)

  18. Screamy Bird

    DEFF Research Database (Denmark)

    Tarby, Sara; Cermak, Daniel

    2016-01-01

    Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016.......Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016....

  19. ADHD and Present Hedonism: time perspective as a potential diagnostic and therapeutic tool.

    Science.gov (United States)

    Weissenberger, S; Klicperova-Baker, M; Zimbardo, P; Schonova, K; Akotia, D; Kostal, J; Goetz, M; Raboch, J; Ptacek, R

    2016-01-01

    The article draws primarily from the behavioral findings (mainly psychiatric and psychological observations) and points out the important relationships between attention-deficit/hyperactivity disorder (ADHD) symptoms and time orientation. Specifically, the authors argue that there is a significant overlap between the symptoms of ADHD and Present Hedonism. Present Hedonism is defined by Zimbardo's time perspective theory and assessed by Zimbardo Time Perspective Inventory. Developmental data on Present Hedonism of males and females in the Czech population sample (N=2201) are also presented. The hypothesis of relationship between ADHD and Present Hedonism is mainly derived from the prevalence of addictive behavior (mainly excessive Internet use, alcohol abuse, craving for sweets, fatty foods, and fast foods), deficits in social learning, and increased aggressiveness both in ADHD and in the population scoring high on Present Hedonism in the Zimbardo Time Perspective Inventory. We conclude that Zimbardo's time perspective offers both: 1) a potential diagnostic tool - the Zimbardo Time Perspective Inventory, particularly its Present Hedonism scale, and 2) a promising preventive and/or therapeutic approach by the Time Perspective Therapy. Time Perspective Therapy has so far been used mainly to treat past negative trauma (most notably, posttraumatic stress disorder); however, it also has value as a potential therapeutic tool for possible behavioral compensation of ADHD.

  20. Aplicaciones del equipo automático de difracción de polvo marca Philips modelo PW-1700 instalado en el Instituto "Eduardo Torroja" de la construcción y del cemento

    Directory of Open Access Journals (Sweden)

    Sagrera, José Luis

    1984-12-01

    Full Text Available In this article, the author has the purpose to give a general view of the applications of the automatic equipment of X ray diffraction purchased by the I.E.T.c.c., quoting the main software programs used by the team in its qualitative, quantitative and crystallographic analysis, as well as to give a simplified account of the data that can be obtained from de computer storage.

    El autor pretende, en este artículo, dar una visión general de las aplicaciones del equipo automático de difracción de rayos X adquirido por el I.E.T.c.c., citando los principales programas del software que utiliza el equipo en sus análisis cualitativos, cuantitativos y cristalográficos, además de una relación simplificada de datos que pueden obtenerse de la memoria del ordenador.

  1. Análisis cuantitativo por difracción de rayos X de cuarzo-alfa en una matriz de cemento portland anhidro con equipos Philips modelo PW-1710 y PW-1700

    Directory of Open Access Journals (Sweden)

    Sagrera Moreno, J. L.

    1985-12-01

    Full Text Available This article, explains the necessary steps to obtained a quartz-low quantitative analysis in an anhydrous Portland cement matrix, by means of a simple addition of a little quantity of Corydon to the sample and applying a simple mathematical formula which gives directly the crystalline compound percentage which determination is required. With this method the labour of preparation samples with internal standard, necessary to obtain a straight line, is eliminated. The need of having a pure sample of the compound which is to be analyzed is also excluded. The method is simple and rapid, offering an acceptable precision in the quantitative crystalline compounds determination.

    En el presente artículo se explican los pasos necesarios para realizar un análisis cuantitativo de cuarzo-alfa en una matriz de cemento portland anhidro, mediante la simple adición de una pequeña cantidad de CORINDÓN a la muestra y la aplicación de una sencilla fórmula matemática (1 que directamente proporciona el porcentaje del compuesto cristalino que se quiere determinar. Con este método se elimina la laboriosa preparación de muestras con patrón interno, necesarias para obtener una curva de calibrado. Además se elimina la necesidad de poseer muestra pura del componente que se quiere analizar. El método es sencillo y rápido, dando una precisión aceptable en las determinaciones cuantitativas de compuestos cristalinos.

  2. Análisis cuantitativo de cuarzo-alfa en mezclas de cemento portland anhidro y calcita sintética por difracción de rayos X con equipo Philips PW-1700

    Directory of Open Access Journals (Sweden)

    Sagrera-Moreno, J. L.

    1985-09-01

    Full Text Available In this article there are explained the necessary steps to make up a quantitative analysis of alpha-quartz applying the technique of rays X diffraction, in artificial mixtures of anhydrous portland cement and synthetic calcite, which contents are known.

    En el presente artículo se explican los pasos necesarios para realizar un análisis cuantitativo de cuarzo-alfa aplicando la técnica de difracción de rayos X en mezclas artificiales de cemento portland anhidro y calcita sintética, cuyos contenidos son conocidos.

  3. Philip C. Kolin. Williams : A Streetcar Named Desire. Stephen J. Bottoms. Albee : Who’s Afraid of Virginia Woolf ? Christopher Bigsby. Contemporary American Playwrights.

    Directory of Open Access Journals (Sweden)

    Liliane Kerjan

    2006-04-01

    Full Text Available Deux grands classiques du patrimoine théâtral américain font ici l’objet de monographies bien illustrées, complétées par une bibliographie et la chronique des mises en scène majeures, dans la collection Plays in Production. Il s’agit de retracer la carrière d’une pièce et ses métamorphoses, de saisir ce « comment faire des choses avec des mots » cher à Albee, ce « Blanche, c’est vous », comme l’annonce le programme de Seattle à tous ceux qui souffrent d’injustice et croisent le malheur, dans ...

  4. Philip C. Kolin. Williams : A Streetcar Named Desire. Stephen J. Bottoms. Albee : Who’s Afraid of Virginia Woolf ? Christopher Bigsby. Contemporary American Playwrights.

    OpenAIRE

    Liliane Kerjan

    2006-01-01

    Deux grands classiques du patrimoine théâtral américain font ici l’objet de monographies bien illustrées, complétées par une bibliographie et la chronique des mises en scène majeures, dans la collection Plays in Production. Il s’agit de retracer la carrière d’une pièce et ses métamorphoses, de saisir ce « comment faire des choses avec des mots » cher à Albee, ce « Blanche, c’est vous », comme l’annonce le programme de Seattle à tous ceux qui souffrent d’injustice et croisent le malheur, dans ...

  5. Sotsiaalsete gruppide erinevused tööhõives ja töötuses = Disparities in social groups in employment and unemployment / Raul Eamets, Kaia Philips, Margus Tuvikene

    Index Scriptorium Estoniae

    Eamets, Raul, 1964-

    2006-01-01

    Üks võimalik sotsiaalse sidususe/tõrjutuse hindamisviis on vaadata hõive- ja töötuse lõhesid erinevate gruppide vahel. Soolised erinevused hõivatuses, erinevused töötuse määrades. Tabelid. Skeemid

  6. Response to Comments on: "Nonlinear phenomena, bifurcations, and routes to chaos in an asymmetrically supported rotor-stator contact system" by Philip Varney, Itzhak Green [J. Sound Vib. 336 (2015) 207-226

    Science.gov (United States)

    Varney, Philip; Green, Itzhak

    2017-11-01

    The authors would like to thank the discussers for their interest in the paper. The discussers raise several objections to the original work; namely, that the state-space equations of motion were derived incorrectly, thus rendering the original results incorrect by association. In actuality, the error in the original state-space equations (Eq. (16) in the original work) is typographic only. This, in conjunction with a typographic error in Table A1, prevented the discussers from replicating a subset of the original results (though the discussers were able to replicate many of the results presented in the original work, despite the presumed error in the equations). These typographic errors are rectified here. In addition, results are presented here corresponding to the solution that would have been obtained had the state-space equations been incorrect in the manner presumed by the discussers. Finally, the discussers state that the results presented in the original work do not adhere to physical principles because the steady-state solution in one case indicates contact even though the linear response to imbalance is less than the radial clearance. This seeming discrepancy is also addressed here.

  7. [Proceedings of the 4th International Workshop of the Lower Cretaceous Cephalopod Team (IGCP-Project 362) / Peter F. Rawson and Philip J. Hoedemaeker (editors)]: Ammonite stratigraphy of the Valanginian to Barremian for the Mediterranean region

    NARCIS (Netherlands)

    Klein, J.; Hoedemaeker, P.J.

    1999-01-01

    Since the 2nd Workshop of the Lower Cretaceous Cephalopod Team in Mula, Spain (Hoedemaeker et al., 1993), several ammonite zones and ammonite horizons have been introduced that still have not be inserted in the standard zonation of the Mediterranean area. In the present survey (1) the different

  8. Epimural Indicator Phylotypes of Transiently-Induced Subacute Ruminal Acidosis in Dairy Cattle

    OpenAIRE

    Wetzels, Stefanie U.; Mann, Evelyne; Metzler-Zebeli, Barbara U.; Pourazad, Poulad; Qumar, Muhammad; Klevenhusen, Fenja; Pinior, Beate; Wagner, Martin; Zebeli, Qendrim; Schmitz-Esser, Stephan

    2016-01-01

    The impact of a long-term subacute rumen acidosis (SARA) on the bovine epimural bacterial microbiome (BEBM) and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a 1-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA...

  9. ADHD and Present Hedonism: time perspective as a potential diagnostic and therapeutic tool

    Czech Academy of Sciences Publication Activity Database

    Weissenberger, S.; Klicperová-Baker, Martina; Zimbardo, P.G.; Schonova, K.; Akotia, D.; Košťál, Jaroslav; Goetz, M.; Raboch, J.; Ptáček, R.

    -, č. 12 (2016), s. 2963-2971 ISSN 1178-2021 R&D Projects: GA ČR GA15-11062S Institutional support: RVO:68081740 Keywords : ADHD * time perspective * ZTPI * Zimbardo * addiction * alcoholism * delinquency * video games * problematic Internet use Subject RIV: AN - Psychology Impact factor: 2.198, year: 2016

  10. lidmate se houding teenoor kerkvereniging in die ngk- familie: 'n ...

    African Journals Online (AJOL)

    Liezel

    9 Januarie, p. 7. 2005. NGK 'reeds aan't skeur'. VS-moderator reageer op berigte. 16 Mei, p. 1. WEITEN, W. 2002. Psychological themes and variations. 5th ed. California: Wadsworth Thomson. Learning. ZIMBARDO, P.G. & LEIPPE, M.R.. 1991. The psychology of attitude change and social influence. New York: McGraw-Hill ...

  11. ADHD and Present Hedonism: time perspective as a potential diagnostic and therapeutic tool

    Czech Academy of Sciences Publication Activity Database

    Weissenberger, S.; Klicperová-Baker, Martina; Zimbardo, P.G.; Schonova, K.; Akotia, D.; Košťál, Jaroslav; Goetz, M.; Raboch, J.; Ptáček, R.

    -, č. 12 (2016), s. 2963-2971 ISSN 1178-2021 R&D Projects: GA ČR GA15-11062S Institutional support: RVO:68081740 Keywords : ADHD * time perspective * ZTPI * Zimbardo * addiction * alcohol ism * delinquency * video games * problematic Internet use Subject RIV: AN - Psychology Impact factor: 2.198, year: 2016

  12. KURVA PHILLIPS DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Maichal Maichal

    2012-12-01

    Full Text Available This paper aims to analyze the existence of the Philips curve in the Indonesian economy, 2000Q1-2010Q3. The results obtained by using OLS method shows that the expectations augmented Philips curve and the New Keynesian Philips curve models cannot give a clear results of Philips curve existence in the Idonesia economy. Shocks variable such as percentage change of exchange rates and crude oil prices provide a very small effect on the inflation rate in Indonesia. Furthermore, the results obtained by using GMM method on the hybrid model of the New Keynesian Philips curve shows that the Philips curve exists in the Indonesian economy.

  13. Book Review: Commemoration as Conflict: Space, Memory and Identity in Peace Processes

    DEFF Research Database (Denmark)

    McQuaid, Sara Dybris

    2016-01-01

    Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7......Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7...

  14. Butanol/Gasoline Test Plan

    Science.gov (United States)

    2012-03-01

    authorities. METHODS FOR CLEANING UP: Contain spillage and then collect with non-combustible absorbent material, (e.g. sand, soil , diatomaceous earth...SARA 311/312 Hazards: Fire Hazard, Acute Health Hazard, and Chronic Health Hazard CERCLA SECTION 103 and SARA SECTION 304 (RELEASE TO THE ENVIROMENT

  15. En ny flugt ind i skoven

    DEFF Research Database (Denmark)

    Haarder, Jon Helt

    2008-01-01

    Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner......Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner...

  16. Journal of Food Technology in Africa - Vol 7, No 3 (2002)

    African Journals Online (AJOL)

    Identification of Lactic Acid Bacteria isolated from Opaque beer (Chibuku) for potential use as a starter culture. Chamunorwa A Togo, Sara B Sara B. Feresu, Anthony Mutukumira. http://dx.doi.org/10.4314/jfta.v7i3.19239 · Performance of different strains of Pleurotus species under Ghanaian conditions. K Vowotor, M Obodai.

  17. Use and Access of Grey Literature in Special Libraries may be Hindered by Lack of Visibility and Cataloguing. A review of: Ranger, Sara L. “Grey Literature in Special Libraries: Access in Use.” Publishing Research Quarterly 21.1 (Spring 2005: 53-63.

    Directory of Open Access Journals (Sweden)

    David Hook

    2006-03-01

    Full Text Available Objective – To examine the barriers to making grey literature (literature not controlled by commercial publishers easier to access in special libraries. Design – Interviews. Setting – Variety of special libraries (government, corporate and specialized academic in the United States. Subjects – Sixteen librarians from fourteen organizations in Washington, Michigan and Texas were interviewed. Four of the organizations were government libraries, four were corporate libraries and five were specialized academic libraries. One of the interviews was not used because the organization did not maintain a collection of paper‐based grey literature. Methods – Librarians were selected as possible interview subjects via three methods: some were previously familiar with the author; some were referred to the author by friends, family and colleagues; two candidates volunteered in response to a presentation of the project at a professional meeting. Interviews were conducted between February 2002 and May 2003. A standard set of seven questions were used, but often followed with further questions. The interviews were conducted either in the library or the librarian’s office. The interviews were tape‐recorded and the answers were written down. Interviews typically lasted between fifteen and thirty minutes and asked about the current state, holdings, access and use of grey literature in the special library. Main Results – Results from the interviews suggest a wide variance in the percentage of users that access grey literature. Grey literature was used less in the corporate libraries than the academic and government libraries. The percentage of the collection made up of grey literature also varied widely between the different libraries. Reports were found to be the most popular form of grey literature, although most of the libraries reported owning conference proceedings and newsletters in addition to reports. One interesting observation found during the interviews was that most of the users of grey literature are also producers of grey literature. The librarians surveyed reported that some of the reasons for using grey literature included use in research, to write (often more grey literature, interest in the topic, for class assignments, as records of previous practices, for localized studies, and for creating models and practices. Results found that for the libraries surveyed, much of the grey literature remains uncatalogued and what has been catalogued was done using a variety of methods. Over half of the libraries surveyed had their grey literature accessible online. Conclusion – Two main reasons were cited as explanations for why grey literature was not used as much as it should be: lack of cataloguing and visibility. In many of the libraries surveyed, much of the grey literature had not been catalogued, making it difficult to find and use the resources. Reasons cited for not cataloguing grey literature include lack of time, funds and/or knowledge. As well, in many of the libraries surveyed, it was found that the holdings of grey literature were not readily visible to the users, so users were not even aware that it existed. To improve the awareness and accessibility of grey literature, the author recommends regional depositories for grey literature, international standards for cataloguing and more cooperation between special libraries.

  18. REPRESENTASI ANTI DISKRIMINASI PADA FILM KARTUN 3D ZOOTOPIA (KAJIAN SEMIOTIKA ROLAND BARTHES

    Directory of Open Access Journals (Sweden)

    Ali Muqoddas

    2016-12-01

    Full Text Available Isu diskriminasi SARA seperti tiada habisnya terjadi di dunia ini, begitu juga di Indonesia. Hal ini mengakibatkan tema-tema tentang SARA menjadi sensitif ketika dibahas atau pun difilmkan. Hal ini mengakibatkan jarang ditemui film yang mengangkat tentang SARA. Lain halnya dengan Walt Disney. Walt Disney baru-baru ini merilis film kartun 3D yang mengangkat tema anti diskriminasi SARA yang berjudul Zootopia. Film ini menjadi menarik karena isu diskriminasi SARA yang diangkat dibalut dengan konsep yang kreatif hingga sensivitas isu SARA tersebut menjadi berkurang. Representasi anti diskriminasi SARA pada film Zootopia ini selanjutnya dikaji dengan metode semiotika Roland Barthes dengan pendekatan deskriptif kualitatif. Berdasarkan dari analisis, dapat disimpulkan bahwa film Zootopia memuat pesan ideologi tentang anti diskriminasi SARA bahwa kedudukan manusia dimata manusia yang lain pada hakikatnya adalah sama. Setiap manusia berhak dan wajib memperlakukan dan diperlakukan secara bijak tanpa memperdulikan background asal manusia itu sendiri. Penghargaan pada setiap individu tidak didasarkan pada faktor keturunan, ras, suku ataupun agama, namun didasarkan pada prestasi dari individu itu sendiri. Kata Kunci: diskriminasi SARA, Zootopia, Roland Barthes Abstract The issue of racial discrimination as an endless happen in this world, so also in Indonesia. This resulted in the themes of SARA be sensitive when discussed or filmed. This resulted in a rare film that raised about SARA. Another case with Walt Disney. Walt Disney recently released 3D animated film that mengangat theme of anti-discrimination SARA entitled Zootopia. This film is interesting because racial discrimination issues raised wrapped with a creative concept to the sensitivity of the racial issues be reduced. SARA anti-discrimination representation on film Zootopia is further studied with Roland Barthes semiotic methods with qualitative descriptive approach. Based on the analysis, it can

  19. 76 FR 41300 - Probable Economic Effect of Providing Duty-Free, Quota-Free Treatment for Imports From Least...

    Science.gov (United States)

    2011-07-13

    ... CONTACT: Project Leader Philip Stone, Office of Industries (202-205-3424 or philip.stone@usitc.gov ), or..., 2011. By order of the Commission. James R. Holbein, Secretary to the Commission. [FR Doc. 2011-17575...

  20. Siidii / Kreete Reval

    Index Scriptorium Estoniae

    Reval, Kreete

    2003-01-01

    Heliplaatidest: Philip Glass & Philip Glass Ensemble "Naqoyqatsi - Life As War", "Sigur Ros", Arvo Pärt "Orient & Occident", Vello Orumets "Sõbrale", "Nuspirit Helsinki", Beck "Sea Change", Barbariz Pastacas "Dehemardik Datis"

  1. Aed, imelise rahu paik / Merilen Mentaal

    Index Scriptorium Estoniae

    Mentaal, Merilen, 1972-

    2008-01-01

    Chelsea Flower Show 2008 võistelnud aedadest. Kujundajateks Philip Nash, Andy Sturgeon, Buono Gazerwitz, Trevor Tooth, Philip Nixon, Thomas Hoblyn, Robert Myers, Tom Stuart-Smith, Yvonne Innes ja Olivia Harrison. 11 värv. ill

  2. The use of sodic monensin and probiotics for controlling subacute ruminal acidosis in sheep

    Directory of Open Access Journals (Sweden)

    Elizabeth Schwegler

    2015-02-01

    Full Text Available The aim of this work was to validate a protocol for induction of subacute ruminal acidosis (SARA (Experiment 1 and test the efficiency of probiotic Saccharomyces cerevisiae or monensin to avoid pH ruminal drops in sheep (Experiment 2. In Experiment 1, six ewes were fasted for two days and then fed most with concentrate during four days. Ewes in this protocol had ruminal fluid pH below 6.0 and kept it for 75 consecutive hours. In Experiment 2, 18 sheep were distributed into three groups: Control (CG, n = 6, monensin (MG, n = 6 and probiotic group (PG, n = 6. SARA was induced according Experiment 1. PG had lower pH (5.7 ± 0.1 than CG (6.0 ± 0.1 (P = 0.05, while MG (5.7 ± 0.1 was similar to both during SARA induction. SARA induction reduced ruminal protozoa population (P < 0.05 and increased chloride concentrations in ruminal fluid (P < 0.01. In serum, SARA increased concentrations of phosphorus (P < 0.01, AST (P < 0.01 and GGT (P < 0.01, but reduced LDH (P < 0.01. In conclusion, the protocol used for SARA induction was able to maintain ruminal pH between 5.5-6.0 for more than 48 hours. However, monensin and probiotics supplementation was not effective in preventing changes in ruminal and serum parameters during SARA.

  3. Alteration in Fecal Microbiota Associated with Grain-induced Subacute Ruminal Acidosis Challenge in Dairy Cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    in the field are often not detected. Thus, other and better markers of SARA are needed. The purpose of this research was to study the feces microbiome during SARA and assess the possibilities of using feces microbial markers as indicators of SARA. Methods: Six lactating, rumen cannulated, Danish Holstein cows...... were used in a blocked design study including two blocks. In the first block, two cows received control diet and two cows received SARA-challenge diet. In the second block, former control cows received SARA diet while two new cows received control diet. Cows received a total mixed ration (TMR; 24......% concentrate) for four weeks before the trial. SARA was induced by gradual substitution of 40% of TMR with grain pellets (50:50 wheat:barley) over 3 days. Full SARA diet was fed for four days. Rumen pH was measured continuously by indwelling probes (eCow). Feces samples were taken at 9 am and 9 pm on last day...

  4. Epimural indicator phylotypes of transiently-induced subacute ruminal acidosis in dairy cattle

    Directory of Open Access Journals (Sweden)

    Stefanie Urimare Wetzels

    2016-03-01

    Full Text Available The impact of a long-term subacute rumen acidosis (SARA on the bovine epimural bacterial microbiome (BEBM and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a one-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA isolation (4 sampling time points per cow: at the baseline before concentrate was fed, after the first SARA challenge, after the challenge break, and after the second SARA challenge. Ruminal pH was continuously monitored. The microbiome was determined using Illumina MiSeq sequencing of the 16S rRNA gene (V345 region. In total 1,215,618 sequences were obtained and clustered into 6,833 operational taxonomic units (OTUs. Campylobacter and Kingella were the most abundant OTUs (16.5% and 7.1%. According to ruminal pH dynamics, the second challenge was more severe than the first challenge. Species diversity estimates and evenness increased during the challenge break compared to all other sampling time points (P<0.05. During both SARA challenges, Kingella- and Azoarcus-OTUs decreased (0.5 and 0.4 fold-change and a dominant Ruminobacter-OTU increased during the challenge break (18.9 fold-change; P<0.05. qPCR confirmed SARA-related shifts. During the challenge break noticeably more OTUs increased compared to other sampling time points. Our results show that the BEBM re-establishes the baseline conditions slower after a SARA challenge than ruminal pH. Key phylotypes that were reduced during both challenges may help to establish a bacterial fingerprint to facilitate understanding effects of SARA conditions on the BEBM and their consequences for the ruminant host.

  5. Epimural Indicator Phylotypes of Transiently-Induced Subacute Ruminal Acidosis in Dairy Cattle.

    Science.gov (United States)

    Wetzels, Stefanie U; Mann, Evelyne; Metzler-Zebeli, Barbara U; Pourazad, Poulad; Qumar, Muhammad; Klevenhusen, Fenja; Pinior, Beate; Wagner, Martin; Zebeli, Qendrim; Schmitz-Esser, Stephan

    2016-01-01

    The impact of a long-term subacute rumen acidosis (SARA) on the bovine epimural bacterial microbiome (BEBM) and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a 1-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA isolation (4 sampling time points per cow: at the baseline before concentrate was fed, after the first SARA challenge, after the challenge break, and after the second SARA challenge). Ruminal pH was continuously monitored. The microbiome was determined using Illumina MiSeq sequencing of the 16S rRNA gene (V345 region). In total 1,215,618 sequences were obtained and clustered into 6833 operational taxonomic units (OTUs). Campylobacter and Kingella were the most abundant OTUs (16.5 and 7.1%). According to ruminal pH dynamics, the second challenge was more severe than the first challenge. Species diversity estimates and evenness increased during the challenge break compared to all other sampling time points (P < 0.05). During both SARA challenges, Kingella- and Azoarcus-OTUs decreased (0.5 and 0.4 fold-change) and a dominant Ruminobacter-OTU increased during the challenge break (18.9 fold-change; P < 0.05). qPCR confirmed SARA-related shifts. During the challenge break noticeably more OTUs increased compared to other sampling time points. Our results show that the BEBM re-establishes the baseline conditions slower after a SARA challenge than ruminal pH. Key phylotypes that were reduced during both challenges may help to establish a bacterial fingerprint to facilitate understanding effects of SARA conditions on the BEBM and their consequences for the ruminant host.

  6. Highlighting Effects of Current Globalization Tenets, Namely Democracy, Capitalism, and Cultural Transformation, on the Arab Islamic Middle East

    Science.gov (United States)

    2009-06-01

    Jansen, The Dual Nature of Islamic Fundamentalism (Ithica: Cornell University Press, 1997), 24. 26 Ariel Merari, “ Psychological Aspects of Suicide...Terrorism,” in Bruce Bongar, Lisa M. Brown, Larry E. Beutler, James N. Breckenridge, and Phillip G. Zimbardo (eds.), Psychology of Terrorism, 110. 16...8 $14 .2 Portugal 0 $219 .5 Tunisia 98 $34 .5 Puerto R ico 0 $0 .0 Turkey 99 .8 $482 .0 Q atar 77 .5 $65 .8 Turkm enistan 89 $26 .2

  7. Farewell to Arms: A Plan for Evaluating the 2001 Authorization for Use of Military Force and Its Alternatives

    Science.gov (United States)

    2014-09-01

    measures. For instance, the executive branch has relied on it to authorize warrantless electronic surveillance of citizens, pursue targeted killings of...House Trade Paperback ed., 2014, original copyright Random House Publishing 1984), 245. 490 Breckenridge and Zimbardo, “The Strategy of Terrorism...enhance legitimacy, Congress should codify relevant “ offences against the Law of Nations.” Specifically, it should interpret and codify the laws of war

  8. Time perspective and smoking, obesity, and exercise in a community sample.

    Science.gov (United States)

    Guthrie, Lori C; Lessl, Kristen; Ochi, Onyinyechukwu; Ward, Michael M

    2013-03-01

    To examine associations between time perspective and smoking, body mass index, and exercise. In this community-based survey, adults reported smoking and exercise habits and weight and height and completed the Zimbardo Time Perspective Inventory. Subjects (N=265) who were more future oriented reported more frequent exercise, but were more likely to smoke. Fatalistic and hedonistic present orientations were not associated with smoking, obesity, or exercise. Time perspective is not consistently associated with common health behaviors in adults.

  9. Perceived Stress in Adults Aged 65 to 90: Relations to Facets of Time Perspective and COMT Val158Met Polymorphism

    OpenAIRE

    Michael Rönnlund; Elisabeth Åström; Rolf Adolfsson; Maria G. Carelli

    2018-01-01

    This study examined the relation between perceived stress and time perspective (views of past, present, future) in a population-based sample of older adults (65–90 years, N = 340). The Perceived Questionnaire (PSQ index) was used to measure stress and the Swedish version of the Zimbardo Time Perspective Inventory (S-ZTPI) was used to operationalize time perspective. Unlike the original inventory, S-ZTPI separates positive and negative aspects of a future time perspective and we hypothesized t...

  10. Tidsperspektiv, mindfulness och stress: : en korrelationsstudie

    OpenAIRE

    Koudriavtseva, Antonina

    2017-01-01

    Denna studie undersökte det potentiella sambandet mellan tidsperspektiv, mindfulness och upplevd stress. Kring 60 studenter besvarade en online-enkät som inkluderade den svenska versionen av Zimbardo Time Perspective Inventory, Five Facets of Mindfulness Questionnaire och Perceived Stress Scale. Analyserna omfattade bivariata korrelationer, multipel linjär regressionsanalys och path analys. I linje med hypoteserna indikerade resultaten statistiskt signifikanta samband mellan mindfulness, ett ...

  11. Time Perspective, Life Satisfaction and Social Comparison Orientation in University Students

    OpenAIRE

    Nazmiye ÇİVİTCİ; Hülya ŞAHİN BALTACI

    2018-01-01

    The aim of this study was to examine the predictive power of time perspective for the life satisfaction and social comparison in university students. The participants (n= 441; 321 female and 120 male) are undergraduate students at a state university. The data of the study were collected through the Zimbardo Time Perspective Inventory, The Satisfaction with Life Scale and IOWA-Netherlands Social Comparison Orientation Measure. In order to determine the prediction power of the time ...

  12. Sex and dark times' strategy: The Dark Triad and time perspective.

    Science.gov (United States)

    Moraga, Fernando R G; Nima, Ali A; Garcia, Danilo

    2017-03-01

    We investigated the effect of sex on associations between dark traits and time perspective dimensions. Responses by participants (N = 338) to the Short Dark Triad Inventory and the Zimbardo Time Perspective Inventory showed that while sex was involved in different time perspective associations of Machiavellianism, psychopathy, and narcissism, it did not moderate the dark times' strategy. © 2017 The Institute of Psychology, Chinese Academy of Sciences and John Wiley & Sons Australia, Ltd.

  13. Terrorism 101 - Knowledge about the What and Why of Terrorism as a State and Local Law Enforcement Competency

    Science.gov (United States)

    2008-09-01

    Zimbardo, “How Social Science can Reduce Terrorism,” The Chronicle of Higher Education (2004), http://www.socialpsychology.org/ pdf /chronicle04. pdf ...the children of Satan ; believers must prepare for the second coming of Yahweh by taking action “Religious” is one of five “motivations...Christian Identity Groups – Christian Bible is used to justify reasons behind beliefs • U.S. Constitution is extension of Bible • Philosophy is based

  14. ADHD and Present Hedonism: time perspective as a potential diagnostic and therapeutic tool

    Directory of Open Access Journals (Sweden)

    Weissenberger S

    2016-11-01

    Full Text Available S Weissenberger,1 M Klicperova-Baker,2 P Zimbardo,3 K Schonova,1 D Akotia,1 J Kostal,2 M Goetz,4 J Raboch,1 R Ptacek1 1First Medical Faculty, Charles University, 2Institute of Psychology, Academy of Sciences of the Czech Republic, Praha, Czech Republic; 3Department of Psychology, Stanford University, Stanford, CA, USA; 4Second Faculty of Medicine, Department of Child Psychiatry, Charles University, Motol University Hospital, Praha, Czech RepublicAbstract: The article draws primarily from the behavioral findings (mainly psychiatric and psychological observations and points out the important relationships between attention-deficit/hyperactivity disorder (ADHD symptoms and time orientation. Specifically, the authors argue that there is a significant overlap between the symptoms of ADHD and Present Hedonism. Present Hedonism is defined by Zimbardo’s time perspective theory and assessed by Zimbardo Time Perspective Inventory. Developmental data on Present Hedonism of males and females in the Czech population sample (N=2201 are also presented. The hypothesis of relationship between ADHD and Present Hedonism is mainly derived from the prevalence of addictive behavior (mainly excessive Internet use, alcohol abuse, craving for sweets, fatty foods, and fast foods, deficits in social learning, and increased aggressiveness both in ADHD and in the population high on Present Hedonism. We conclude that Zimbardo’s time perspective offers both: 1 a potential diagnostic tool – the Zimbardo Time Perspective Inventory, particularly its Present Hedonism scale, and 2 a promising preventive and/or therapeutic approach by the Time Perspective Therapy. Time Perspective Therapy has so far been used mainly to treat past negative trauma (most notably, posttraumatic stress disorder; however, it also has value as a potential therapeutic tool for possible behavioral compensation of ADHD.Keywords: ADHD, time perspective, ZTPI, Zimbardo, addiction, alcoholism, delinquency

  15. Effects of time perspective and self-control on procrastination and Internet addiction

    OpenAIRE

    Kim, Jinha; Hong, Hyeongi; Lee, Jungeun; Hyun, Myoung-Ho

    2017-01-01

    Background and aims College students experiencing stress show tendencies to procrastinate and can develop Internet addiction problems. This study investigated the structural relationship between time perspective and self-control on procrastination and Internet addiction. Methods College students (N?=?377) residing in South Korea completed the following questionnaires: the Pathological Internet Use Behavior Symptom Scale for Adults, the Zimbardo Time Perspective Inventory, the Self-Control Rat...

  16. Ocean acidification increases the accumulation of toxic phenolic compounds across trophic levels, supplement to: Jin, Peng; Wang, Tifeng; Liu, Nana; Dupont, Sam; Beardall, John; Boyd, Philip W; Riebesell, Ulf; Gao, Kunshan (2015): Ocean acidification increases the accumulation of toxic phenolic compounds across trophic levels. Nature Communications, 6, 8714

    KAUST Repository

    Jin, Peng; Wang, Tifeng; Liu, Nana; Dupont, Sam; Beardall, John; Boyd, Philip W; Riebesell, Ulf; Gao, Kunshan

    2016-01-01

    Increasing atmospheric CO2 concentrations are causing ocean acidification (OA), altering carbonate chemistry with consequences for marine organisms. Here we show that OA increases by 46-212% the production of phenolic compounds in phytoplankton grown under the elevated CO2 concentrations projected for the end of this century, compared with the ambient CO2 level. At the same time, mitochondrial respiration rate is enhanced under elevated CO2 concentrations by 130-160% in a single species or mixed phytoplankton assemblage. When fed with phytoplankton cells grown under OA, zooplankton assemblages have significantly higher phenolic compound content, by about 28-48%. The functional consequences of the increased accumulation of toxic phenolic compounds in primary and secondary producers have the potential to have profound consequences for marine ecosystem and seafood quality, with the possibility that fishery industries could be influenced as a result of progressive ocean changes.

  17. Short-Communication: Revisiting conclusions of the report titled, "The impact of psychological factors on self-reported sleep disturbance among people living in the vicinity of wind turbines," by Leila Jalali, Mohammad-Reza Nezhad-Ahmadi, Mahmood Gohari, Philip Bigelow, & Stephen McColl, published in environmental research, volume 148, July 2016, 401-410.

    Science.gov (United States)

    Palmer, William K G

    2017-05-01

    The research report concluded, "It appears that self-reported sleep reported of participants may be associated to the indirect effects of visual and attitudinal cue and concern about property devaluation rather than distance to the nearest WT's or noise as itself." Careful reading of the report shows that the conclusions presented are not supported by the data provided in the report. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-07

    Mar 7, 2018 ... ation with the pump units of various types operating in the optimal and correct mode. ... In the existing irrigation systems of the Sara- ... Journal of Fundamental and Applied Sciences is licensed under a Creative Commons ...

  19. Annual report of the Grenoble Institute of nuclear science

    International Nuclear Information System (INIS)

    Vignon, B.

    1988-01-01

    Research in theoretical nuclear physics; peripheral reactions and intermediate energy physics; characteristics of reaction mechanisms in heavy ion collisions; nuclear structure; fundamental interactions; interdisciplinary studies; experimental methods and instrumentation; and the SARA accelerator is presented [fr

  20. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  1. Preventing Pressure Sores

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  2. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  3. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  4. Hella hingega karmid naised / Krista Kaer

    Index Scriptorium Estoniae

    Kaer, Krista

    1996-01-01

    Tänapäeva kriminaalromaani inglise ja ameerika autoritest (Dame Phyllis Dorothy James, Joan Smith, Lynda La Plante (inglise); Sara Paretsky, Sue Grafton, Patricia Cornwell (ameerika) ja nende poolt loodud naisdetektiivi kujudest

  5. Bridging the gap between farmers and supermarkets in Nicaragua ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2014-07-03

    Jul 3, 2014 ... Elder chose to study smallholder farmers after working in Kenya as an ... Combining this data will help her gain expertise in qualitative and quantitative work. ... Sara Elder interviews smallholder farmers in Nicaragua.

  6. 75 FR 80037 - Poultry Programs; Notice of Request for an Extension and Revision of a Currently Approved...

    Science.gov (United States)

    2010-12-21

    ... DEPARTMENT OF AGRICULTURE Agricultural Marketing Service [Doc. No. AMS-PY-10-0098] Poultry... David Bowden, Jr., Chief, Standards, Promotion, & Technology Branch; Poultry Programs, AMS, U.S.... FOR FURTHER INFORMATION CONTACT: Sara Lutton, Standards, Promotion, & Technology Branch; Poultry...

  7. Investigating Asphaltenes Composition in Crude Oil Samples using ...

    African Journals Online (AJOL)

    MBI

    2015-12-22

    Dec 22, 2015 ... composition of asphaltenes by Iatroscan TLC-FID method was compared with the weight% of asphaltenes precipitated. ... SARA in the crude oil samples were determined in this work ..... Fractionation and characterization of.

  8. Nutrition from aquaculture and home gardens in Cambodia

    International Development Research Centre (IDRC) Digital Library (Canada)

    is about 76% carbohydrate, only 10% protein, and only 14% fat. Foods from animal sources ... to increase and diversify food production and provide low- ... Senior Program Specialist, Ottawa, Canada (awesley@idrc.ca) or. Sara Ahmed, Senior ...

  9. Mind Over Matter: Methamphetamine

    Science.gov (United States)

    ... Teaching Guide and Series / Methamphetamine Mind Over Matter: Methamphetamine (Meth) Print Order Free Publication in: English Spanish ... paranoia, aggressiveness, and hallucinations. The Brain's Response to Methamphetamine Hi, my name's Sara Bellum. Welcome to my ...

  10. Are You Shopping Smart for Prescription Drugs?

    Science.gov (United States)

    ... work well for them through the CR Best Buy Drugs program. Photo courtesy of Sara Jorde Photography A ... National Library of Medicine, the Consumer Reports Best Buy Drugs program helps consumers discuss drug choices with their ...

  11. Policy challenges in modern health care

    National Research Council Canada - National Science Library

    Mechanic, David

    2005-01-01

    ... for the Obesity Epidemic KENNETH E. WARNER 99 8 Patterns and Causes of Disparities in Health DAVID R. WILLIAMS 115 9 Addressing Racial Inequality in Health Care SARA ROSENBAUM AND JOEL TEITELBAU...

  12. Pop / Tõnis Kahu

    Index Scriptorium Estoniae

    Kahu, Tõnis, 1962-

    2008-01-01

    Heliplaatidest: Get Cape. Wear Cape. Fly "Searching For The Hows And Whys", The Black Crowes "Warpaint", Jonny Greenwood "There Will Be Blood", Tegan & Sara "The Con", Teräsbetoni "Myrskyntuoja", REM "Accelerate"

  13. 76 FR 11494 - List of Recipients of Indian Health Scholarships Under the Indian Health Scholarship Program

    Science.gov (United States)

    2011-03-02

    ... Collins, Sara Jane, University of Oklahoma, Cherokee Nation, Oklahoma Cook, David D., Rocky Vista... University, Oglala Sioux Tribe of the Pine Ridge Reservation, South Dakota Jim, Leroy, The Fielding Institute...

  14. 77 FR 44310 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2012-07-27

    ... JACINTA YEUNG CHEONG CHANG MICHAEL YIO-HOW CHENG NICOLAS VINCENT CHI TELLY TAI HSUAN CHINOY SAMIR MUSTAPHA... TONJA YVONNE SU JIN CHIN SU XIAOBO SARA SHAO SUEN SAMSON C. L. SY KEVIN NEIL TAN LAI HING THARALDSEN...

  15. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family ... play_arrow How is the delivery of a child affected by the mother's spinal cord injury? play_ ...

  16. Technical Guidance for Hazardous Analysis, Emergency Planning for Extremely Hazardous Substances

    Science.gov (United States)

    This current guide supplements NRT-1 by providing technical assistance to LEPCs to assess the lethal hazards related to potential airborne releases of extremely hazardous substances (EHSs) as designated under Section 302 of Title Ill of SARA.

  17. the capacity of megasphaera elsdenii strain ncimb 41125 to control ...

    African Journals Online (AJOL)

    David

    SARA include grain treatment to reduce starch degradation, feed additives such as ... Keywords: Megasphaera elsdenii, ruminal acidosis, dairy cattle, beef cattle, sheep, ...... Mastitis. Retained foetal membranes. Metritis/endometritis. Ketosis.

  18. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Kayvan Etebari1 Leila Matindoost2. Department of Sericulture, Faculty of Natural Resources, University of Guilan, Somehe Sara, Iran; Department of Entomology, Faculty of Agriculture, University of Guilan, Rasht, Iran ...

  19. Bacteriophage-antibiotic synergism to control planktonic and biofilm ...

    African Journals Online (AJOL)

    Bacteriophage-antibiotic synergism to control planktonic and biofilm producing clinical isolates of Pseudomonas aeruginosa. Amina Amal Mahmoud Nouraldin, Manal Mohammad Baddour, Reem Abdel Hameed Harfoush, Sara AbdelAziz Mohamed Essa ...

  20. Reforming the American Military Officer Personnel System

    Science.gov (United States)

    2015-12-02

    Lamping Lewis, Henry Leonard, Julia Pollak, Christopher Guo and Bernard Rostker, Tour Lengths, Permanent Changes of Station, and Alternatives for...Raymond E. Conley, Stephanie Young, William A. Williams, Jeffrey Engstrom, Barbara Bicksler, Sara Beth Elson, Joseph Jenkins , Lianne Kennedy

  1. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  2. Preventing Pressure Sores

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  3. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  4. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  5. Review of the Scientific Evidence of Using Population Normative Values for Post-Concussive Computerized Neurocognitive Assessments

    Science.gov (United States)

    2016-02-10

    R, Virginia Commonwealth University  Dr. Chris Giza, Professor of Pediatric Neurology and Neurosurgery, UCLA Brain Injury Research Center October...Sara Higgins , MPH Analyst, Grant Thornton LLP Kendal Brown, MBA Management Analyst, Information Innovators, Inc. Margaret Welsh Management

  6. Eczema (Atopic Dermatitis)Treatment

    Science.gov (United States)

    ... Lubricate or moisturize the skin two to three times a day using ointments such as petroleum jelly. Moisturizers should be ... Freeman Peter Hubbard Sara Jones Tony Lee Lara R. ... Kinyoun Lecture Series 2016 Kinyoun Lecture 2015 Kinyoun Lecture 2014 Kinyoun ...

  7. Depression among Congestive Heart Failure Patients: Results of a Survey from Central China

    Directory of Open Access Journals (Sweden)

    JPMS

    2011-10-01

    Full Text Available Tabish Hussain, Li Yu Shu, Xiang Cheng, Tumenjavkhlan Sosorburam, A.Seid Adji, Sara Tajammul, Aamra Sartaj (Union Hospital, Tongji Medical College, Huazhong University of Sciences and Technology, Wuhan, China (pages 38-42

  8. Assessing the viability of the Species at Risk Act in managing commercial exploitation and recovery of threatened and endangered marine fish in Canada

    OpenAIRE

    Druce, Courtney Danielle

    2012-01-01

    Commercially exploited threatened or endangered marine fish are consistently declined for listing under Canada’s Species at Risk Act (SARA), largely due to predicted socio-economic impacts associated with SARA’s prohibitions. However, commercial exploitation can be exempted from SARA’s general prohibitions. If exemptions were utilized, commercially exploited species could benefit from other aspects of SARA listing, and support continued economic opportunities for fishers. I conducted a litera...

  9. An Investigation into Rumen Fungal and Protozoal Diversity in Three Rumen Fractions, during High-Fiber or Grain-Induced Sub-Acute Ruminal Acidosis Conditions, with or without Active Dry Yeast Supplementation.

    Science.gov (United States)

    Ishaq, Suzanne L; AlZahal, Ousama; Walker, Nicola; McBride, Brian

    2017-01-01

    Sub-acute ruminal acidosis (SARA) is a gastrointestinal functional disorder in livestock characterized by low rumen pH, which reduces rumen function, microbial diversity, host performance, and host immune function. Dietary management is used to prevent SARA, often with yeast supplementation as a pH buffer. Almost nothing is known about the effect of SARA or yeast supplementation on ruminal protozoal and fungal diversity, despite their roles in fiber degradation. Dairy cows were switched from a high-fiber to high-grain diet abruptly to induce SARA, with and without active dry yeast (ADY, Saccharomyces cerevisiae ) supplementation, and sampled from the rumen fluid, solids, and epimural fractions to determine microbial diversity using the protozoal 18S rRNA and the fungal ITS1 genes via Illumina MiSeq sequencing. Diet-induced SARA dramatically increased the number and abundance of rare fungal taxa, even in fluid fractions where total reads were very low, and reduced protozoal diversity. SARA selected for more lactic-acid utilizing taxa, and fewer fiber-degrading taxa. ADY treatment increased fungal richness (OTUs) but not diversity (Inverse Simpson, Shannon), but increased protozoal richness and diversity in some fractions. ADY treatment itself significantly ( P PERMANOVA, P = 0.0001, P = 0.0452, P = 0.0068, Monte Carlo correction, respectively, and location was a significant factor ( P = 0.001, Monte Carlo correction) for protozoa. Diet-induced SARA shifts diversity of rumen fungi and protozoa and selects against fiber-degrading species. Supplementation with ADY mitigated this reduction in protozoa, presumptively by triggering microbial diversity shifts (as seen even in the high-fiber diet) that resulted in pH stabilization. ADY did not recover the initial community structure that was seen in pre-SARA conditions.

  10. Peranan Raja La Maddaremmeng Dalam Penyebaran Islam Di Bone

    Directory of Open Access Journals (Sweden)

    Nasruddin Nasruddin

    2014-06-01

    Full Text Available King Bone to Lamaddaremmeng XIII has a very large role and has the effect of early-early development of Islam in southern Sulawesi. He Maddaremeng is committed to enforce Sharia Law. His efforts were Eliminating slavery, Addition parewa Sara, to revamp the governance structure by adding positions previously unknown structure that positions parewa sara, eradication of idols, eliminating the arbitrary actions on others, Equal rights. Other efforts are trying to eliminate the differences in the degree of the community.

  11. Targets and special materials

    International Nuclear Information System (INIS)

    Blanc, R.; Bouriant, M.; Richaud, J.P.

    1997-01-01

    The target preparation group supplied a large number of samples to nuclear physicists for experiments using SARA and also other accelerators throughout the world. Particular preparation and projects include: 208 Pb, 116 Cd, 6 LiF, 123 Sb, In and Ta targets, strippers for SARA and GANIL, optical silicone disks for POLDER and GRAAL experiments, active participations for the AMS project and finally filament preparation for the GENEPI project. (authors)

  12. Ruminal acidosis: a review with detailed reference to the controlling agent Megasphaera elsdenii NCIMB 41125

    OpenAIRE

    Meissner, H.H.; Henning, P.H.; Horn, C.H.; Leeuw, K-J.; Hagg, F.M.; Fouché, G.

    2010-01-01

    Ruminal acidosis is discussed with reference to causes and economic and health implications. Distinction is made between the acute form which with proper adaptation to high energy diets is seldom encountered and the more problematic chronic or sub-acute form, commonly referred to as sub-acute ruminal acidosis (SARA). Apart from stepwise transition from roughage to concentrates, methods adopted to reduce SARA include grain treatment to reduce starch degradation, feed additives such as buffers ...

  13. Paducah Gaseous Diffusion Plant site environmental report for 1988

    International Nuclear Information System (INIS)

    Rogers, J.G.; Jett, T.G.

    1989-05-01

    Quantities of nonradiological chemical emissions are not included in this report this year. An addendum that will include the information will be published after the Superfund Amendments Reauthorization Act (SARA) Title III report is issued on July 1, 1989. When the addendum is published, probably in late July, a summary of the SARA Title III 313 report will be included. The SARA report provides the community with the opportunity to lean about estimated quantities of certain toxic chemicals used at a facility that are routinely or accidentally released into the environment. The addendum that will be published after the SARA report will summarize the SARA report and is expected to include some additional ''large quantity'' chemicals used or stored at the facilities that are not required to be reported by SARA Title III but are known to be emitted from the facilities. The addendum will not be all inclusive but will provide emissions information on the major chemical emissions to the air, water, or land from processes at the facilities

  14. In vitro residual anti-bacterial activity of difloxacin, sarafloxacin and their photoproducts after photolysis in water

    International Nuclear Information System (INIS)

    Kusari, Souvik; Prabhakaran, Deivasigamani; Lamshoeft, Marc; Spiteller, Michael

    2009-01-01

    Fluoroquinolones like difloxacin (DIF) and sarafloxacin (SARA) are adsorbed in soil and enter the aquatic environment wherein they are subjected to photolytic degradation. To evaluate the fate of DIF and SARA, their photolysis was performed in water under stimulated natural sunlight conditions. DIF primarily degrades to SARA. On prolonged photodegradation, seven photoproducts were elucidated by HR-LC-MS/MS, three of which were entirely novel. The residual anti-bacterial activities of DIF, SARA and their photoproducts were studied against a group of pathogenic strains. DIF and SARA revealed potency against both Gram-positive and -negative bacteria. The photoproducts also exhibited varying degrees of efficacies against the tested bacteria. Even without isolating the individual photoproducts, their impact on the aquatic environment could be assessed. Therefore, the present results call for prudence in estimating the fate of these compounds in water and in avoiding emergence of resistance in bacteria caused by the photoproducts of DIF and SARA. - Assessment of the residual anti-bacterial efficacies of difloxacin, sarafloxacin and their photoproducts in water, and estimating their impact on the aquatic environment in inducing resistance to microorganisms.

  15. RNA structure alignment by a unit-vector approach.

    Science.gov (United States)

    Capriotti, Emidio; Marti-Renom, Marc A

    2008-08-15

    The recent discovery of tiny RNA molecules such as microRNAs and small interfering RNA are transforming the view of RNA as a simple information transfer molecule. Similar to proteins, the native three-dimensional structure of RNA determines its biological activity. Therefore, classifying the current structural space is paramount for functionally annotating RNA molecules. The increasing numbers of RNA structures deposited in the PDB requires more accurate, automatic and benchmarked methods for RNA structure comparison. In this article, we introduce a new algorithm for RNA structure alignment based on a unit-vector approach. The algorithm has been implemented in the SARA program, which results in RNA structure pairwise alignments and their statistical significance. The SARA program has been implemented to be of general applicability even when no secondary structure can be calculated from the RNA structures. A benchmark against the ARTS program using a set of 1275 non-redundant pairwise structure alignments results in inverted approximately 6% extra alignments with at least 50% structurally superposed nucleotides and base pairs. A first attempt to perform RNA automatic functional annotation based on structure alignments indicates that SARA can correctly assign the deepest SCOR classification to >60% of the query structures. The SARA program is freely available through a World Wide Web server http://sgu.bioinfo.cipf.es/services/SARA/. Supplementary data are available at Bioinformatics online.

  16. Los parlamentos hispano-mapuches bajo el reinado de Felipe III: la labor del padre Luis de Valdivia (1605-1617 = Os parlamentos hispânico-mapuches durante o reinado de Felipe III: a função do padre Luis de Valdivia (1605-1617 = The hispano-mapuche parlamentos under the reign of Philip III of Spain: the work of father Luis de Valdivia (1605-1617

    Directory of Open Access Journals (Sweden)

    Cepeda, José Manuel Zavala

    2014-01-01

    Full Text Available Durante o reinado de Felipe III são detectados elos intermediários entre as origens quinhentistas das instituições parlamentarias hispânico mapuches e sua etapa de plenitude, inaugurada em meados do século XVII. O grande impulsionador dos planos de pacificação no início do século XVII, foi o jesuíta Luís de Valdivia, que graças as sua aptidões diplomáticas, linguísticas e etnográficas consegue consolidar uma tradição de negociação fronteiriça hispânico-indígena marcada pela importância do diálogo, dos rituais, e da mediação linguística

  17. Book reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2010-12-01

    Full Text Available The Atlantic World, 1450-2000, edited by Toyin Falola & Kevin D. Roberts (reviewed by Aaron Spencer Fogleman The Slave Ship: A Human History, by Marcus Rediker (reviewed by Justin Roberts Extending the Frontiers: Essays on the New Transatlantic Slave Trade Database, edited by David Eltis & David Richardson (reviewed by Joseph C. Miller "New Negroes from Africa": Slave Trade Abolition and Free African Settlement in the Nineteenth-Century Caribbean, by Rosanne Marion Adderley (reviewed by Nicolette Bethel Atlantic Diasporas: Jews, Conversos, and Crypto-Jews in the Age of Mercantilism, 1500-1800, edited by Richard L. Kagan & Philip D. Morgan (reviewed by Jonathan Schorsch Brother’s Keeper: The United States, Race, and Empire in the British Caribbean, 1937-1962, by Jason C. Parker (reviewed by Charlie Whitham Labour and the Multiracial Project in the Caribbean: Its History and Promise, by Sara Abraham (reviewed by Douglas Midgett Envisioning Caribbean Futures: Jamaican Perspectives, by Brian Meeks (reviewed by Gina Athena Ulysse Archibald Monteath: Igbo, Jamaican, Moravian, by Maureen Warner-Lewis (reviewed by Jon Sensbach Left of Karl Marx: The Political Life of Black Communist Claudia Jones, by Carole Boyce Davies (reviewed by Linden Lewis Displacements and Transformations in Caribbean Cultures, edited by Lizabeth Paravisini-Gebert & Ivette Romero-Cesareo (reviewed by Bill Maurer Caribbean Migration to Western Europe and the United States: Essays on Incorporation, Identity, and Citizenship, edited by Margarita Cervantes-Rodríguez, Ramón Grosfoguel & Eric Mielants (reviewed by Gert Oostindie Home Cooking in the Global Village: Caribbean Food from Buccaneers to Ecotourists, by Richard Wilk (reviewed by William H. Fisher Dead Man in Paradise: Unraveling a Murder from a Time of Revolution, by J.B. MacKinnon (reviewed by Edward Paulino Tropical Zion: General Trujillo, FDR, and the Jews of Sos

  18. Valores y política: Análisis del perfil axiológico de los estudiantes universitarios de la ciudad de Buenos Aires (República Argentina)

    OpenAIRE

    Delfino, Gisela I.; Zubieta, Elena M.

    2011-01-01

    Para Rokeach (1968), los valores son un concepto clave en las Ciencias Sociales, la principal variable dependiente en los estudios culturales sobre la sociedad y la personalidad y la principal variable independiente en el estudio de las actitudes y la conducta social. Distintas investigaciones en Psicología Política revelan a los valores como importantes para la explicación de los fenómenos políticos (e.g., Barnea & Schwartz,1998; Caprara & Zimbardo, 2004; Delfino, Fernández & Zubieta, 2007)....

  19. Explaining why larks are future-oriented and owls are present-oriented: self-control mediates the chronotype-time perspective relationships.

    Science.gov (United States)

    Milfont, Taciano L; Schwarzenthal, Miriam

    2014-05-01

    Recent studies provide evidence for the chronotype-time perspective relationships. Larks are more future-oriented and owls are more present-oriented. The present study expands this initial research by examining whether the associations are replicable with other time perspective measures, and whether self-control explains the observed relationships. Chronotype was assessed with the Morningness-Eveningness Questionnaire and the basic associations with the Zimbardo Time Perspective Inventory were replicated in a sample of 142 New Zealand students, but not with other measures. Self-control mediated the influence of morningness on both future time perspective and delay of gratification. Implications of the findings are discussed.

  20. X-ray fluorescence spectrometry

    International Nuclear Information System (INIS)

    Vries, J.L. de.

    1976-01-01

    The seventh edition of Philips' Review of Literature on x-ray fluorescence spectrometry starts with a list of conference proceedings on the subject, organised by the Philips organisation at regular intervals in various European countries. It is followed by a list of bulletins. The bibliography is subdivided according to spectra, equipment, applications and absorption analysis

  1. CPAP Tips

    Medline Plus

    Full Text Available ... 6:09 Philips Respironics Dream Station CPAP Machine Review - Duration: 8:29. The CPAP Shop 264,785 ... DreamWear Philips Respironics CPAP BiPAP Mask Fitting and Review. FreeCPAPAdvice.com - Duration: 11:18. TheLankyLefty27 135,735 ...

  2. Course redesign for blended learning: modern optics for technical professionals.

    NARCIS (Netherlands)

    Collis, Betty; Bruijstens, Huib; van der Veen, Jan Kees

    2003-01-01

    Philips Centre for Technical Training (CTT) is responsible for the on-going professional education of scientific staff in Philips Research Laboratories worldwide. This article addresses the 'why' and 'how' of an evolution toward more flexible learning at the CTT in which various models for blended

  3. Euler-Lagrange modeling for a seven degree of freedom Manipulator

    NARCIS (Netherlands)

    Muñoz Arias, Mauricio; Scherpen, Jacquelien M.A.

    2011-01-01

    The Philips experimental robot arm is a kinematically redundant manipulator which is mainly aimed at increasing dexterity. The robot manipulator, developed by Philips Applied Technologies for domotic applications, has seven degrees of freedom and includes humanoid characteristics of a upper limb

  4. CPAP Tips

    Medline Plus

    Full Text Available ... 4:26 Philips Respironics Dream Station CPAP Machine Review - Duration: 8:29. The CPAP Shop 271,568 ... Philips Respironics Wisp Nasal CPAP Bilevel Mask Fitting Review Demonstration FreeCPAPAdvice com - Duration: 7:36. TheLankyLefty27 102, ...

  5. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Philip N Garner. Articles written in Sadhana. Volume 36 Issue 5 October 2011 pp 885-915. Current trends in multilingual speech processing · Hervé Bourlard John Dines Mathew Magimai-Doss Philip N Garner David Imseng Petr Motlicek Hui Liang Lakshmi Saheer Fabio Valente · More Details ...

  6. Cinema and Culture in Theory

    DEFF Research Database (Denmark)

    Christensen, Ove

    2005-01-01

    Om Philip Simpson, Andrew Utterson and K.J. Shepherdson (ed.), Film Theory. Critical Concepts in Media and Cultural Studies vols. 1–4.......Om Philip Simpson, Andrew Utterson and K.J. Shepherdson (ed.), Film Theory. Critical Concepts in Media and Cultural Studies vols. 1–4....

  7. 76 FR 63346 - Notice of Delays in Processing of Special Permits Applications

    Science.gov (United States)

    2011-10-12

    ... and is of significant impact or precedent-setting and requires extensive analysis. 4. Staff review..., Midvale, UT 4 11-30-2011 7887-P PSC Industrial Outsourcing, LP 4 11-30-2011 dba Philip West Industrial Services, Long Beach, CA. 8445-P PSC Industrial Outsourcing, LP 4 11-30-2011 dba Philip West Industrial...

  8. 76 FR 56493 - Notice of Delays in Processing of Special Permits Applications

    Science.gov (United States)

    2011-09-13

    ... public comment under review. 3. Application is technically complex and is of significant impact or... WESCO, Midvale, 4 11-30-2011 UT. 7887-P PSC Industrial 4 11-30-2011 Outsourcing, LP dba Philip West Industrial Services, Long Beach, CA. 8445-P PSC Industrial 4 11-30-2011 Outsourcing LP, dba Philip West...

  9. What Drives Health Professionals to Tweet About the HPV Vaccine?

    Centers for Disease Control (CDC) Podcasts

    This podcast features Philip Massey, PhD, MPH, an assistant professor at Drexel University and one of the authors of a recent study that looks at what motivates health professionals to tweet about the HPV vaccine. Philip answers questions about his research and what impact social media can have on public health and health care communication.

  10. 75 FR 4845 - Advice Concerning Possible Modifications to the U.S. Generalized System of Preferences, 2010...

    Science.gov (United States)

    2010-01-29

    ...: Information specific to this investigation may be obtained from Philip Stone, Project Leader, Office of Industries (202-205-3424 or philip.stone@usitc.gov ). For information on the legal aspects of this.... Issued: January 25, 2010. Marilyn R. Abbott, Secretary to the Commission. [FR Doc. 2010-1812 Filed 1-28...

  11. 75 FR 3247 - Advice Concerning Possible Modifications to the U.S. Generalized System of Preferences, 2009...

    Science.gov (United States)

    2010-01-20

    ... specific to this investigation may be obtained from Philip Stone, Project Leader, Office of Industries (202-205-3424 or philip.stone@usitc.gov ). For information on the legal aspects of these investigations... order of the Commission. Marilyn R. Abbott, Secretary to the Commission. [FR Doc. 2010-903 Filed 1-19-10...

  12. The prince, the glamour model and the Vikings’ lost language

    DEFF Research Database (Denmark)

    Kroonen, Guus

    2015-01-01

    The marriage of Sofia Hellqvist to Prince Carl Philip of Sweden could help resurrect the once-banned Elfdalian tongue......The marriage of Sofia Hellqvist to Prince Carl Philip of Sweden could help resurrect the once-banned Elfdalian tongue...

  13. Efficient and scalable IPv6 communication functions for wireless outdour lighting networks

    NARCIS (Netherlands)

    Mamo, S.T.

    2014-01-01

    Outdoor lighting today is becoming increasingly network-connected. The rapid development in wireless communication technologies makes this progress faster and competitive. Philips Research and Philips Lighting are part of the leading forces in exploration and development of a wide spectrum of

  14. Mobile 3D rotational X-ray: comparison with CT in sinus surgery

    International Nuclear Information System (INIS)

    Carelsen, B.; Bakker, N.H.; Boon, S.N.; Fokkens, W.J.; Freling, N.J.M.; Noordhoek, N.J.

    2004-01-01

    Clinical evaluation of a 3D rotational X-ray (3D-RX) system, comprising a modified Philips BV Pulsera C-arm system and a Philips 3D-RA workstation, demonstrates good diagnostic accuracy in functional endoscopic sinus surgery

  15. QDR 2001: Strategy-Driven Choices for America’s Security

    Science.gov (United States)

    2001-04-01

    McKenzie, Jr., USMC; Lieutenant Colonel Philip M. Ruhlman , USAF; Lieutenant Colonel John J. Spinelli, USA; and Captain Sam J. Tangredi, USN. Their...one chosen by their service: Lieutenant Colonel Frank McKenzie, USMC; Lieutenant Colonel Philip Ruhlman , USAF; Lieutenant Colonel John Spinelli, USA

  16. On-site customer analytics and reporting (OSCAR) : a portable clinical data warehouse for the in-house linking of hospital and telehealth data

    NARCIS (Netherlands)

    Thomaidis, P.

    2014-01-01

    This document conveys the results of the On-Site Customer Analytics and Reporting (OSCAR) project. This nine-month project started on January 2014 and was conducted at Philips Research in the Chronic Disease Management group as part of the H2H Analytics Project. Philips has access to telehealth data

  17. Comparative study of new 130mm diameter fast photomultipliers for neutron detectors

    International Nuclear Information System (INIS)

    Moszynski, M.; Costa, G.J.; Guillaume, G.; Heusch, B.; Huck, A.; Mouatassim, S.

    1991-01-01

    The present paper is a summary of the test measurements carried out using new 130 mm diameter fast photomultiplier tubes manufactured by Philips (France), EMI (England) and Hamamatsu (Japan), along with a comparison to the results obtained with the well known XP 2041 Philips model. These tubes will be used in large size neutron detectors

  18. Pinnacle: The Army’s Effort to Reform Its Accession Process

    Science.gov (United States)

    2011-02-24

    Philip Kotler emphasizes the importance of market conditions on organization design and strategy. According to Kotler , “Companies need to give the... principles also address the importance of selecting effective sales representatives. According to Kotler , “At the heart of a successful salesforce...Leadership, interview by author, December 6, 2010. 68 Philip Kotler , Marketing Management: Analysis, Planning, Implementation and Control

  19. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. G MADUMATHI, LIGY PHILIP. Articles written in Sadhana. Volume 42 Issue 6 June 2017 pp 1007-1024. Transport of E. coli in saturated and unsaturated porous media: effect of physiological state and substrate availability · G MADUMATHI, LIGY PHILIP S MURTY BHALLAMUDI · More Details ...

  20. Signing and security of Hue software

    NARCIS (Netherlands)

    Anastasov, I.

    2017-01-01

    Developing software for the Hue devices poses plenty of challenges among the engineers at Philips Lighting. These challenges arise at each stage of the Software Development Life-Cycle (SDLC). Improvement of it is of immense importance to the Philips Lighting. This report describes a project which

  1. Enhanced Defense Cooperation Agreement: Aquino III’s Balancing Strategy With The United States Against China

    Science.gov (United States)

    2017-03-01

    fallen over the decades. These variations were contingent upon the nature of the Philippines’ need to balance against a perceived contemporary threat...71 In April 2014, U.S. Ambassador to the Philippines Philip Goldberg and Philippine Defense Secretary Voltaire Gazmin signed the EDCA, with...visit, Philippine Defense Secretary Voltaire Gazmin and U.S. Ambassador Philip Goldberg signed the EDCA, which was

  2. Embedded Systems Design with 8051 Microcontrollers

    DEFF Research Database (Denmark)

    Karakahayov, Zdravko; Winther, Ole; Christensen, Knud Smed

    Textbook on embedded microcontrollers. Example microcontroller family: Intel 8051 with special emphasis on Philips 80C552. Structure, design examples and programming in C and assembler. Hardware - software codesign. EProm emulator.......Textbook on embedded microcontrollers. Example microcontroller family: Intel 8051 with special emphasis on Philips 80C552. Structure, design examples and programming in C and assembler. Hardware - software codesign. EProm emulator....

  3. CPAP Tips

    Medline Plus

    Full Text Available ... Up next Philips Respironics Dream Station CPAP Machine Review - Duration: 8:29. The CPAP Shop 268,918 ... Philips Respironics Wisp Nasal CPAP Bilevel Mask Fitting Review Demonstration FreeCPAPAdvice com - Duration: 7:36. TheLankyLefty27 102, ...

  4. Usaha La Sangkuru Patau Dalam Mengembangkan Agama Islam Di Kerajaan Wajo

    Directory of Open Access Journals (Sweden)

    Nasruddin Nasruddin

    2014-12-01

    Full Text Available La Sangkuru Patau is one of the Arung Matoa Wajo has substantial powers. His remarks could be a law and society Wajo stick to what he says. So when La Sangkuru Patau said that he had converted to Islam, the community participated Wajo also embraced Islam. Arung Matoa Wajo La Sangkuru with doing business in developing Islam in Wajo that bring Datu Sulaiman to provide Islamic religious instruction in public Wajo, then set up a sara officers' special charge of handling issues such royal Friday prayers, warnings Islamic holidays , then hold the officer cadre sara 'that will be placed outside the capital of the kingdom (Tosora, sara officers' given the facilities, such as free of taxes, as well as the parallel position to the position of indigenous stakeholders.

  5. Substorm associated radar auroral surges: a statistical study and possible generation model

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available Substorm-associated radar auroral surges (SARAS are a short lived (15–90 minutes and spatially localised (~5° of latitude perturbation of the plasma convection pattern observed within the auroral E-region. The understanding of such phenomena has important ramifications for the investigation of the larger scale plasma convection and ultimately the coupling of the solar wind, magnetosphere and ionosphere system. A statistical investigation is undertaken of SARAS, observed by the Sweden And Britain Radar Experiment (SABRE, in order to provide a more extensive examination of the local time occurrence and propagation characteristics of the events. The statistical analysis has determined a local time occurrence of observations between 1420 MLT and 2200 MLT with a maximum occurrence centred around 1700 MLT. The propagation velocity of the SARAS feature through the SABRE field of view was found to be predominately L-shell aligned with a velocity centred around 1750 m s–1 and within the range 500 m s–1 and 3500 m s–1. This comprehensive examination of the SARAS provides the opportunity to discuss, qualitatively, a possible generation mechanism for SARAS based on a proposed model for the production of a similar phenomenon referred to as sub-auroral ion drifts (SAIDs. The results of the comparison suggests that SARAS may result from a similar geophysical mechanism to that which produces SAID events, but probably occurs at a different time in the evolution of the event.

    Key words. Substorms · Auroral surges · Plasma con-vection · Sub-auroral ion drifts

  6. Perlindungan Hukum Kelompok Teisme dalam Sistem Negara Hukum Pancasila

    Directory of Open Access Journals (Sweden)

    Tomy Michael

    2017-05-01

    Full Text Available Di era global saat ini, suatu bangsa dituntut mampu bersaing dengan negara lain. Agar tidak terlepas dari unsur khas Indonesia maka penguatan Pancasila sebagai ideologi adalah keharusan. Pancasila yang melingkupi keragaman suku, agama, ras dan antar golongan (SARA kurang tercermin dalam UU Nomor 23 Tahun 2006. Permasalahan yang timbul yaitu hilangnya unsur khas Indonesia yaitu kepercayaan atau agama tradisional karena adanya diskriminasi dengan pengosongan kolom agama dalam Kartu Kelurga (KK dan Kartu Tanda Penduduk (KTP (Pasal 61 dan Pasal 64 UU No. 23-2006. Penelitian ini bertujuan untuk menganalisis korelasi hukum UU No. 23 tahun 2016 dengan keberadaan Pancasila dan SARA di Indonesia. Metode penelitian yang digunakan adalah penelitian hukum normatif. Hasil penelitian ini menunjukkan bahwa UU No. 23 Tahun 2006 tidak selaras dengan semangat Pancasila yang mengakui keragaman SARA dan bertentang dengan asas keadilan dalam UU No. 12Tahun 2011. In the global era, a nation supposedly able to compete with other countries. In order not to be separated from the typical elements of Indonesia, the strengthening of Pancasila as an ideology is a must. Pancasila surrounding ethnic, religious, racial and sectarian (SARA less diversity reflected in Law No. 23 of 2006. The problems that arise, namely the loss of the typical elements of Indonesia namely traditional religious beliefs or because of their discrimination by emptying the religion column in Family Card (KK and Identity Card (KTP (Article 61 and Article 64 of Law No. 23-2006. This study aims to analyze the correlation on Law No. 23of 2016 with the existence of Pancasila and SARA in Indonesia. The method used is a normative legal research. The result of this study reveals that the Law No. 23 of 2006 not in line with the spirit of Pancasila that recognizes the diversity of SARA and incompatible with the principles of justice on Law No. 12 of 2011.

  7. The concentration principle applied to spaceborne solar arrays. AGORA mission: Studies synthesis

    Science.gov (United States)

    Laget, R.

    1986-01-01

    Studies that led to selection of the distributed 25 kW SARA LOUVRE concept for the solar cell generator to be flown on the AGORA asteroid mission, and the major characteristics of such a spaceborne solar array are summarized. In the SARA LOUVRE concept, a parabolic cross section reflector concentrates incident light over the rear face of the identical, preceding reflector dish. The whole set of reflectors is pivotally commanded, thus compensating the effects of depointing. Geometric concentration factor is 10. End of life power level at 2.5 AU is 4.5 kW.

  8. An Investigation into Rumen Fungal and Protozoal Diversity in Three Rumen Fractions, during High-Fiber or Grain-Induced Sub-Acute Ruminal Acidosis Conditions, with or without Active Dry Yeast Supplementation

    Directory of Open Access Journals (Sweden)

    Suzanne L. Ishaq

    2017-10-01

    Full Text Available Sub-acute ruminal acidosis (SARA is a gastrointestinal functional disorder in livestock characterized by low rumen pH, which reduces rumen function, microbial diversity, host performance, and host immune function. Dietary management is used to prevent SARA, often with yeast supplementation as a pH buffer. Almost nothing is known about the effect of SARA or yeast supplementation on ruminal protozoal and fungal diversity, despite their roles in fiber degradation. Dairy cows were switched from a high-fiber to high-grain diet abruptly to induce SARA, with and without active dry yeast (ADY, Saccharomyces cerevisiae supplementation, and sampled from the rumen fluid, solids, and epimural fractions to determine microbial diversity using the protozoal 18S rRNA and the fungal ITS1 genes via Illumina MiSeq sequencing. Diet-induced SARA dramatically increased the number and abundance of rare fungal taxa, even in fluid fractions where total reads were very low, and reduced protozoal diversity. SARA selected for more lactic-acid utilizing taxa, and fewer fiber-degrading taxa. ADY treatment increased fungal richness (OTUs but not diversity (Inverse Simpson, Shannon, but increased protozoal richness and diversity in some fractions. ADY treatment itself significantly (P < 0.05 affected the abundance of numerous fungal genera as seen in the high-fiber diet: Lewia, Neocallimastix, and Phoma were increased, while Alternaria, Candida Orpinomyces, and Piromyces spp. were decreased. Likewise, for protozoa, ADY itself increased Isotricha intestinalis but decreased Entodinium furca spp. Multivariate analyses showed diet type was most significant in driving diversity, followed by yeast treatment, for AMOVA, ANOSIM, and weighted UniFrac. Diet, ADY, and location were all significant factors for fungi (PERMANOVA, P = 0.0001, P = 0.0452, P = 0.0068, Monte Carlo correction, respectively, and location was a significant factor (P = 0.001, Monte Carlo correction for protozoa

  9. Management of Sub-acute Ruminal Acidosis in Dairy Cattle for Improved Production: A Review

    OpenAIRE

    Kafil Hussain; Amjad Ul Islam; Surinder Kumar Gupta

    2011-01-01

    Sub-acute ruminal acidosis (SARA) is a well-recognized digestive disorder that is an increasing health problem in most dairy herds. Feeding diets high in grain and other highly fermentable carbohydrates to dairy cows increases milk production, but also increases the risk of SARA. Sub-acute ruminal acidosis is defined as periods of moderately depressed ruminal pH, from about 5.5 to 5.0. Sub-acute ruminal acidosis may be associated with laminitis and other health problems resulting in decreased...

  10. Implementation of Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) Health Authority by the Agency for Toxic Substances and Disease Registry

    International Nuclear Information System (INIS)

    Siegel, M.R.

    1990-01-01

    The Superfund Amendments and Reauthorization Act (SARA) of 1986 greatly expanded the health authority of the Comprehensive Environmental Response, Compensation, and Liability Act. One of the federal agencies most affected by SARA is the Agency for Toxic Substances and Disease Registry (ATSDR) of the U.S. Public Health Service. Among other responsibilities, ATSDR was mandated to conduct health assessments within strict time frames for each site on or proposed for the U.S. Environmental Protection Agency's National Priorities List. The author will review ATSDR's efforts to address this new statutory mandate, especially for federal facilities, and will focus on different conceptual frameworks for implementing the health assessment program

  11. Inventory in a Brazilian Sample

    Directory of Open Access Journals (Sweden)

    Taciano L. Milfont

    2008-01-01

    Full Text Available Éste artículo evalúa la validez de constructo y la validez discriminante del Inventario de Perspectiva Temporal de Zimbardo (Zimbardo Time Perspective Inventory, ZTPI de una muestra de 247 estudiantes brasileños. La estructura de cinco-factores de ZTPI, definidos por Pasado-Negativo, Presente-Hedonístico, Futuro, Pasado- Positivo y Presente-Fatalista, provee un ajuste aceptable de los datos, y pareció ser mejor estadísticamente que el ajuste de los modelos alternativos. El Presente-Hedonístico fue positivamente correlacionado con el consumo de alcohol y negativamente con la religiosidad, el Futuro fue correlacionado positivamente con la preocupación por la salud y negativamente con el consumo de alcohol, y el Pasado-Positivo fue positivamente correlacionado con el uso del reloj. Los resultados encontrados concuerdan con los estudios anteriores, indicando que las cinco dimensiones de perspectiva del tiempo pueden ser identificadas cognitivamente. Además los patrones de correlación con otras variables son comparables a través de otras culturas.

  12. Percepción del tiempo: resultados de una intervención grupal breve para el cambio del perfil temporal

    Directory of Open Access Journals (Sweden)

    Cristián Oyanadel

    2014-06-01

    Full Text Available La teoría de la perspectiva del tiempo de Zimbardo (1999 plantea una clasificación de las dimensiones de la orientación temporal, medidas con el Zimbardo Time Perspective Inventory (ZTPI, la cual propone, por una parte, que si se tiene una actitud positiva y moderada hacia el pasado, el presente y el futuro, se puede desarrollar mayor bienestar y buena salud tanto mental como física, mientras que actitudes negativas o extremas reflejarían pautas de vida poco saludables. El principal objetivo de esta investigación es evaluar el efecto de una intervención grupal breve para la modificación del perfil temporal. Para este fin, se realizó un estudio cuasiexperimental con grupo control en una muestra de 28 estudiantes universitarios; 14 de ellos formaron el grupo experimental y 14 formaron el grupo control. Los resultados muestran que la intervención realizada al grupo experimental modificó la orientación temporal de los participantes hacia un perfil equilibrado. Para terminar, se concluye que, con una intervención breve y grupal que potencie un pasado positivo y un futuro y un presente más saludables, es posible lograr un perfil equilibrado. Posteriores estudios podrían evaluar el impacto de la modificación del perfil temporal en población clínica.

  13. Percepción del tiempo: resultados de una intervención grupal breve para el cambio del perfil temporal

    Directory of Open Access Journals (Sweden)

    Cristián Oyanadel

    2014-06-01

    Full Text Available La teoría de la perspectiva del tiempo de Zimbardo (1999 plantea una clasificación de las dimensiones de la orientación temporal, medidas con el Zimbardo Time Perspective Inventory (ZTPI, la cual propone, por una parte, que si se tiene una actitud positiva y moderada hacia el pasado, el presente y el futuro, se puede desarrollar mayor bienestar y buena salud tanto mental como física, mientras que actitudes negativas o extremas reflejarían pautas de vida poco saludables. El principal objetivo de esta investigación es evaluar el efecto de una intervención grupal breve para la modificación del perfil temporal. Para este fin, se realizó un estudio cuasiexperimental con grupo control en una muestra de 28 estudiantes universitarios; 14 de ellos formaron el grupo experimental y 14 formaron el grupo control. Los resultados muestran que la intervención realizada al grupo experimental modificó la orientación temporal de los participantes hacia un perfil equilibrado. Para terminar, se concluye que, con una intervención breve y grupal que potencie un pasado positivo y un futuro y un presente más saludables, es posible lograr un perfil equilibrado. Posteriores estudios podrían evaluar el impacto de la modificación del perfil temporal en población clínica.

  14. Testing the goodness of fit of selected infiltration models on soils with different land use histories

    International Nuclear Information System (INIS)

    Mbagwu, J.S.C.

    1993-10-01

    Six infiltration models, some obtained by reformulating the fitting parameters of the classical Kostiakov (1932) and Philip (1957) equations, were investigated for their ability to describe water infiltration into highly permeable sandy soils from the Nsukka plains of SE Nigeria. The models were Kostiakov, Modified Kostiakov (A), Modified Kostiakov (B), Philip, Modified Philip (A) and Modified Philip (B). Infiltration data were obtained from double ring infiltrometers on field plots established on a Knadic Paleustult (Nkpologu series) to investigate the effects of land use on soil properties and maize yield. The treatments were; (i) tilled-mulched (TM), (ii) tilled-unmulched (TU), (iii) untilled-mulched (UM), (iv) untilled-unmulched (UU) and (v) continuous pasture (CP). Cumulative infiltration was highest on the TM and lowest on the CP plots. All estimated model parameters obtained by the best fit of measured data differed significantly among the treatments. Based on the magnitude of R 2 values, the Kostiakov, Modified Kostiakov (A), Philip and Modified Philip (A) models provided best predictions of cumulative infiltration as a function of time. Comparing experimental with model-predicted cumulative infiltration showed, however, that on all treatments the values predicted by the classical Kostiakov, Philip and Modified Philip (A) models deviated most from experimental data. The other models produced values that agreed very well with measured data. Considering the eases of determining the fitting parameters it is proposed that on soils with high infiltration rates, either Modified Kostiakov model (I = Kt a + Ict) or Modified Philip model (I St 1/2 + Ict), (where I is cumulative infiltration, K, the time coefficient, t, time elapsed, 'a' the time exponent, Ic the equilibrium infiltration rate and S, the soil water sorptivity), be used for routine characterization of the infiltration process. (author). 33 refs, 3 figs 6 tabs

  15. Assessment Matters: Moving beyond Surveys

    Science.gov (United States)

    Wise, Vicki L.; Barham, Mary Ann

    2012-01-01

    The August 16, 2011, "Chronicle of Higher Education" article "Want Data? Ask Students. Again and Again" by Sara Lipka posits that in higher education there is a culture of oversurveying students and too often relying on surveys as the main, or only, way of assessing the impact of programs and services on student satisfaction and learning. Because…

  16. Some geological processes in the Macro-tidal regime of Gulf of Kachchh, Northwest coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Vora, K.H.; Chauhan, O.S.; Rao, B.R

    of about 150-350 m in the Kandla Creek The Sara, Sanu and Phang creeks exhibit uneven to rugged topography with about 4 to 12 m deep V-shaped channels The seismic profiles across these creeks show 10-15 m thick clays The channels are cutting across...

  17. 78 FR 47408 - Notice of Intent to Prepare an Environmental Impact Statement for Oil and Gas Leasing and...

    Science.gov (United States)

    2013-08-05

    ..., Sacramento, CA 95825 Documents pertinent to this proposal may be examined at the BLM California State Office, 2800 Cottage Way, Sacramento, CA 95825. FOR FURTHER INFORMATION CONTACT: Sara Acridge, Natural Resources Specialist, telephone 916-978-4557; address 2800 Cottage Way, Rm. W- 1623, Sacramento, CA 95825...

  18. The Workplace Literacy System Project (WLS). Final Performance Report.

    Science.gov (United States)

    Poulton, Bruce R.

    The Workplace Literacy System Project (WLS) prepared interactive CD-ROM discs containing about 50 hours of instruction and drill in basic skills presented within the context of the textile/apparel manufacturing industry. The project was conducted at a Sara Lee knit products plant in North Carolina. During the project, literacy task analyses were…

  19. 75 FR 59983 - National Priorities List, Final Rule-Newtown Creek

    Science.gov (United States)

    2010-09-29

    ...? H. May EPA delete portions of sites from the NPL as they are cleaned up? I. What is the Construction...), added by SARA. The revised HRS evaluates four pathways: Ground water, surface water, soil exposure, and... the site are typically not known at the time of listing. Although a CERCLA ``facility'' is broadly...

  20. 78 FR 31417 - National Priorities List, Final Rule No. 56

    Science.gov (United States)

    2013-05-24

    ... would be time-consuming or costly. In other cases, data for scoring some pathways are available, but... NPL as they are cleaned up? I. What is the Construction Completion List (CCL)? J. What is the sitewide... partly in response to CERCLA section 105(c), added by SARA. The revised HRS evaluates four pathways...