WorldWideScience

Sample records for sara markowitz michael

  1. Speaking Personally--With Hal Markowitz

    Science.gov (United States)

    Pittman, Von

    2012-01-01

    This article presents an interview with Hal Markowitz, a veteran distance educator whose experience in the field is both deep and broad. Building on bachelor's and master's degrees at the University of Florida and his doctorate at Columbia University, Markowitz served in leadership roles in several professional organizations and directed distance…

  2. Sparse and stable Markowitz portfolios.

    Science.gov (United States)

    Brodie, Joshua; Daubechies, Ingrid; De Mol, Christine; Giannone, Domenico; Loris, Ignace

    2009-07-28

    We consider the problem of portfolio selection within the classical Markowitz mean-variance framework, reformulated as a constrained least-squares regression problem. We propose to add to the objective function a penalty proportional to the sum of the absolute values of the portfolio weights. This penalty regularizes (stabilizes) the optimization problem, encourages sparse portfolios (i.e., portfolios with only few active positions), and allows accounting for transaction costs. Our approach recovers as special cases the no-short-positions portfolios, but does allow for short positions in limited number. We implement this methodology on two benchmark data sets constructed by Fama and French. Using only a modest amount of training data, we construct portfolios whose out-of-sample performance, as measured by Sharpe ratio, is consistently and significantly better than that of the naïve evenly weighted portfolio.

  3. News developments at Sara

    International Nuclear Information System (INIS)

    Belmont, J.L.; Fruneau, M.; Martin, P.

    1989-05-01

    SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration

  4. Optimasi Portofolio Investasi Dengan Menggunakan Model Markowitz

    OpenAIRE

    Priyatna, Yayat; Sukono, F

    2003-01-01

    Permasalahan pokok dalam paper ini adalah memilih dua saham unggulan dan proporsi dana yang akan diinvestasikan dalam pembentukan suatu portofolio. Optimasi portofolio investasi di sini dilakukan dengan menggunakan model Markowitz. Dari empat saham unggulan versi LQ 45 yang dianalisis menunjukkan bahwa saham HM Sampurna dan Telkom memberikan hasil yang optimum dalam pembentukan portofolio investasi dengan proporsi dana berturut-turut sebesar 51% dan 49%.

  5. Markowitz portfolio optimization model employing fuzzy measure

    Science.gov (United States)

    Ramli, Suhailywati; Jaaman, Saiful Hafizah

    2017-04-01

    Markowitz in 1952 introduced the mean-variance methodology for the portfolio selection problems. His pioneering research has shaped the portfolio risk-return model and become one of the most important research fields in modern finance. This paper extends the classical Markowitz's mean-variance portfolio selection model applying the fuzzy measure to determine the risk and return. In this paper, we apply the original mean-variance model as a benchmark, fuzzy mean-variance model with fuzzy return and the model with return are modeled by specific types of fuzzy number for comparison. The model with fuzzy approach gives better performance as compared to the mean-variance approach. The numerical examples are included to illustrate these models by employing Malaysian share market data.

  6. Asset management using an extended Markowitz theorem

    Directory of Open Access Journals (Sweden)

    Paria Karimi

    2014-06-01

    Full Text Available Markowitz theorem is one of the most popular techniques for asset management. The method has been widely used to solve many applications, successfully. In this paper, we present a multi objective Markowitz model to determine asset allocation by considering cardinality constraints. The resulted model is an NP-Hard problem and the proposed study uses two metaheuristics, namely genetic algorithm (GA and particle swarm optimization (PSO to find efficient solutions. The proposed study has been applied on some data collected from Tehran Stock Exchange over the period 2009-2011. The study considers four objectives including cash return, 12-month return, 36-month return and Lower Partial Moment (LPM. The results indicate that there was no statistical difference between the implementation of PSO and GA methods.

  7. Michael Thonet

    Index Scriptorium Estoniae

    2005-01-01

    Saksa päritolu austria mööblidisaineri ja mööblitöösturi Michael Thonet' (1796-1871) disainiloomingust. 1859. a. Michael Thonet' loodud tool nr. 14 on endiselt tootmises ja on tuntud ka Viini toolina. 2 ill

  8. 2012 SARA Students Technical Report

    International Nuclear Information System (INIS)

    Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet

    2012-01-01

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of

  9. 2012 SARA Students Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

    2012-07-30

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the

  10. The SARA REU Site Program

    Science.gov (United States)

    Wood, M. A.; Oswalt, T. D.; SARA Collaboration

    2000-12-01

    We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.

  11. Michael Scott

    Directory of Open Access Journals (Sweden)

    Ersin Hussein

    2015-04-01

    While Michael has contributed significantly to the field of classics and ancient history by publishing extensively, he has also enjoyed great success in engaging wider audiences with the ancient world. He regularly talks in schools around the country, writes books intended for the popular market as well as articles for national and international newspapers and magazines. Michael's experience in writing and presenting a range of programmes intended for TV and radio audiences has made him a household name. He has written and presented programmes for the National Geographic, History Channel, Nova, and the BBC including Delphi: bellybutton of the ancient world (BBC4; Guilty Pleasures: luxury in the ancient and medieval words (BBC4; Jesus: rise to power (Natural Geographic; Ancient Discoveries (History Channel; Who were the Greeks? (BBC2; The Mystery of the X Tombs (BBC2/Nova; The Greatest Show on Earth (BBC4, in conjunction with the Open University. He has also presented a radio series for BBC Radio 4, Spin the Globe. Michael's most recent programme, Roman Britain from the Air, was aired on ITV in December 2014. In this interview, I talk to him about his engagement with other disciplines within the humanities, his forthcoming book project, and his experiences writing and presenting TV and radio documentaries.

  12. Sara

    International Nuclear Information System (INIS)

    Aparo, M.; Dionisi, M.; Vicini, C.; Zeppa, P.; Frazzoli, F.V.; Remetti, R.; Portale, C.

    1989-01-01

    Nuclear Material Accountability, supported by Containment and Surveillance measures, is a foundamental means for an effective International Safeguard implemention in nuclear plants. Accountability is based on the verification that difference between a material quantity entering a given material balance and the quantity leaving that area in a given period of time, correspond and the amount of material actually present at the moment of the inspection. In the recent years International Safeguards appealing to the needs of timeliness in detecting diversion and concealing activities, devoted ReD efforts on a new Dynamic Accountability procedures (NRTMA) with particular concern with reprocessing plants. The present paper, which is the result of a research activity carried out in the frame of the Italian Support Programme to IAEA for Safeguards implementation, deals with a feasibility study of a NRTMA system to be applied to the EUREX pilot reprocessing plant. Such a feasibility study was performed by developing a computer program based on simulated plant generated data

  13. Parametric Portfolio Selection: Evaluating and Comparing to Markowitz Portfolios

    Directory of Open Access Journals (Sweden)

    Marcelo C. Medeiros

    2014-10-01

    Full Text Available In this paper we exploit the parametric portfolio optimization in the Brazilian market. Our data consists of monthly returns of 306 Brazilian stocks in the period between 2001 and 2013. We tested the model both in and out of sample and compared the results with the value and equal weighted portfolios and with a Markowitz based portfolio. We performed statistical inference in the parametric optimization using bootstrap techniques in order to build the parameters empirical distributions. Our results showed that the parametric optimization is a very efficient technique out of sample. It consistently showed superior results when compared with the VW, EW and Markowitz portfolios even when transaction costs were included. Finally, we consider the parametric approach to be very flexible to the inclusion of constraints in weights, transaction costs and listing and delisting of stocks.

  14. Decision Utility Theory: Back to von Neumann, Morgenstern, and Markowitz

    OpenAIRE

    Kontek, Krzysztof

    2010-01-01

    Prospect Theory (1979) and its Cumulative version (1992) argue for probability weighting to explain lottery choices. Decision Utility Theory presents an alternative solution, which makes no use of this concept. The new theory distinguishes decision and perception utility, postulates a double S-shaped decision utility curve similar to one hypothesized by Markowitz (1952), and applies the expected decision utility value similarly to the theory by von Neumann and Morgenstern (1944). Decision Uti...

  15. PENGGUNAAN ALGORITMA GENETIKA UNTUK PEMILIHAN PORTFOLIO SAHAM DALAM MODEL MARKOWITZ

    Directory of Open Access Journals (Sweden)

    Silvia Rostianingsih

    2005-01-01

    Full Text Available Modern portfolio theory is based on asumption that investor can choose his proportion asset in portfolio, so they can minimize the risk and maximize the return. This paper presents the use of genetic algorithm (GA to optimize the choice of share portfolio in markowitz model by representing the efficient set portfolio. GA represent the efficient set using undirect representation to avoid infeasible solution and penalty function. From the implementation, it can be concluded that GA is one of methods which is able to obtain optimum point from portfolio. Abstract in Bahasa Indonesia : Teori portofolio modern mendasarkan teorinya pada asumsi bahwa investor bertindak secara rasional dengan memilih proporsi asetnya dalam sebuah portofolio sedemikian rupa sehingga dapat meminimalkan resiko dan memaksimalkan return. Dalam paper ini penulis mencoba menyajikan penggunaan algoritma genetika (Genetic Algorithm/GA untuk optimasi pemilihan portofolio saham dalam model markowitz dengan cara merepresentasikannya sebagai kumpulan portofolio yang efisien (the efficient set portofolio. GA merepresentasikan kumpulan yang effisien ini dengan menggunakan representasi tidak langsung untuk menghindari solusi yang tidak feasible dan fungsi penalti. Dari hasil yang telah diimplementasikan dapat disimpulkan bahwa GA dapat digunakan sebagai salah satu metode yang cukup berhasil dalam menemukan titik optimum dari sebuah portofolio. Kata kunci: markowitz, teori portofolio, algoritma genetika.

  16. Credit Portfolio Selection According to Sectors in Risky Environments: Markowitz Practice

    OpenAIRE

    Halim Kazan; Kültigin Uludag

    2014-01-01

    In this study, it was researched that how the rate of repayment of loans will be increased and how the credit risk will be minimized in banking sector, by using Markowitz Portfolio Theory. Construction, textile and wholesale and retail sectors were examined under the central bank data. Portfolio groups were selected and risks( variances of Portfolio groups) were evaluated according to Markowitz portfolio theory. Markowitz portfolio theory is effective than the other portfolio selection instru...

  17. A COMPARISON OF BASIC AND EXTENDED MARKOWITZ MODEL ON CROATIAN CAPITAL MARKET

    OpenAIRE

    Bruna Škarica; Zrinka Lukač

    2012-01-01

    Markowitz' mean - variance model for portfolio selection, first introduced in H.M. Markowitz' 1952 article, is one of the best known models in finance. However, the Markowitz model is based on many assumptions about financial markets and investors, which do not coincide with the real world. One of these assumptions is that there are no taxes or transaction costs, when in reality all financial products are subject to both taxes and transaction costs – such as brokerage fees. In this pape...

  18. Severe Accident Recriticality Analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  19. Severe accident recriticality analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H

    2001-11-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated

  20. Severe accident recriticality analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.

    2001-01-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady

  1. Severe Accident Recriticality Analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  2. Application of Markowitz Model on Romanian Stock Market

    Directory of Open Access Journals (Sweden)

    Zavera Ioana Coralia

    2017-04-01

    Full Text Available Performance evaluation of financial instruments has become a concern for more and more economists, while security trading activities have developed over time. “Modern portfolio theory” comprises statistical and mathematical models which describe various ways in order to evaluate and especially analyse profitability and risk of these portfolios. This article offers an application of this type of model on Romanian stock market, the Markowitz model, by focusing on portfolios comprising three securities, and determining the efficient frontier and the minimum variance portfolio.

  3. Study about Markowitz Model Applicability on Romanian Stock Exchange Market

    Directory of Open Access Journals (Sweden)

    Leonardo Badea

    2006-11-01

    Full Text Available This paper deals with the application of the analysis on a portfolio made up of eight titles, through determination of the portfolio with absolute minimum variation and of the frontier of efficiency. Thus, using the Markowitz model, the dimensions of the portfolio with minimum absolute variation could be established but its profitability was smaller than the profitability offered by the BET rating. The best strategy to follow in this respect would have been to adopt a passive strategy and to take over the structure of the rating in the investment of portfolio for a good profitability but with a higher risk.

  4. Study about Markowitz Model Applicability on Romanian Stock Exchange Market

    Directory of Open Access Journals (Sweden)

    Leonardo Badea

    2006-09-01

    Full Text Available This paper deals with the application of the analysis on a portfolio made up of eight titles, through determination of the portfolio with absolute minimum variation and of the frontier of efficiency. Thus, using the Markowitz model, the dimensions of the portfolio with minimum absolute variation could be established but its profitability was smaller than the profitability offered by the BET rating. The best strategy to follow in this respect would have been to adopt a passive strategy and to take over the structure of the rating in the investment of portfolio for a good profitability but with a higher risk.

  5. Interpreting the SARA and RCRA training requirements

    International Nuclear Information System (INIS)

    Moreland, W.M.; Wells, S.M.

    1987-01-01

    The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements

  6. Michael Griffin | NREL

    Science.gov (United States)

    Griffin Photo of Michael Griffin Michael Griffin Researcher III-Chemical Engineering production of high-value products Physical and chemical material characterization under reaction conditions Physical and chemical characterization of catalytic materials Surface science Design and operation of ultra

  7. Michael E. Himmel | NREL

    Science.gov (United States)

    E. Himmel Photo of Michael E. Himmel Michael Himmel Senior Research Fellow I-Molecular Biology biochemistry, recombinant technology, enzyme engineering, new micro-organism discovery, and physicochemistry of

  8. An application of Markowitz theorem on Tehran Stock Exchange

    Directory of Open Access Journals (Sweden)

    Hassan Ghodrati

    2014-05-01

    Full Text Available During the past 65 years, there have been tremendous efforts on portfolio selection problem. The standard Markowitz mean–variance model to portfolio selection includes tracing out an efficient frontier, a continuous curve demonstrating the tradeoff between return and risk. This frontier can be often detected via standard quadratic programming, categorized in convex optimization. Traditional Markowitz problem has been recently extended into a new form of mixed integer nonlinear problems by considering various constraints such as cardinality constraints, industry limitation, etc. This paper proposes a mixed integer nonlinear programming to determine optimal asset allocation on Tehran Stock Exchange. The results have indicated that a petrochemical firm named Farabi has gained 44% of the portfolio followed by a drug firm named Kosar Pharmacy gaining 28%. In addition, banking sector was the third winning firm where Eghtesad Novin bank gained nearly 10% of the portfolio. Minerals and mining firms were the next sector in our portfolio where Gol Gohar Iron Ore and Tehran Cement collected 0.73% and 0.57% of the portfolio, respectively. In our survey, auto industry gained only 0.26% of the portfolio, which belonged to Saipa group.

  9. Ant Colony Optimization for Markowitz Mean-Variance Portfolio Model

    Science.gov (United States)

    Deng, Guang-Feng; Lin, Woo-Tsong

    This work presents Ant Colony Optimization (ACO), which was initially developed to be a meta-heuristic for combinatorial optimization, for solving the cardinality constraints Markowitz mean-variance portfolio model (nonlinear mixed quadratic programming problem). To our knowledge, an efficient algorithmic solution for this problem has not been proposed until now. Using heuristic algorithms in this case is imperative. Numerical solutions are obtained for five analyses of weekly price data for the following indices for the period March, 1992 to September, 1997: Hang Seng 31 in Hong Kong, DAX 100 in Germany, FTSE 100 in UK, S&P 100 in USA and Nikkei 225 in Japan. The test results indicate that the ACO is much more robust and effective than Particle swarm optimization (PSO), especially for low-risk investment portfolios.

  10. Jack Michael's Motivation

    OpenAIRE

    Miguel, Caio F.

    2013-01-01

    Among many of Jack Michael's contributions to the field of behavior analysis is his behavioral account of motivation. This paper focuses on the concept of motivating operation (MO) by outlining its development from Skinner's (1938) notion of drive. Conceptually, Michael's term helped us change our focus on how to study motivation by shifting its origins from the organism to the environment. Michael's account also served to stimulate applied research and to better understand behavioral functio...

  11. System Analysis and Risk Assessment (SARA) system

    International Nuclear Information System (INIS)

    Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

    1986-01-01

    Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable

  12. A COMPARISON OF BASIC AND EXTENDED MARKOWITZ MODEL ON CROATIAN CAPITAL MARKET

    Directory of Open Access Journals (Sweden)

    Bruna Škarica

    2012-12-01

    Full Text Available Markowitz' mean - variance model for portfolio selection, first introduced in H.M. Markowitz' 1952 article, is one of the best known models in finance. However, the Markowitz model is based on many assumptions about financial markets and investors, which do not coincide with the real world. One of these assumptions is that there are no taxes or transaction costs, when in reality all financial products are subject to both taxes and transaction costs – such as brokerage fees. In this paper, we consider an extension of the standard portfolio problem which includes transaction costs that arise when constructing an investment portfolio. Finally, we compare both the extension of the Markowitz' model, including transaction costs, and the basic model on the example of the Croatian capital market.

  13. Application of Markowitz Portfolio Theory by Building Optimal Portfolio on the US Stock Market

    OpenAIRE

    Širůček, Martin; Křen, Lukáš

    2015-01-01

    ŠIRŮČEK MARTIN, KŘEN LUKÁŠ. 2015. Application of Markowitz Portfolio Theory by Building Optimal Portfolio on the US Stock Market. Acta Universitatis Agriculturae et Silviculturae Mendelianae Brunensis, 63(4): 1375–1386. This paper is focused on building investment portfolios by using the Markowitz Portfolio Theory (MPT). Derivation based on the Capital Asset Pricing Model (CAPM) is used to calculate the weights of individual securities in portfolios. The calculated portfolios include a po...

  14. Analisis Portofolio Saham dengan Metode Capm dan Markowitz

    Directory of Open Access Journals (Sweden)

    Hartiwi Prabowo

    2013-05-01

    Full Text Available  LQ45 index is a row of 45 stocks with the largest commercial transactions in BEI. These stocks are also commonly referred to as blue-chip stocks. Stocks at LQ 45 index must meet the criteria and pass a predetermined key. The LQ 45 stocks are continuously being monitored and will be a reviewed for every 6 months (early February and August. Capital Asset Pricing Model (CAPM is used to estimate the return of a securities, while minimizing the risk to the desired level of returns in stock investing can be done by way of diversification or invest the funds into more than one type of securities (forming portfolios. The purpose of this study was to determine the expected return, and choosing the best stocks to obtain the optimal portfolio composition and profitable to invest. This study uses secondary data, ie data LQ 45, stock prices, the level of available SBI Stock Exchange, BI, and websites. To analyze the data, the writer used method of CAPM and Markowitz Portfolio. The results showed the election of 5 stocks of the most profitable for investors, namely stock UNTR, SMCB, ASII, INDF and BBRI. For companies that issue stocks should interact more with the society and the capital markets to attract more investors.

  15. Michael Faraday's Bicentenary.

    Science.gov (United States)

    Williams, L. Pearce; And Others

    1991-01-01

    Six articles discuss the work of Michael Faraday, a chemist whose work revolutionized physics and led directly to both classical field and relativity theory. The scientist as a young man, the electromagnetic experiments of Faraday, his search for the gravelectric effect, his work on optical glass, his laboratory notebooks, and his creative use of…

  16. Following Michael Faraday's Footprints

    Science.gov (United States)

    Galeano, Javier

    2011-01-01

    Last fall I had the good fortune of receiving financial support to shoot a documentary about Michael Faraday. I took the opportunity to learn more about this great experimentalist and to visit the highlights of places in his life. In this paper, I would like to share a list and description of some of the most remarkable places in London suitable…

  17. Michael Faraday, media man.

    Science.gov (United States)

    Fara, Patricia

    2006-03-01

    Michael Faraday was an enthusiastic portrait collector, and he welcomed the invention of photography not only as a possible means of recording observations accurately, but also as a method for advertising science and its practitioners. This article (which is part of the Science in the Industrial Revolution series) shows that like many eminent scientists, Faraday took advantage of the burgeoning Victorian media industry by posing in various roles.

  18. Spectrally-Corrected Estimation for High-Dimensional Markowitz Mean-Variance Optimization

    NARCIS (Netherlands)

    Z. Bai (Zhidong); H. Li (Hua); M.J. McAleer (Michael); W.-K. Wong (Wing-Keung)

    2016-01-01

    textabstractThis paper considers the portfolio problem for high dimensional data when the dimension and size are both large. We analyze the traditional Markowitz mean-variance (MV) portfolio by large dimension matrix theory, and find the spectral distribution of the sample covariance is the main

  19. Differentiability properties of the efficient (u,q2)-set in the Markowitz portfolio selection method

    NARCIS (Netherlands)

    Kriens, J.; Strijbosch, L.W.G.; Vörös, J.

    1994-01-01

    The set of efficient (Rho2)-combinations in the (Rho2)-plane of the Markowitz portfolio selection method consists of a series of strictly convex parabola. In the transition points from one parabola to the next one, the curve may be indifferentiable. The article gives necessary and sufficient

  20. An inequality for detecting financial fraud, derived from the Markowitz Optimal Portfolio Theory

    Science.gov (United States)

    Bard, Gregory V.

    2016-12-01

    The Markowitz Optimal Portfolio Theory, published in 1952, is well-known, and was often taught because it blends Lagrange Multipliers, matrices, statistics, and mathematical finance. However, the theory faded from prominence in American investing, as Business departments at US universities shifted from techniques based on mathematics, finance, and statistics, to focus instead on leadership, public speaking, interpersonal skills, advertising, etc… The author proposes a new application of Markowitz's Theory: the detection of a fairly broad category of financial fraud (called "Ponzi schemes" in American newspapers) by looking at a particular inequality derived from the Markowitz Optimal Portfolio Theory, relating volatility and expected rate of return. For example, one recent Ponzi scheme was that of Bernard Madoff, uncovered in December 2008, which comprised fraud totaling 64,800,000,000 US dollars [23]. The objective is to compare investments with the "efficient frontier" as predicted by Markowitz's theory. Violations of the inequality should be impossible in theory; therefore, in practice, violations might indicate fraud.

  1. Michael Jackson's Sound Stages

    OpenAIRE

    Morten Michelsen

    2012-01-01

    In order to discuss analytically spatial aspects of recorded sound William Moylan’s concept of ‘sound stage’ is developed within a musicological framework as part of a sound paradigm which includes timbre, texture and sound stage. Two Michael Jackson songs (‘The Lady in My Life’ from 1982 and ‘Scream’ from 1995) are used to: a) demonstrate the value of such a conceptualisation, and b) demonstrate that the model has its limits, as record producers in the 1990s began ignoring the conventions of...

  2. Michael Frayn visits CERN

    CERN Multimedia

    2007-01-01

    Award-winning playwright and novelist Michael Frayn gave a guest lecture in the main auditorium at CERN on Friday 15 March about his new book The Human Touch: Our Part in the Creation of the Universe. The lecture focused on cosmology and philosophy and the limitations that language places on our ability to understand the creation of a universe in which we seem to play such a small part. In addition to his novels and plays, which include Copenhagen, a play about the 1941 meeting between German physicist Werner Heisenberg and Danish physicist Niels Bohr, Frayn has translated several works from Russian, including plays by Chekhov and Tolstoy.

  3. Portafolio management: A critical view beyond Markowitz Gestión de portafolios. Una mirada crítica más allá de Markowitz

    Directory of Open Access Journals (Sweden)

    Duván Darío Grajales Bedoya

    2009-12-01

    Full Text Available Since its first appearance, the Markowitz model for portfolio selection has been a basic theoretical reference, opening several new development options. However, practically it has not been used among portfolio managers and investment analysts in spite of its success in the theoretical field. This paper presents and discusses the Markowitz’s model limitations modal to its practical implementation, the existence of transaction costs, equilibrium considerations, technical and fundamental analysis importance and the focus on behavioural finance as that of limited rationality, determine that the decision process of the individuals possesses limitations so much cognitive as computing that reduce perfection to their decisions, nevertheless, these theories of behavioural portfolios is possible to consider to be more a descriptive theory of how the investors construct their portfolios, in contrast with the theory of Markowitz's portfolios that is more prescriptive on having tried to instruct the investors how they must their portfolios.Desde su aparición, el modelo de Markowitz ha sido un referente teórico fundamental para la selección de carteras de valores y ha dado lugar a múltiples desarrollos y derivaciones. Su utilización en la práctica, entre gestores de carteras y analistas de inversiones, no es tan amplia como podría esperarse de su éxito teórico. Aquí se presentan y discuten sus limitaciones en cuanto a implementación práctica, presencia de costos de transacción, consideraciones de rebalanceo, importancia de los análisis fundamental y técnico, y el enfoque de finanzas del comportamiento que, como el de racionalidad limitada, determinan que el proceso de decisión de los individuos posee especificaciones cognitivas y computacionales que le restan perfección a las decisiones. Tales teorías de comportamiento se pueden considerar descriptivas de cómo los inversionistas construyen sus portafolios, en contraste con la de

  4. The relationship between SARA fractions and crude oil stability

    Directory of Open Access Journals (Sweden)

    Siavash Ashoori

    2017-03-01

    Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.

  5. Application of Markowitz model in analysing risk and return a case study of BSE stock

    Directory of Open Access Journals (Sweden)

    Manas Pandey

    2012-03-01

    Full Text Available In this paper the optimal portfolio formation using real life data subject to two different constraint sets is attempted. It is a theoretical framework for the analysis of risk return choices. Decisions are based on the concept of efficient portfolios. Markowitz portfolio analysis gives as output an efficient frontier on which each portfolio is the highest return earning portfolio for a specified level of risk. The investors can reduce their risks and can maximize their return from the investment, The Markowitz portfolio selections were obtained by solving the portfolio optimization problems to get maximum total returns, constrained by minimum allowable risk level. Investors can get lot of information knowledge about how to invest when to invest and why to invest in the particular portfolio. It basically calculates the standard deviation and returns for each of the feasible portfolios and identifies the efficient frontier, the boundary of the feasible portfolios of increasing returns

  6. Layering of life (Sara novel of Peter Sarić

    Directory of Open Access Journals (Sweden)

    Kostić Dragomir J.

    2015-01-01

    Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safe­guard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.

  7. VAR Portfolio Optimal: Perbandingan Antara Metode Markowitz Dan Mean Absolute Deviation

    OpenAIRE

    Sartono, R. Agus; Setiawan, Arie Andika

    2006-01-01

    Portfolio selection method which have been introduced by Harry Markowitz (1952) used variance or deviation standard as a measure of risk. Kanno and Yamazaki (1991) introduced another method and used mean absolute deviation as a measure of risk instead of variance. The Value-at Risk (VaR) is a relatively new method to capitalized risk that been used by financial institutions. The aim of this research is compare between mean variance and mean absolute deviation of two portfolios. Next, we attem...

  8. Professor Michael Levitt

    Directory of Open Access Journals (Sweden)

    Gemma-Louise Davies

    2015-10-01

    Full Text Available Professor Michael Levitt (Stanford University, USA won the 2013 Nobel Prize in Chemistry for the development of multiscale models for complex chemical systems—computational tools which can calculate the course of chemical reactions. Professor Levitt was born in Pretoria, South Africa; he came to the UK on a summer vacation aged 16, where he decided to stay and study for his A‑levels. His interest in the physics of living systems drove him to study biophysics at King’s College London, before securing a PhD position at the Laboratory of Molecular Biology in Cambridge. In the interim year between his degree and beginning his PhD, Professor Levitt worked at the Weizmann Institute of Science in Israel, where he met his future wife. They married later that year and moved to Cambridge, where their three children were born. After completing his PhD, he spent time working in Israel, Cambridge, the Salk Institute and Stanford (both California. Since 1986, he has split his time between Israel and California. Outside of science, he is a keen hiker and he is well-known to have attended the eclectic ‘Burning Man’ Festival in California.[1] Professor Levitt visited the University of Warwick to speak at the Computational Molecular Science Annual Conference in March 2015. In this interview, Dr Gemma-Louise Davies, an Institute of Advanced Study Global Research Fellow, spoke to Professor Levitt about the importance of Interdisciplinarity in his field, role models in Academia, and his plans for the future. Image: Professor Michael Levitt (left with Dr Scott Habershon (right, organiser of the 2015 Computational Molecular Science Annual Conference during his visit to the University of Warwick in March 2015. [1] ‘Burning Man’ is a unique annual festival dedicated to community, art, music, self-expression and self-reliance. Tens of thousands of people flock to this temporary metropolis built in the Californian desert.

  9. Michael Levitt and Computational Biology

    Science.gov (United States)

    dropdown arrow Site Map A-Z Index Menu Synopsis Michael Levitt and Computational Biology Resources with Michael Levitt, PhD, professor of structural biology at the Stanford University School of Medicine, has function. ... Levitt's early work pioneered computational structural biology, which helped to predict

  10. Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.

    Science.gov (United States)

    O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J

    2008-04-01

    Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.

  11. Gene : CBRC-SARA-01-1996 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

  12. Robust Markowitz mean-variance portfolio selection under ambiguous covariance matrix *

    OpenAIRE

    Ismail, Amine; Pham, Huyên

    2016-01-01

    This paper studies a robust continuous-time Markowitz portfolio selection pro\\-blem where the model uncertainty carries on the covariance matrix of multiple risky assets. This problem is formulated into a min-max mean-variance problem over a set of non-dominated probability measures that is solved by a McKean-Vlasov dynamic programming approach, which allows us to characterize the solution in terms of a Bellman-Isaacs equation in the Wasserstein space of probability measures. We provide expli...

  13. SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS

    International Nuclear Information System (INIS)

    Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.

    2015-01-01

    SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index

  14. Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

    Directory of Open Access Journals (Sweden)

    M. Sidi Ritau'din

    2017-06-01

    Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.

  15. En bog om Michael Strunge

    DEFF Research Database (Denmark)

    Mai, Anne-Marie

    Antologi med bidrag om Michael Strunges forfatterskab. Bidrag af Anne-Marie Mai, Jørgen Aabenhus, Marianne Stidsen, Moritz Schramm, Tue Andersen Nexø, Lars Bukdahl, Jon Helt Haarder, Rune Kühl er optaget efter fagfællesbedømmelse. Antologien er redigeret af Anne-Marie Mai og Jørgen Aabenhus....

  16. Michael Beitz: Objects of Communication

    Science.gov (United States)

    Hoefferle, Mary

    2014-01-01

    For this Instructional Resource, the author interviewed contemporary sculptor Michael Beitz, who uses art to explore the role of designed objects in human communication and emotional experience. This column was written in response to calls for using Enduring Understandings/Big Ideas (National Coalition for Core Arts Standards, 2013; Stewart &…

  17. Radiation curable Michael addition compounds

    International Nuclear Information System (INIS)

    Gruber, G.W.; Friedlander, C.B.; McDonald, W.H.; Dowbenko, R.

    1979-01-01

    Radiation polymerizable acrylyloxy-containing reaction products are provided from Michael addition reaction of an amide containing at least two acrylate groups with a primary or secondary amine. The resulting amine adducts of the amide, which contain at least one acrylate group per molecule, possesses high cure rates in air and are useful in compositions for forming coatings. (author)

  18. Application of Markowitz Portfolio Theory by Building Optimal Portfolio on the US Stock Market

    Directory of Open Access Journals (Sweden)

    Martin Širůček

    2015-01-01

    Full Text Available This paper is focused on building investment portfolios by using the Markowitz Portfolio Theory (MPT. Derivation based on the Capital Asset Pricing Model (CAPM is used to calculate the weights of individual securities in portfolios. The calculated portfolios include a portfolio copying the benchmark made using the CAPM model, portfolio with low and high beta coefficients, and a random portfolio. Only stocks were selected for the examined sample from all the asset classes. Stocks in each portfolio are put together according to predefined criteria. All stocks were selected from Dow Jones Industrial Average (DJIA index which serves as a benchmark, too. Portfolios were compared based on their risk and return profiles. The results of this work will provide general recommendations on the optimal approach to choose securities for an investor’s portfolio.

  19. MARKOWITZ MODEL DALAM PEMBENTUKAN PORTOFOLIO OPTIMAL (STUDI KASUS PADA JAKARTA ISLAMIC INDEX

    Directory of Open Access Journals (Sweden)

    Irni Yunita

    2018-04-01

    Full Text Available Tujuan dari penelitian ini adalah untuk menentukan pemilihan portofolio optimal menggunakan model Markowitz. Penelitian ini menggunakan data time series dari tahun 2013 - 2018. Sampel penelitian terdiri dari 29 saham yang terdapat dalam Jakarta Islamic Index tahun 2018. Hasil penelitian menunjukkan bahwa terdapat 10 saham yang termasuk ke dalam portofolio optimal yaitu antara lain AKRA (3.4%, ADRO (3.3%, ICBP (4.7%, INCO (2.6%, MYRX (13.6%, PTPP (4.9%, PWON (11.3%, TPIA (1%, UNTR (15.7% dan UNVR (39.5%. Rata rata tingkat pengembalian portofolio adalah sebesar 1.22 % dan resiko portofolio adalah sebesar 0.0312, resiko tersebut di bawah resiko dari masing-masing saham individual pembentuk portofolio optimal.

  20. Layering of life (Sara novel of Peter Sarić)

    OpenAIRE

    Kostić, Dragomir J.

    2015-01-01

    Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...

  1. A simple blowdown code for SUPER-SARA loop conditions

    International Nuclear Information System (INIS)

    Fritz, G.

    1981-01-01

    The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section

  2. Michael J. Fox: Spurring Research on Parkinson's

    Science.gov (United States)

    ... turn JavaScript on. Feature: Parkinson's Disease Michael J. Fox: Spurring Research on Parkinson's Past Issues / Winter 2014 Table of Contents Michael J. Fox and his wife, actress Tracy Pollan, founded the ...

  3. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...

  4. Michael Faraday vs. the Spiritualists

    Science.gov (United States)

    Hirshfeld, Alan

    2006-12-01

    In the 1850s, renowned physicist Michael Faraday launched a public campaign against pseudoscience and spiritualism, which were rampant in England at the time. Faraday objected especially to claims that electrical or magnetic forces were responsible for paranormal phenomena, such as table-spinning and communication with the dead. Using scientific methods, Faraday unmasked the deceptions of spiritualists, clairvoyants and mediums and also laid bare the credulity of a public ill-educated in science. Despite his efforts, Victorian society's fascination with the paranormal swelled. Faraday's debacle anticipates current controversies about public science education and the interface between science and religion. This episode is one of many described in the new biography, The Electric Life of Michael Faraday (Walker & Co.), which chronicles Faraday's discoveries and his unlikely rise from poverty to the pinnacle of the English science establishment.

  5. Michael Niegl (1985-2009)

    CERN Multimedia

    2009-01-01

    Our friend and colleague Michael Niegl died in a tragic accident in the first hours of the new year. Michael was a Master’s student in Microsystems Engineering at the University of Applied Sciences Wiener Neustadt. He was responsible for the development of the ATLAS Beam Conditions Monitor (BCM) ROD FPGA firmware, which acquires the data from the BCM detector modules and provides online monitoring of the LHC beams within the ATLAS experiment. He spent several months at CERN to carry out beam tests on the BCM detectors and received his Bachelor of Science with first class honours for his thesis: Concept and Implementation of an FPGA-based Data Recorder and Processor for the ATLAS Beam Conditions Monitor. Michael spent six months at CERN last year to finish the development and commissioning of the ROD firmware for the first beam. He worked the entire night of 10 September to fine tune the system for the first beam. It was a joy to ...

  6. Michael De Sousa (1989 - 2012)

    CERN Multimedia

    2012-01-01

    We are deeply saddened to announce the death of Mr Michael De Sousa on 13 May 2012. Mr De Sousa, who was born on 02.09.1989, was working as an apprentice in the TE Department and had been at CERN since 24.08.2009. The Director-General has sent a message of condolence to his family on behalf of the CERN personnel. Social Affairs Human Resources Department     It is with great emotion and deep sadness that we learn of the tragic loss of our colleague and friend Michael De Sousa. Michael was a hard working colleague, cordial and considerate. Within a few months, he marked his presence by the implementation of the instrumentation benches for gas permeation measurement in polymers, and the calibration of high technology gas analyzers, necessary for vacuum technology. His last contribution will enable us to measure pressures in the extreme high vacuum range for the ELENA project.  With the continuation of this activity, his memory will remain. His accomplishments will remain...

  7. Organocatalytic aza-Michael/retro-aza-Michael reaction: pronounced chirality amplification in aza-Michael reaction and racemization via retro-aza-Michael reaction.

    Science.gov (United States)

    Cai, Yong-Feng; Li, Li; Luo, Meng-Xian; Yang, Ke-Fang; Lai, Guo-Qiao; Jiang, Jian-Xiong; Xu, Li-Wen

    2011-05-01

    A detailed experimental investigation of an aza-Michael reaction of aniline and chalcone is presented. A series of Cinchona alkaloid-derived organocatalysts with different functional groups were prepared and used in the aza-Michael and retro-aza-Michael reaction. There was an interesting finding that a complete reversal of stereoselectivity when a benzoyl group was introduced to the cinchonine and cinchonidine. The chirality amplification vs. time proceeds in the quinine-derived organocatalyst containing silicon-based bulky group, QN-TBS, -catalyzed aza-Michael reaction under solvent-free conditions. In addition, we have demonstrated for the first time that racemization was occurred in suitable solvents under mild conditions due to retro-aza-Michael reaction of the Michael adduct of aniline with chalcone. These indicate the equilibrium of retro-aza-Michael reaction and aza-Michael reaction produce the happening of chirality amplification in aza-Michael reaction and racemization via retro-aza-Michael reaction under different conditions, which would be beneficial to the development of novel chiral catalysts for the aza-Michael reactions. Copyright © 2011 Wiley-Liss, Inc.

  8. Analysis Of Dynamic Portfolio Allocation Of Indonesian LQ45 During 2005 – 2011 Following The Markowitz Theowry

    Directory of Open Access Journals (Sweden)

    Agustini Hamid

    2016-09-01

    Full Text Available The research observed that equity portfolio and investment managers were facing challenges in determining the optimum portfolio, especially during the turbulent times. As a result, they needed to implement portfolio management strategies to overcome the risk associated with stock return volatility in turbulence periods. This research focused on selecting stocks from the LQ-45 index during 2005-2011 using The Markowitz theory combining the Solver Linear Programming. The portfolio selection method which has been introduced by Markowitz (1952 used variance or standard deviation as a risk measurement. The result of this research proves that the composition of the portfolio is not the same in the different period. In the bearish period, the composition of the optimum portfolio is dominated by the banking sector and manufacture sector. In the bullish period, the optimum portfolio is dominated by the commodity stocks.

  9. Sara, a patient with borderline personality structure: A "crisis" management

    Directory of Open Access Journals (Sweden)

    Paola Marinelli

    2015-05-01

    Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma. 

  10. Michael Jackson antes del caos

    OpenAIRE

    Juan Luciano Nieves

    2015-01-01

    Michael Jackson es un buen ejemplo de cómo utilizar las relaciones públicas para realizar o manipular la imagen de un producto a través de los medios de comunicación. Este ensayo pretende analizar los eventos que tuvieron lugar antes de que el cantante fuera acusado de abuso sexual contra un menor. Dichos eventos formaron parte de un plan muy bien delineado para disminuir los efectos de la inminente crisis que se acercaba. Este trabajo combina la crítica retórica de temas de fantasía con teor...

  11. VAR Portfolio Optimal: Perbandingan Antara Metode Markowitz dan Mean Absolute Deviation

    Directory of Open Access Journals (Sweden)

    R. Agus Sartono

    2009-05-01

    Full Text Available Portfolio selection method which have been introduced by Harry Markowitz (1952 used variance or deviation standard as a measure of risk. Kanno and Yamazaki (1991 introduced another method and used mean absolute deviation as a measure of risk instead of variance. The Value-at Risk (VaR is a relatively new method to capitalized risk that been used by financial institutions. The aim of this research is compare between mean variance and mean absolute deviation of two portfolios. Next, we attempt to assess the VaR of two portfolios using delta normal method and historical simulation. We use the secondary data from the Jakarta Stock Exchange – LQ45 during 2003. We find that there is a weak-positive correlation between deviation standard and return in both portfolios. The VaR nolmal delta based on mean absolute deviation method eventually is higher than the VaR normal delta based on mean variance method. However, based on the historical simulation the VaR of two methods is statistically insignificant. Thus, the deviation standard is sufficient measures of portfolio risk.Keywords: optimalisasi portofolio, mean-variance, mean-absolute deviation, value-at-risk, metode delta normal, metode simulasi historis

  12. Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

    Directory of Open Access Journals (Sweden)

    Jessica N Snowden

    Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.

  13. Video interview with Michael Dell

    CERN Multimedia

    CERN Bulletin

    2010-01-01

    Michael Dell, founder and presently Chairman of the Board of Directors and Chief Executive Office of the DELL computer company visited CERN on Tuesday 26th January 2010. The Bulletin and the Video productions team had the opportunity to meet him. The video interview is transcribed for your convenience.   Michael S. Dell with CERN Director-General Rolf Heuer. What motivated you to come and visit CERN? I obviously heard about the great science and research has going on here, and DELL is very pleased to be a partner and providing a lot of the computers to analyse the data and I really wanted to see for myself in person, some of the great science that is going on here. What is your view on fundamental research in IT, and in general? I think if you look at the field of science in the last hundred years, we have been able to solve a lot of problems, but there are still lots of unsolved problems and unsolved mysteries. And it is only through basic fundamental research that we will address these probl...

  14. System Analysis and Risk Assessment system (SARA) Version 4.0

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1992-01-01

    This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis

  15. Michael Jackson antes del caos

    Directory of Open Access Journals (Sweden)

    Juan Luciano Nieves

    2015-01-01

    Full Text Available Michael Jackson es un buen ejemplo de cómo utilizar las relaciones públicas para realizar o manipular la imagen de un producto a través de los medios de comunicación. Este ensayo pretende analizar los eventos que tuvieron lugar antes de que el cantante fuera acusado de abuso sexual contra un menor. Dichos eventos formaron parte de un plan muy bien delineado para disminuir los efectos de la inminente crisis que se acercaba. Este trabajo combina la crítica retórica de temas de fantasía con teoría de comunicación.

  16. The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...

  17. Calculations for the design and modification of the 2 cyclotrons of S.A.R.A

    International Nuclear Information System (INIS)

    Albrand, P.S.; Belmont, J.L.; Ripouteau, F.

    1983-09-01

    S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron

  18. PORTOFOLIO MARKOWITZ: UJI OPTIMAL HOLDING PERIOD DAN KINERJA PORTOFOLIO BERDASARKAN KRITERIA RISIKO DAN TARGET RETURN

    Directory of Open Access Journals (Sweden)

    Andi Ivand Markemo Boangmanalu

    2017-04-01

    Full Text Available The concept of mean-variance optimization, developed by Markowitz, is the cornerstone of modern finance theory. The objective of this portfolio construction is to minimize investment risk by forming optimal portfolios. Dynamic movement in capital markets requires not only changes in portfolio composition. Optimal portfolio is not only determined by the covariance between securities in the portfolio, but also by holding period. The aims of this study is to answer two research questions. The first research question is how long the optimal holding period that was resulted from trade-off between risk and return. This study using target return that are determined hypothetically as well as the risk criteria are divided into 3 namely the mean variance, semivarians and expected loss. Target returns are simulated in this study were divided into 3 criteria namely aggressive, moderate and conservative. The second research question is whether there are differences among the various portfolio performance based on criteria of risk and target return. Portfolio performance is measured by using excess return and the Sharpe index. In this study, stocks covered in LQ-45 index are used to construct efficient portoflio. Monthly price series for company and LQ-45 index for February 2004 to September 2008 are collected. The analysis found that optimal holing period is ranges between 1-5 months. Holding period of a portfolio that more than 5 months will provide risk and return trade-off less favorable. In addition this study found that there was no significant differences in portfolio performance based on overall scenarios

  19. Optimization model using Markowitz model approach for reducing the number of dengue cases in Bandung

    Science.gov (United States)

    Yong, Benny; Chin, Liem

    2017-05-01

    Dengue fever is one of the most serious diseases and this disease can cause death. Currently, Indonesia is a country with the highest cases of dengue disease in Southeast Asia. Bandung is one of the cities in Indonesia that is vulnerable to dengue disease. The sub-districts in Bandung had different levels of relative risk of dengue disease. Dengue disease is transmitted to people by the bite of an Aedesaegypti mosquito that is infected with a dengue virus. Prevention of dengue disease is by controlling the vector mosquito. It can be done by various methods, one of the methods is fogging. The efforts made by the Health Department of Bandung through fogging had constraints in terms of limited funds. This problem causes Health Department selective in fogging, which is only done for certain locations. As a result, many sub-districts are not handled properly by the Health Department because of the unequal distribution of activities to prevent the spread of dengue disease. Thus, it needs the proper allocation of funds to each sub-district in Bandung for preventing dengue transmission optimally. In this research, the optimization model using Markowitz model approach will be applied to determine the allocation of funds should be given to each sub-district in Bandung. Some constraints will be added to this model and the numerical solution will be solved with generalized reduced gradient method using Solver software. The expected result of this research is the proportion of funds given to each sub-district in Bandung correspond to the level of risk of dengue disease in each sub-district in Bandung so that the number of dengue cases in this city can be reduced significantly.

  20. Jack Michael's Motivation

    Science.gov (United States)

    Miguel, Caio F.

    2013-01-01

    Among many of Jack Michael's contributions to the field of behavior analysis is his behavioral account of motivation. This paper focuses on the concept of "motivating operation" (MO) by outlining its development from Skinner's (1938) notion of "drive." Conceptually, Michael's term helped us change our focus on…

  1. Social humanoid robot SARA: development of the wrist mechanism

    Science.gov (United States)

    Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.

    2018-01-01

    This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.

  2. Mengukur Politisasi Agama dalam Ruang Publik: Komunikasi SARA dalam Perdebatan Rational Choice Theory

    Directory of Open Access Journals (Sweden)

    Mohammad Supriyadi

    2015-12-01

    Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.

  3. Concurrent software system design supported by SARA at the age of one

    Energy Technology Data Exchange (ETDEWEB)

    Campos, I.M.; Estrin, G.

    A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.

  4. ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

    Directory of Open Access Journals (Sweden)

    Sulistyastuti Sutomo

    2015-01-01

    Full Text Available Not only does art   have   self-fullfillment, but  it also has axiological  benefits both socially, culturally, religiously, and economiclally.  So does Sara Douda dance.  Sara Douda aesthetics  is first contained  in its whole dance movements. In addition, it  can also be found in the whole dance equipments.  Moreover,  this dance aesthetics  may  also be contained in the verbal symbols in the speech forms  prior to the dance performance. However,  both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and  religious values in the Loli community about  their honoring their ancestors,  having social harmony, and  highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance.   Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...

  11. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    Science.gov (United States)

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...

  19. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  8. Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural

    Directory of Open Access Journals (Sweden)

    Tiara Kharisma

    2017-12-01

    Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

  12. Michael Wood’s Yangzhou Dream

    Institute of Scientific and Technical Information of China (English)

    Yuan; Dan

    2014-01-01

    <正>Mr.Michael Wood is a wellknown British historian and documentary maker who has produced more than a hundred documentaries on various national histories and cultures exemplified by The Story of India.They enjoy wide popularity in more than 150 countries.I met him in February when he took his fi lm crew to Yangzhou to shoot The Story of China documentary for the British Broadcasting Corporation(BBC).It was a snowy day,cold and wet,but Michael said happily that the

  13. Michael Tomasello: Award for Distinguished Scientific Contributions.

    Science.gov (United States)

    2015-11-01

    The APA Awards for Distinguished Scientific Contributions are presented to persons who, in the opinion of the Committee on Scientific Awards, have made distinguished theoretical or empirical contributions to basic research in psychology. One of the 2015 award winners is Michael Tomasello, who received this award for "outstanding empirical and theoretical contributions to understanding what makes the human mind unique. Michael Tomasello's pioneering research on the origins of social cognition has led to revolutionary insights in both developmental psychology and primate cognition." Tomasello's award citation, biography, and a selected bibliography are presented here. (c) 2015 APA, all rights reserved).

  14. Michael Heyrovsky, in memoriam (1932-2017)

    Czech Academy of Sciences Publication Activity Database

    Barek, J.; Černý, Slavoj; Herman, Zdeněk; Jindra, Jiří; Paleček, Emil

    2017-01-01

    Roč. 29, č. 8 (2017), s. 2001-2002 ISSN 1040-0397 Institutional support: RVO:68378114 ; RVO:61388955 ; RVO:68081707 Keywords : Michael Heyrovský Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings) Impact factor: 2.851, year: 2016

  15. Reframing Michael Scott: Exploring Inappropriate Workplace Communication

    Science.gov (United States)

    Schaefer, Zachary A.

    2010-01-01

    Individuals who work in professional settings interact with others who may exhibit a variety of cultural beliefs and decision-making approaches. Page (2007) argues that cognitive diversity (i.e., how people approach and attempt to solve problems) is a vital asset in effective organizations. Michael Scott, who portrays the inept main character on…

  16. Michael Hauskeller: Sex and the Posthuman Condition

    NARCIS (Netherlands)

    Miller, Lantz Eugene

    2016-01-01

    This new book from Michael Hauskeller explores the currently marketed or projected sex/love products that exhibit some trait of so-called “posthumanistic” theory or design. These products are so designated because of their intention to fuse high technologies, including robotics and computing, with

  17. Aza-Michael reaction: achievements and prospects

    International Nuclear Information System (INIS)

    Rulev, Alexander Yu

    2011-01-01

    Data published in the last 10 years on the use of the aza-Michael reaction in organic synthesis are described systematically. The attention is focused on environmentally friendly processes following green chemistry principles and on methods for the synthesis of compounds that are difficult to access by other routes.

  18. Transferring generic SARA/OSHA training to US Department of Energy facilities

    International Nuclear Information System (INIS)

    White, A.; McKinley, T.

    1989-01-01

    The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs

  19. SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

    DEFF Research Database (Denmark)

    Martin, Christer; Heinze, C.; Busch, M.

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...

  20. Michael Haneke film Euroopa parim / M. T.

    Index Scriptorium Estoniae

    M. T.

    2005-01-01

    IX PÖFFil linastuv Michael Haneke film "Varjatud" ("Cache") võitis laupäeval mitu Euroopa Filmiakadeemia auhinda, selhulgas parima filmi, parima lavastaja, parima meesnäitleja (Daniel Auteuil) ja FIPRESCI auhinna. Parim naisnäitleja - Julia Jentsch ("Sophie Scholli viimased päevad"), operaator - Franz Lustig ("Don't Come Knocking"), stsenaarium - Hany Abu-Assad, Bero Beyer ("Kohe paradiisi")

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...

  4. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    OpenAIRE

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...

  6. CERN Library and Art@CMS present Artist and Painter Xavier Cortada and CMS Physicist Pete Markowitz

    CERN Document Server

    CERN Library

    2013-01-01

    Xavier Cortada is an American artist and painter, and an artist in residence at Florida International University (FIU) College of Architecture and the Arts who also specializes in participatory art projects. His work includes art installations at the Earth’s poles to generate awareness about climate change, child welfare murals in Bolivia and peace murals in Cyprus. Xavier will be in conversation with CMS physicist Pete Markowitz, also from FIU, to discuss the participatory art piece which they developed together. The piece will be showcased in the CMS detector hall on Thursday 11 April during the experiment’s conference week. The piece promises to "engage 300 scientists from around the world in a performance art piece that transforms them into the very subatomic particles they research". It is the first piece by Art@CMS, a new project inspired by the Arts@CERN programme. Discover more about how this new piece was developed and more about Xavier’s ...

  7. Identification of Differentially Expressed Proteins in Liver in Response to Subacute Ruminal Acidosis (SARA Induced by High-concentrate Diet

    Directory of Open Access Journals (Sweden)

    X. Y. Jiang

    2014-08-01

    Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.

  8. SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-05-01

    Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.

  9. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    Science.gov (United States)

    Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

    2017-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.

  10. System Analysis and Risk Assessment System (SARA), Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.

    1992-02-01

    This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs

  11. Obituary: Michael James Ledlow, 1964-2004

    Science.gov (United States)

    Puxley, Philip John; Grashuis, Randon M.

    2004-12-01

    Michael James Ledlow died on 5 June 2004 from a large, unsuspected brain tumor. Since 2000 he had been on the scientific staff of the Gemini Observatory in La Serena, Chile, initially as a Science Fellow and then as a tenure-track astronomer. Michael was born in Bartlesville, Oklahoma on 1 October 1964 to Jerry and Sharon Ledlow. He obtained his Bachelor Degree in astrophysics at the University of Oklahoma in 1987 and attended the University of New Mexico for his graduate work, obtaining his PhD while studying Galaxy Clusters under Frazer Owen in 1994. From 1995-1997 Michael held a postdoctoral position with Jack Burns at New Mexico State University where he used various astronomical facilities including the VLA and Apache Point Observatory to study distant galaxies. From 1998-2000 Michael rejoined the Physics and Astronomy Department at the University of New Mexico where he was a visiting professor until he moved on to Gemini. At the Gemini Observatory, Mike shared in the excitement, hard work and many long days and nights associated with bringing on-line a major new astronomical facility and its instrumentation. Following its commissioning he assisted visiting observers, supported and took data for many more remote users via the queue system, and for each he showed the same care and attention to detail evident in his own research to ensure that all got the best possible data. His research concentrated on the radio and optical properties of galaxy clusters, especially rich Abell clusters such as A2125, on luminous radio galaxies, including the detection of a powerful double radio source in the "wrong sort of galaxy," the spiral system 0313-192, and on EROs (extremely red objects), dusty galaxies barely detectable at optical wavelengths. Michael thoroughly enjoyed living in Chile and enthusiastically immersed himself in the culture of his surroundings. He and his family were actively involved with the International English Spanish Association in La Serena. He had a

  12. Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

    2009-07-01

    Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench

  13. Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

    Science.gov (United States)

    Thomas, S. M.; Su, Y. C.; Hummel, P. R.

    2016-12-01

    Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance

  14. Development of an ion guide coupled to an on-line isotope separation system on Sara. Identification and study of isospin exotic nuclei at Isolde and Sara

    International Nuclear Information System (INIS)

    Bouldjedri, A.

    1992-06-01

    This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements

  15. Michael Roitmann : Kalandus ei ole Eestile ilmselt prioriteetne valdkond / Michael Roitmann ; interv. Marko Saaret

    Index Scriptorium Estoniae

    Roitmann, Michael

    2003-01-01

    Ilmunud ka: Delovõje Vedomosti 3. dets. lk. 9. Euroopa Komisjoni kalandusdirektoraadi koordinaator Euroopa Liidu laienemise küsimuses Michael Roitmann juhib tähelepanu Eesti kalanduse suurematele probleemidele ning prognoosib EL-iga liitumise mõju Eesti kalandussektori arengule

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  17. Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.

    1995-01-01

    Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...

  19. Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010

    OpenAIRE

    Beaulé, Sophie

    2014-01-01

    With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w

  1. Lepidoptera, Nymphalidae, Heliconiinae, Heliconius sara apseudes (Hübner, 1813: Distribution extension

    Directory of Open Access Journals (Sweden)

    Iserhard, C. A.

    2010-01-01

    Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.

  2. PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

    Directory of Open Access Journals (Sweden)

    Jorge A. Orrego-Ruiz

    2014-06-01

    Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.

  3. Michael Maier--nine newly discovered letters.

    Science.gov (United States)

    Lenke, Nils; Roudet, Nicolas; Tilton, Hereward

    2014-02-01

    The authors provide a transcription, translation, and evaluation of nine newly discovered letters from the alchemist Michael Maier (1568-1622) to Gebhardt Johann von Alvensleben (1576-1631), a noble landholder in the vicinity of Magdeburg. Stemming from the final year of his life, this correspondence casts new light on Maier's biography, detailing his efforts to secure patronage amid the financial crisis of the early Thirty Years' War. While his ill-fated quest to perfect potable gold continued to form the central focus of his patronage suits, Maier also offered his services in several arts that he had condemned in his printed works, namely astrology and "supernatural" magic. Remarks concerning his previously unknown acquaintance with Heinrich Khunrath call for a re-evaluation of Maier's negotiation of the discursive boundaries between Lutheran orthodoxy and Paracelsianism. The letters also reveal Maier's substantial contribution to a work previously ascribed solely to the English alchemist Francis Anthony.

  4. The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

    Science.gov (United States)

    Wood, M. A.

    2003-12-01

    The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.

  5. Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.

    Science.gov (United States)

    Zhao, Bryan M; Hoffmann, F Michael

    2006-09-01

    Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.

  6. Sara John: Ethnisierte Arbeit. Eine feministische Perspektive. Marburg: Tectum Wissenschaftsverlag 2009.

    Directory of Open Access Journals (Sweden)

    Grit Grigoleit

    2011-03-01

    Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.

  7. Interview with Michael Apple: The Biography of a Public Intellectual

    Science.gov (United States)

    Peters, Michael A.

    2015-01-01

    Michael W. Apple is the John Bascom Professor of Curriculum and Instruction and Educational Policy Studies in the Departments of Curriculum and Instruction (CI) and Educational Policy Studies (EPS) at the University of Wisconsin-Madison School of Education where he has taught since 1970. Michael Apple is one of the foremost educational theorists…

  8. Book Review: Invitation to Topological Robotics by Michael Farber

    DEFF Research Database (Denmark)

    Raussen, Martin

    2009-01-01

    Book Review: Invitaton to Topological Robotics by Michael Farber. Zurich Lectures in Advanced Mathematics, European Mathematical Society (2008), ISBN 978-3-03719-054-8......Book Review: Invitaton to Topological Robotics by Michael Farber. Zurich Lectures in Advanced Mathematics, European Mathematical Society (2008), ISBN 978-3-03719-054-8...

  9. A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

    Science.gov (United States)

    Worthen, Helena Harlow

    2012-01-01

    The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…

  10. Hemolytic disease of the fetus and newborn caused by an antibody to a low-prevalence antigen, anti-SARA.

    Science.gov (United States)

    Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy

    2011-09-01

    The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.

  11. Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

    Science.gov (United States)

    Goldrick-Rab, Sara; Kelly, Andrew P.

    2016-01-01

    In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…

  12. Obituary: Michael John Klein, 1940-2005

    Science.gov (United States)

    Gulkis, Samuel

    2006-12-01

    Michael John Klein died on 14 May 2005 at home in South Pasadena, California. The cause of death was tongue cancer that metastasized to the lungs. He was a non-smoker. Mike was a passionate radio astronomer, a trusted astronomical observer, an educator and a family man. Mike was born on 19 January 1940 in Ames, Iowa, the son of Florence Marie (Graf) and Fred Michael Klein. His mother was a homemaker, and his father was a banker. Mike had two older sisters, Lois Jean (Klein) Flauher and Marilyn June (Klein) Griffin. In 1962, Mike married his high school sweetheart Barbara Dahlberg, who survives him along with their three children, Kristin Marie (Klein) Shields, Michael John Klein Jr., Timothy Joel Klein, and six grandchildren. Mike developed a love for astronomy early in his life, and credited an early morning, newspaper-delivery route that he had at age twelve, which took him outside well before sunrise. He told family members that as he walked along his route, he stared into the sky and wondered what everything was. He studied sky charts, located stars, and began to understand how the planets shifted their positions relative to the stars each day. Another big influence in Mike's life was his brother in-law, Jim Griffin. Jim helped Mike understand that his passion for science did not have to remain a hobby, but could and should become a career. Jim's encouragement led Mike to attend Iowa State University in Ames, where he earned a BS in electrical engineering in 1962. Mike then started graduate school in electrical engineering at Michigan State, but after one semester transferred to the University of Michigan, Ann Arbor, where he earned an MS (1966) and PhD (1968) in astronomy. His doctoral dissertation, under the direction of Professor Fred Haddock, was based on extensive observations of the planets and examined the physical and thermal properties of planetary atmospheres and surfaces. Mike was awarded a Resident Research Associate position at JPL by the National

  13. Race, punishment, and the Michael Vick experience.

    Science.gov (United States)

    Piquero, Alex R; Piquero, Nicole Leeper; Gertz, Marc; Baker, Thomas; Batton, Jason; Barnes, J C

    2011-01-01

    Objective. The relationship between race and crime has been contentious, focusing primarily on offending and incarceration patterns among minorities. There has been some limited work on public perceptions of criminal punishment, and findings show that while minorities believe in the role and rule of law, they simultaneously perceive the justice system as acting in a biased and/or unfair manner. Two limitations have stalled this literature. First, research has focused mainly on criminal punishments to the neglect of noncriminal punishments. Second, most studies have not examined whether race remains salient after considering other demographic variables or discrimination and legitimacy attitudes.Methods. Using data from 400 adults, we examine how race affects perceptions of criminal punishment and subsequent reinstatement into the National Football League in the case of Michael Vick, a star professional quarterback who pled guilty to charges of operating an illegal dog-fighting ring.Results. Findings show that whites are more likely to view Vick's punishment as too soft and that he should not be reinstated, while nonwhites had the opposite views. Race remained significant after controlling for other variables believed to be related to punishment perceptions.Conclusion. Attitudes toward both criminal punishment and NFL reinstatement vary across race such that there exists important divides in how individuals perceive the system meting out punishment and subsequently reintegrating offenders back into society. These results underscore that white and nonwhites perceive the law and its administration differently.

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

  15. NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r

  20. Escribiendo el silencio: la contemplación poética de Sara Pujol

    Directory of Open Access Journals (Sweden)

    Gala, Candelas

    2005-06-01

    Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.

  1. Michael Polanyi: Patriarch of Chemical Dynamics and Tacit Knowing.

    Science.gov (United States)

    Herschbach, Dudley R

    2017-03-20

    Connecting Science and the Humanities was the title of the symposium on Michael Polanyi that took place at the Technische Universität Berlin (Technical University of Berlin) in October 2016. This essay, which appraises the scientific and philosophical contributions of Michael Polanyi, is based on the presentation given by Dr. Herschbach on this occasion. In the photograph: Polanyi in 1931. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Principles of Chemistry (by Michael Munowitz)

    Science.gov (United States)

    Kovac, Reviewed By Jeffrey

    2000-05-01

    At a time when almost all general chemistry textbooks seem to have become commodities designed by marketing departments to offend no one, it is refreshing to find a book with a unique perspective. Michael Munowitz has written what I can only describe as a delightful chemistry book, full of conceptual insight, that uses a novel and interesting pedagogic strategy. This is a book that has much to recommend it. This is the best-written general chemistry book I have ever read. An editor with whom I have worked recently remarked that he felt his job was to help authors make their writing sing. Well, the writing in Principles of Chemistry sings with the full, rich harmonies and creative inventiveness of the King's Singers or Chanticleer. Here is the first sentence of the introduction: "Central to any understanding of the physical world is one discovery of paramount importance, a truth disarmingly simple yet profound in its implications: matter is not continuous." This is prose to be savored and celebrated. Principles of Chemistry has a distinct perspective on chemistry: the perspective of the physical chemist. The focus is on simplicity, what is common about molecules and reactions; begin with the microscopic and build bridges to the macroscopic. The author's perspective is clear from the organization of the book. After three rather broad introductory chapters, there are four chapters that develop the quantum mechanical theory of atoms and molecules, including a strong treatment of molecular orbital theory. Unlike many books, Principles of Chemistry presents the molecular orbital approach first and introduces valence bond theory later only as an approximation for dealing with more complicated molecules. The usual chapters on descriptive inorganic chemistry are absent (though there is an excellent chapter on organic and biological molecules and reactions as well as one on transition metal complexes). Instead, descriptive chemistry is integrated into the development of

  3. Intravenous immunoglobulin in the management of a rare cause of hemolytic disease of the newborn: Anti-SARA antibodies.

    Science.gov (United States)

    Venkataraman, Rohini; Yusuf, Kamran

    2017-01-01

    Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.

  4. Guest Foreword from Michael Thomas CMG QC

    Directory of Open Access Journals (Sweden)

    Michael Thomas

    2012-04-01

    precedents and thought in a unique legal market in which ideas drawn from Islamic law, civil law and common law can intermingle and blend. It is not surprising therefore to see that this new publication will be dedicated to the subject of international law, both public and private. Its laudable aim is to promote legal discourse around the world, and to promote a wider international understanding of contemporary legal issues for the common benefit. As an open access, bilingual journal, addressing topics concerning any jurisdiction, I hope it will reach a wide audience, and fulfil its aim of promoting understanding between different cultures. I am sure that the journal will not only benefit Qatar’s legal community by advancing academic and practice-based legal discussion. I am also confident that it will stimulate thought in the global legal community at large. May I wish it every success and a long life. Michael Thomas CMG QC

  5. Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

    Directory of Open Access Journals (Sweden)

    Tirshem Kumar Kaushik

    2015-05-01

    Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.

  6. Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge

    DEFF Research Database (Denmark)

    Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette

    2017-01-01

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...

  7. TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

    Energy Technology Data Exchange (ETDEWEB)

    1989-03-01

    This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.

  8. Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.

    1994-11-01

    The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)

  9. Instructional materials for SARA/OSHA training. Volume 1, General site working training

    Energy Technology Data Exchange (ETDEWEB)

    Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)

    1988-04-01

    This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.

  10. La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli

    Directory of Open Access Journals (Sweden)

    Umberto Fortis

    2014-04-01

    Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.

  11. Reading Sara Pujol Russell’s Poetry of Contemplation and Connection

    Directory of Open Access Journals (Sweden)

    Anita M. Hart

    2012-06-01

    Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.

  12. SAPHIRE technical reference manual: IRRAS/SARA Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.

    1993-01-01

    This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix

  13. Obituary: Michael John Seaton, 1923-2007

    Science.gov (United States)

    Pradhan, Anil; Nahar, Sultana

    2007-12-01

    Professor Michael John Seaton, hailed as the "Father of Atomic Astrophysics," passed away on May 29, 2007. He was one of the few Honorary Fellows of both the American Astronomical Society and the American Physical Society, so honored for his monumental contributions to both physics and astronomy. Mike Seaton was born on January 16, 1923 in Bristol, England. He attended Wallington County High School. But his leftist political activities, even at that stage, led to his expulsion, though he was eventually allowed to matriculate. He enlisted in the Royal Air Force as a navigator during the Second World War, and flew many dangerous missions. His legendary concentration and precision are reflected in the following anecdote. Once after a bombing mission his aircraft was lost in fog over the Alps. Seaton calculated the position and coordinates in flight to guide the aircraft. When the fog lifted, the crew found themselves flying perilously close to the mountains, but made it safely back. His associates often said, "A Seaton calculation is carried out as if his life depended on it." After the War he was admitted to University College London (UCL) as an undergraduate. Thereafter, he spent all of his professional career at UCL. Seaton received his Batchelor's degree in 1948, and his Ph.D. in 1951. His tenure at UCL coincided with the golden age of atomic astrophysics, for he was largely responsible for it. Seaton was elected Fellow of the Royal Society in 1967, and as President of the Royal Astronomical Society (RAS) in 1978. He was the recipient of an Honorary Doctorate from the Observatoire de Paris, an Honorary D.Sc. from the Queen's University of Belfast, the Gold Medal for Astronomy by the RAS, the Guthrie Medal by the Institute of Physics, the Royal Society Hughes award for lifetime work by the RAS, and several other prestigious awards. Nevertheless, as Alex Dalgarno recently remarked, Seaton was not part of the establishment because he chose not to be. Though rooted in

  14. Tweeting Prayers and Communicating Grief over Michael Jackson Online

    Science.gov (United States)

    Sanderson, Jimmy; Cheong, Pauline Hope

    2010-01-01

    Death and bereavement are human experiences that new media helps facilitate alongside creating new social grief practices that occur online. This study investigated how people's postings and tweets facilitated the communication of grief after pop music icon Michael Jackson died. Drawing on past grief research, religion, and new media studies, a…

  15. Professor Porter ja tema viis konkurentsitegurit / Michael E Porter

    Index Scriptorium Estoniae

    Porter, Michael E

    2008-01-01

    Maailmas tuntud juhtimisguru Michael Porter viie konkurentsijõu teooriast ja selle rakendatavusest erinevates valdkondades. Lisad: Erinevused valdkondade kasumlikkuses; 5 määravat konkurentsijõudu; Investeeritud kapitali keskmine tasuvus; Mõnede USA tegevusvaldkondade kasumlikkus; Valdkonnaanalüüs praktikas; Valdkonna määratlemine; Valdkonnaanalüüsi sammud

  16. A Good Time: A Conversation with C. Michael Nelson

    Science.gov (United States)

    Zabel, Robert; Kaff, Marilyn; Teagarden, Jim

    2015-01-01

    C. Michael Nelson began his special education career as a teacher of adolescents with learning and behavior disorders. He has worked as a child psychologist and as a professor with the Department of Special Education and Rehabilitation Counseling at the University of Kentucky. He coordinated the graduate Personnel Preparation Program for Teachers…

  17. Eesti luksushotellide ristiisa / Michael Stenner ; interv. Malle Koido

    Index Scriptorium Estoniae

    Stenner, Michael

    2007-01-01

    Eesti tipphotelle 1997. aastast juhtinud sakslane, praegu hotellide Kolm Õde ja Telegraaf juht räägib Eesti ja Saksamaa erinevustest, Eesti hotelliärist, teeninduskultuurist ja personalist. Lisa: Kes on Michael Stenner ning kuidas ta Eestisse sattus? Ilmunud ka: Linnaleht : Pärnu, 23. veebr. 2007, lk. 5-6

  18. Michael Polanyi on the Education and Knowledge of Scientists.

    Science.gov (United States)

    Jacobs, Struan

    2000-01-01

    Explains why teachers addressing the nature of science should know the work of Michael Polanyi. Outlines Polanyi's intellectual career and examines his ideas on the education of scientists, research, and knowledge. Polanyi presaged Kuhn, Feyerabend, and the constructivists, yet insisted that science produces true knowledge about reality. (Contains…

  19. Michael Moore kaevati kohtusse pettuse eest / Mari Rebane

    Index Scriptorium Estoniae

    Rebane, Mari

    2006-01-01

    Dokumentaalfilm "9/11 Fahrenheiti" ("Fahrenheit 9/11") : režissöör Michael Moore : USA 2004. Iraagi sõja invaliidistunud veteran andis režissööri kohtusse teda kujutavate flmikaadrite loata ja tenentsliku kasutamise pärast

  20. SuchThatCast Episode 6: Michael Boylan

    NARCIS (Netherlands)

    Soraker, Johnny

    2012-01-01

    Michael Boylan is the John J. McDonnell jr chair in Ethics, and professor and chair of the philosophy department at Marymount University in Arlington, Virginia. In addition to being a poet and novelist, he has written more than 100 published articles and 25 books primarily in ethics, social and

  1. Berliinis võidutses Michael Haneke / Jüri Laulik

    Index Scriptorium Estoniae

    Laulik, Jüri, 1959-

    2005-01-01

    IX PÖFFil linastuv Michael Haneke film "Varjatud" ("Cache") võitis laupäeval mitu Euroopa Filmiakadeemia auhinda, sealhulgas parima filmi, parima lavastaja ja parima meesnäitleja (Daniel Auteuil) auhinna. Parima naisnäitleja tiitli pälvis Julia Jentsch ("Sophie Scholli viimased päevad"). Elutööpreemia sai sir Sean Connery

  2. Aza-Michael Reaction for an Undergraduate Organic Chemistry Laboratory

    Science.gov (United States)

    Nigam, Manisha; Rush, Brittney; Patel, Jay; Castillo, Raul; Dhar, Preeti

    2016-01-01

    A green, aza-Michael reaction is described that can be used to teach undergraduate students conjugate addition of nitrogen nucleophile to an a,ß-unsaturated ester. Students analyze spectral data of the product obtained from the assigned reaction to determine product structure and propose the mechanism of its formation. The experiment requires…

  3. Educational Implications of Michael Fishbane's "Sacred Attunement: A Jewish Theology"

    Science.gov (United States)

    Marom, Daniel

    2008-01-01

    This article posits Michael Fishbane's Judaic scholarship as a prime resource for Jewish education. The link between the two fields can be made through a translation of the theological underpinnings of Fishbane's insights into Judaism to educational purposes and practices. Initial work with Jewish educators on establishing this link encouraged…

  4. Correspondence of Michael Faraday, v.5 1855-1860

    CERN Document Server

    Faraday, Michael

    2008-01-01

    This volume includes 70% of previously unpublished letters of Michael Farday spanning half of the 1850s and most of 1860. Topics include Faraday's work on regelation, the transmission of light through gold and his appointment by Emperor Napoleon III to be a Commander of the Legion of Honour.

  5. Optimasi Portofolio Resiko Menggunakan Model Markowitz MVO Dikaitkan Dengan Keterbatasan Manusia Dalam Memprediksi Masa Depan Dalam Perspektif Al-Qur`an

    Directory of Open Access Journals (Sweden)

    Noor Saif Muhammad Mussafi

    2012-04-01

    Full Text Available Risk portfolio on modern finance has become increasingly technical, requiring the use of sophisticated mathematical tools in both research and practice. Since companies cannot insure themselves completely against risk, as human incompetence in predicting the future precisely that written in Al-Quran surah Luqman verse 34, they have to manage it to yield an optimal portfolio. The objective here is to minimize the variance among all portfolios, or alternatively, to maximize expected return among all portfolios that has at least a certain expected return. Furthermore, this study focuses on optimizing risk portfolio so called Markowitz MVO (Mean-Variance Optimization. Some theoretical frameworks for analysis are arithmetic mean, geometric mean, variance, covariance, linear programming, and quadratic programming. Moreover, finding a minimum variance portfolio  produces a convex quadratic programming, that is minimizing the objective function  with constraints ≥ and = . The outcome of this research is the solution of optimal risk portofolio in some investments that could be finished smoothly using MATLAB R2007b software together with its graphic analysis.

  6. Michael Pärt ئ suure muusika taustajõud / Michael Pärt ; interv. Siim Nestor

    Index Scriptorium Estoniae

    Pärt, Michael

    2008-01-01

    Arvo Pärdi pojast Michael Pärdist. Tema tööst "music editor"-ina - helimonteerijana, tööst muusika produktsiooni, salvestamise ja muusika kirjutamise abijõuna. Koostööst maailmas tuntud muusikutega

  7. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    Directory of Open Access Journals (Sweden)

    Abdullah K. Shehabat

    2016-09-01

    Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.

  8. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0. Volume 5, Systems Analysis and Risk Assessment (SARA) tutorial manual

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities

  9. SARA South Observations and Analysis of the Solar Type, Totally Eclipsing, Over Contact Binary, PY Aquarii

    Science.gov (United States)

    Chamberlain, Heather; Samec, Ronald G.; Caton, Daniel Bruce; Van Hamme, Walter

    2018-01-01

    PY Aqr (GSC 05191-00853) is a solar Type (T ~ 5750K) eclipsing binary. It was observed in July to October, 2017 at Cerro Tololo in remote mode with the 0.6-m SARA South reflector. Two times of minimum light were calculated from our present observations, a primary and a secondary eclipse:HJD Min I = 2457951.7762±0.0006 HJD Min II = 2458019.5295±00.0003. Both weighted as 1.0.In addition, four timings were determined from online data given in IBVS 5600 and five observations at minima were determined from archived All Sky Automated Survey Data:HJD Min I = 2452908.3165, 2452912.33612 HJD Min II = 2452877.5621, 2452913.34465. All weighted as 0.5.ASAS Observations at minima: 2452094.688, 2453478.882, 2453266.576, 2452093.685 and 54729.600. Each weighted as 0.10The following linear and quadratic ephemerides were determined from all available times of minimum light:JD Hel Min I=2452951.7443±0.0008d + 0.402093441±0.000000099 X E {1} JD Hel Min I=2452951.7439±0.0007d + 0.4020912±0.0000007 X E +0.00000000018 ± 0.00000000006 X E2 {2}A BVRI Bessell filtered simultaneous Wilson-Devinney Program (W-D) solution reveals that the system has a mass ratio of ~0.34 and a component temperature difference of only ~40 K. One low luminosity (Tfact ~ 0.94, ~66 degree radius) large cool region of spots was iterated on the primary component in the WD Synthetic Light Curve computations. It appears in the Southern Hemisphere (colatitude 155 degrees). The Roche Lobe fill-out of the binary is ~17%. The inclination is ~86 degrees. An eclipse duration of ~10 minutes was determined for the primary eclipse and the light curve solution. Additional and more detailed information is given in this report.

  10. DETERMINACIÓN DE LAS FRACCIONES SARA DE ASFALTOS COLOMBIANOS ENVEJECIDOS AL MEDIO AMBIENTE EMPLEANDO CROMATOGRAFÍA LÍQUIDA EN COLUMNA DETERMINAÇÃO DAS FRAÇÕES SARA DE ASFALTOS COLOMBIANOS ENVELHECIDOS AO MÉDIO AMBIENTE EMPREGANDO CROMATOGRAFIA LÍQUIDA EM COLUNA DETERMINATION OF SARA FRACTIONS OF ENVIRONMENTALLY AGED COLOMBIAN ASPHALTS USING LIQUID CHROMATOGRAPHY COLUMN

    Directory of Open Access Journals (Sweden)

    Fredy Alberto Reyes

    2012-06-01

    Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p

  11. Double Michael Addition Reaction of Bischalcone under Ultrasound

    Institute of Scientific and Technical Information of China (English)

    LI,Ji-Tai; XU,Wen-Zhi; CHEN,Guo-Feng; LI,Tong-Shuang

    2004-01-01

    @@ The Michael addition of 1,5-diaryl-1,4-pentadien-3-ones with active methylene compounds has been the subjects of many investigations. Ultrasound has increasingly been used in organic synthesis in the last three decades. Compared with traditional methods, this method is more convenient and easily controlled. A large number of organic reactions can be carried out in higher yield, shorter reaction time or milder conditions under ultrasonic irradiation. KF/Al2O3 as a useful solid supported catalyst has received considerable attention because of their high level of chemoselectivity and environmental compatibility as well as simplicity of operation and their ready availability at low cost. Herein we report the double Michael addition of dibenzalacetone with active methlene compounds such as dimethyl malonate, diethyl malonate,methyl cyanoacetate and ethyl cyanoacetate catalyzed by KF/Al2O3 under ultrasound irradiation.

  12. Asymmetric Michael Addition Mediated by Chiral Ionic Liquids

    Science.gov (United States)

    Suzuki, Yumiko

    2018-01-01

    Chiral ionic liquids with a focus on their applications in asymmetric Michael additions and related reactions were reviewed. The examples were classified on the basis of the mode of asymmetric induction (e.g., external induction/non-covalent interaction or internal induction/covalent bond formation), the roles in reactions (as a solvent or catalyst), and their structural features (e.g., imidazolium-based chiral cations, other chiral oniums; proline derivatives). Most of the reactions with high chiral induction are Michael addition of ketones or aldehydes to chalcones or nitrostyrenes where proline-derived chiral ionic liquids catalyze the reaction through enamine/ iminium formation. Many reports demonstrate the recyclability of ionic liquid-tagged pyrrolidines. PMID:29861702

  13. Asymmetric Michael Addition Mediated by Chiral Ionic Liquids.

    Science.gov (United States)

    Suzuki, Yumiko

    2018-06-01

    Chiral ionic liquids with a focus on their applications in asymmetric Michael additions and related reactions were reviewed. The examples were classified on the basis of the mode of asymmetric induction (e.g., external induction/non-covalent interaction or internal induction/covalent bond formation), the roles in reactions (as a solvent or catalyst), and their structural features (e.g., imidazolium-based chiral cations, other chiral oniums; proline derivatives). Most of the reactions with high chiral induction are Michael addition of ketones or aldehydes to chalcones or nitrostyrenes where proline-derived chiral ionic liquids catalyze the reaction through enamine/ iminium formation. Many reports demonstrate the recyclability of ionic liquid-tagged pyrrolidines.

  14. Pengaruh Tipografi pada Era Massimo Vignelli terhadap Tipografi Michael Bierut

    Directory of Open Access Journals (Sweden)

    Irwan Harnoko

    2011-10-01

    Full Text Available Massimo Vignelli is a senior graphic designer lived in New York, as a vocal modernism against post-modernism. His statement firmly opposing post-modernism in several occasions: interview in Helvetica the movie, typeradio, talkshow, and some articles in Looking Closer or AIGA Journal. Graphic design works of Massimo Vignelli reflected his characteristic, which is firmly choosing typeface. Typefaces of Vignelly are around 5 typefaces: Bodoni, Helvetica, Times Roman, Century, and Futura. The article uses formal analysis method. The writers collected materials about Michael Bierut, Massimo VIgnelli and Tibor Kalman from books and websites. The writers compare the typeface opinion of Massimo Vignelli (modernism designer, Michael Bierut designer (transition era designer from modernism to post-modernism, and Tibor Kalman (a designer in A Century of Graphic Design, as the influencer of Bierut’s betrayal over Vignelli. 

  15. Tribute to Professor Anthony J. McMichael

    Directory of Open Access Journals (Sweden)

    Ashwin Swaminathan

    2014-11-01

    Full Text Available Emeritus Professor A. J. “Tony” McMichael (1942–2014 was an internationally renowned and pioneering Australian academic and advocate in epidemiology, who was passionate about understanding the influences of the environment on human health. In an illustrious career spanning more than four decades, he made significant contributions to the scientific community and policy discourse—including ground-breaking research related to the health of children. McMichael was a prolific academic writer with over 300 peer-reviewed papers; 160 book chapters and two sole-authored books. However, his outstanding talent was for integrating complex and seemingly unrelated strands from the environmental and health sciences into a cohesive narrative—and highlighting its relevance to lay persons, scientists and governments alike. He was instrumental in validating this nascent field of research and inspiring many others to follow his lead.

  16. Political Cinema and Culture industry: the work of Michael Moore

    OpenAIRE

    Cristiane Toledo Maria

    2015-01-01

    This article aims to reflect upon the production of the American filmmaker Michael Moore, proposing as a central question the relationship established between art and politics in a historical moment which, on one side, points to the crisis of capitalism and, on the other side, to the political fragmentation of the working class. Focusing on the analysis of the documentaries Roger & Me (1989) and Capitalism: a love story (2009), this article is an attempt to understand the method developed by ...

  17. Entretien avec Michael Quinn Patton | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    9 févr. 2011 ... Michael Quinn Patton, évaluateur de renommée internationale, était récemment au CRDI .... C'est un mode de pensée analytique qui doit tout imprégner. ... des données solides et crédibles sur ce qui marche et ce qui ne marche pas. ... des emplois, des infrastructures et un accès à la nourriture et aux mar.

  18. Euroopa parimaks filmiks sai Michael Haneke "Valge lint" / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2009-01-01

    Euroopa Filmiakadeemia auhindadest: parima filmiauhinna sai Saksamaal Bochumis toimunud tseremoonial Michael Haneke "Valge lint", mille eest Haneke sai ka parima režissööri ja stsenaristi auhinna. Parimaks meesnäitlejaks pärjati Tahar Rahim ("Un Prophete"), parimaks naisnäitlejaks Kate Winslet ("The Reader"), publikupreemia sai Danny Boyle'i "Rentslimiljonär. Ka teistest võitjatest

  19. Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia

    Directory of Open Access Journals (Sweden)

    Tjitske F. Lawerman

    2017-12-01

    Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced

  20. sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

    DEFF Research Database (Denmark)

    Christner, Martin; Heinze, Constanze; Busch, Michael

    2012-01-01

    to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...

  1. Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

    Science.gov (United States)

    Godwin, Allison; Potvin, Geoff

    2017-01-01

    This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…

  2. Staphylococcus aureus Quorum Regulator SarA Targeted Compound, 2-[(Methylaminomethyl]phenol Inhibits Biofilm and Down-Regulates Virulence Genes

    Directory of Open Access Journals (Sweden)

    P. Balamurugan

    2017-07-01

    Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.

  3. Eficiência das Companhias Abertas e o Risco versus Retorno das Carteiras de Ações a partir do Modelo de Markowitz

    Directory of Open Access Journals (Sweden)

    Tatiana Marceda Bach

    2015-04-01

    Full Text Available As decisões sobre em qual carteira investir para reduzir o risco e maximizar o retorno das ações podem ser auxiliadas aliando-se os modelos Análise por Envoltória de Dados (DEA e a seleção de carteiras eficientes de Markowitz. Pretende-se, nesta investigação, analisar se existe relação entre a eficiência, o retorno e o risco das carteiras diversificadas no mercado brasileiro de ações. Entre os principais resultados, destaca-se que as empresas consideradas mais eficientes, ao nível de 100%, tiveram suas ações e estratégias focadas na maximização do valor do acionista e na realização de auditorias. Houve uma maior predominância de companhias vinculadas aos setores de construção, alimentos e bebidas, siderurgia e metalurgia, têxtil e de transporte e serviços. As carteiras que apresentaram a melhor relação do risco em função do seu total de ativos, também apresentaram, de forma complementar, o índice de Sharpe superior. Desse modo, se o investidor tiver um perfil avesso ao risco a melhor opção seria investir em uma carteira com risco menor e, por outro lado, se o investidor for mais ponderado em relação ao risco, este pode decidir pela adoção de uma carteira que apresente um risco maior em função de um dado retorno. Não houve indícios sobre a relação entre as companhias definidas como eficientes e uma melhor relação entre o risco e o retorno do investidor, ou seja, o fato de serem consideradas eficientes não oferece suporte para que sejam realizados investimentos nas carteiras formadas por elas. Dessa forma, quando se pretende investir em uma carteira de ativos, as companhias consideradas eficientes não podem ser tomadas como parâmetros para a maximização da relação risco e retorno.

  4. Michael Kohlhaas or the Germans and Their Law

    Directory of Open Access Journals (Sweden)

    Heike Jung

    2014-12-01

    Full Text Available Asked to pick a single representative ‘German’ piece for a discourse on ‘Law and Literature’ one almost inevitably ends up with Kleist’s tale Michael Kohlhaas. It seems to be the literary incarnation of the German stance vis-à-vis the law. It is all about horses; it could just as well be about dogs. Kohlhaas fights a devastating battle, using legal means and outright violence, even warfare, for their recovery in good shape. Victorious eventually with his legal actions, he is happy to trade in his own life for this victory, thus giving an extreme example for the nice line between being in the right and pursuing this position with disproportionate rigour. Of course, the interpretations of Michael Kohlhaas (which, in its complete version, dates of 1810 have varied from epoch to epoch as well as from reader to reader. It is not possible to rehearse the bulk of ‘Kohlhaas literature’. In comparing legal cultures, it might be of interest to look into the question why such a somber story on the law forms part and will continue to form part of the German cultural heritage. Si se tiene que elegir un único representante “alemán” para una ponencia sobre “derecho y literatura”, es inevitable optar por la obra de Kleist, Michael Kohlhaas. Parece la encarnación literaria de la posición alemana hacia el derecho. El libro trata de caballos; también podría tratar sobre perros. Kohlhaas libra una batalla devastadora usando medios legales y la violencia pura y dura, incluso la guerra, para que se recuperen en buena forma. Finalmente resulta ganador mediante acciones legales, está contento de dedicar su propia vida para conseguir esta victoria, dando así un ejemplo extremo de la línea que existe entre tener la razón y seguir esta posición con un rigor desproporcionado. Por supuesto, las interpretaciones de Michael Kohlhaas (publicado en 1810 han variado de una época a otra, y de un lector a otro. No es posible revisar el grueso de

  5. The Correspondence of Michael Faraday Pt 6 1860-1867

    CERN Document Server

    Frank, James

    2012-01-01

    Michael Faraday (1791-1867) was one of the most important men of science in nineteenth century Britain. His discoveries of electro-magnetic rotations (1821) and electro-magnetic induction (1831) laid the foundations of the modern electrical industry. His discovery of the magneto-optical effect and diamagnetism (1845) led him to formulate the field theory of electro-magnetism, which forms one of the cornerstones of modern physics.These and a whole host of other fundamental discoveries in physics and chemistry, together with his lecturing at the Royal Institution, his work for the state (includi

  6. Michael Marinov memorial volume multiple facets of quantization and supersymmetry

    CERN Document Server

    Vainshtein, A I

    2002-01-01

    This book is dedicated to the memory of Michael Marinov, the theorist who, together with Felix Berezin, introduced the classical description of spin by anticommuting Grassmann variables. It contains original papers and reviews by physicists and mathematicians written specifically for the book. These articles reflect the current status and recent developments in the areas of Marinov's research: quantum tunneling, quantization of constrained systems, supersymmetry, and others. The personal recollections included portray the human face of M Marinov, a person of great knowledge and integrity.

  7. The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters

    International Nuclear Information System (INIS)

    Iazzourene, F.

    1982-01-01

    The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr

  8. Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

    Directory of Open Access Journals (Sweden)

    Helena López

    2013-07-01

    Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.

  9. Os suínos da raça Bísara – oportunidades e desafios

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...

  10. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  11. A Study of Postmodern Narrative in Michael Cunningham's The Hours

    Directory of Open Access Journals (Sweden)

    Hajar Abbasi Narinabad

    2012-09-01

    Full Text Available This project aims at providing a detailed analysis of the major features of the theory of postmodern narrative and at going through the novel The Hours by the American writer Michael Cunningham concentrating on some postmodern narrative techniques. To do so, the researcher goes through the theories set forth by some postmodern theoreticians like Roland Barthes, Jacque Derrida, Jean-François Lyotard and Julia Kristeva to investigate the postmodern narrative techniques and elements used in the novel. The researcher first examines the theories and then critically applies them on the novel. The article goes through the most eminent elements of postmodern narrative including intertextuality, stream of consciousness style, fragmentation and representation respectively which are delicately utilized in The Hours. The article concludes by recommending a few directions for the further research.

  12. Michael Longley’s Father: Memory, Mourning and History

    Directory of Open Access Journals (Sweden)

    Barry Sloan

    2012-03-01

    Full Text Available Michael Longley’s father has been a recurring presence in the poet’s work from his earliest to his most recent collection. This paper examines the exceptional strength of that bond reflected in the varied and changing ways in which the poet has responded to it – memorizing and mourning his loss; discovering through his father’s First World War stories a means of memorialising loss of life in contemporary conflicts and a way of facing the history of the twentieth century; confronting his own ageing and sense of mortality; and marking the specific, but also representative, generational history of his family. Close readings of key poems are offered to highlight Longley’s skills in meeting his own exacting standards of aesthetic propriety and moral and social responsibility for writers of elegy in order to avoid either exploitation of tragedy and loss, or facile gestures of consolation.

  13. Estratégia competitiva: Michael Porter 30 anos depois

    Directory of Open Access Journals (Sweden)

    Manuel Portugal Ferreira

    2009-12-01

    Full Text Available Os estudos de estratégia têm sido muito influenciados pelos trabalhos de Michael Porter, em todas as suas fases, como as cinco forças, as estratégias genéricas, a cadeia de valor e as vantagens competitivas das nações. Neste artigo, analisou-se a influência de Porter nos trabalhos brasileiros em estratégia, a partir dos trabalhos selecionados e apresentados no EnANPAD. No levantamento para a análise dos artigos, considerando 10 anos de EnANPAD (1997-2006, foram selecionados 46 artigos. A identificação e seleção dos artigos envolveram os seguintes critérios: busca complementar por palavra-chave Porter na base de dados do EnANPAD; avaliação dos títulos e resumos dos artigos apresentados na área de estratégia entre 1997 e 2006, bem como na íntegra quando necessário. Procedeu-se também à análise das referências utilizadas nos artigos e o posicionamento dos autores em relação às tipologias de Porter. Como resultado, verificou-se que Michael Porter é um autor com grande influência nas pesquisas acadêmicas de estratégia. Seus estudos mais utilizados são os da análise da indústria e das estratégias genéricas, e também se verificou que a maioria dos estudos analisados é favorável aos seus conceitos, mesmo existindo pesquisas contrárias.

  14. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Diego O Andrey

    Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  15. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    OpenAIRE

    Abdullah K. Shehabat

    2016-01-01

    This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...

  16. Studying Teachers and Schools: Michael Pressley's Legacy and Directions for Future Research

    Science.gov (United States)

    Mohan, Lindsey; Lundeberg, Mary A.; Reffitt, Kelly

    2008-01-01

    Much of Michael Pressley's work during the past decade focused on the nature of highly effective, engaging literacy instruction. Michael Pressley believed that studying effective teachers and schools had the potential to influence more engaging and effective teaching, especially in underresourced schools. First, we describe the grounded…

  17. Markets, Marx, Modernity and Mathematics Education: A Response to Michael Apple.

    Science.gov (United States)

    Gates, Peter

    This paper is a response to Michael Apple's paper, "What Postmodernists Forget: Cultural Capital and Official Knowledge." The paper advocates Michael's identification of the current dangers and processes of the growth of new right ideologies in the development of subjectivity, society, and education. The differences in success in the education…

  18. Reflections on Michael Hardt and Antonio Negri’s Book “Assembly”

    Directory of Open Access Journals (Sweden)

    Christian Fuchs

    2017-10-01

    Full Text Available This contribution presents reflections on Michael Hardt and Antonio Negri’s book “Assembly” (2017, Oxford: Oxford University Press, ISBN 978-0190677961. Keywords: assembly, Michael Hardt, Antonio Negri, multitude, common, entrepreneurship of the multitude, the new Prince, digital capitalism, digital assemblage, neoliberalism, finance

  19. Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests

    International Nuclear Information System (INIS)

    Eifler, W.; Shepherd, I.M.

    1983-01-01

    Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix

  20. Land-use evaluation for sustainable construction in a protected area: A case of Sara mountain national park.

    Science.gov (United States)

    Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena

    2018-01-15

    The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Michael Field’s “A Dance of Death”

    Directory of Open Access Journals (Sweden)

    LeeAnne Richardson

    2012-03-01

    Full Text Available The 1912 poem "A Dance of Death" by Michael Field (pen name of Katherine Bradley and her niece Edith Cooper depicts Salome in an alternate version of the biblical story: this Salome dances on a frozen river, falls through the ice, and is decapitated on a jagged edge. Nonetheless, her beautiful head continues dancing over the frozen river. This poem is highly unusual, especially in the context of the other poems in the postconversion volume Poems of Adoration, because it questions, rather than submits to, authority. In re-writing a familiar Christian tale, as well as a familiar decadent theme, Field uses the poem to assert the supremacy of their artistic vision, which (despite their ardent Catholicism cannot be subject to any law outside themselves. Like the continually dancing head of Salome, which continues to create beauty even after nature (and perhaps God has struck it down, the poet is subjugate only to her own law and creates without boundaries or restrictions on her art. Bradley and Cooper were acutely aware of their authorial persona (actively taking not only a masculine but also a singular poetic identity, and their mode of reconciling the apparent contradictions of this identity are mirrored in their presentation of Salome in a "Dance of Death."

  2. A Musical Italy: Michael W. Balfe’s Italian Experiences

    Directory of Open Access Journals (Sweden)

    Basil Walsh

    2016-06-01

    Full Text Available The Dublin-born musician, Michael W. Balfe, was a singer, composerand conductor whose brilliant musical career was heavily influenced byformative experiences in Italy. In 1825, Balfe, interested in broadeninghis musical studies first went to Paris where he was introduced to thegreat composers, Luigi Cherubini and Gioachino Rossini, who took apersonal interest in him and his musical talents. On the advice of Rossinihe spent the next few years in Italy studying singing with the famousRossini singer, Filippo Galli, and taking music composition lessonsfrom Ferdinando Paer, in Rome. Later in Milan he studied harmonyand counterpoint with Vincenzo Federici. By 1831, when he was only23 years old, his first three operas had been produced in Palermo, Pavia,and Milan. He returned to London in August 1835, participatingwith the great Lablache, Tamburini, Rubini and Grisi in a concert inVauxhall Gardens. In 1834 he made his debut at La Scala, Milan, singingopposite the renowned mezzo-soprano, Maria Malibran in Rossini’sOtello. He appeared again with Malibran in Venice early in 1835,singing once more in Rossini and Bellini operas. Balfe worked as a singerand composer throughout the Italian peninsula/states during the years,1825-1835 and this article will chart these experiences and demonstratehow the time he spent in Italy and the people he met, influenced hislife and later career as an important and popular European composer.

  3. 75 FR 62635 - Proposed Information Collection (Patient Satisfaction Survey Michael E. DeBakey Home Care Program...

    Science.gov (United States)

    2010-10-12

    ... Collection (Patient Satisfaction Survey Michael E. DeBakey Home Care Program) Activity: Comment Request... determine patients' satisfaction with services provided by or through the Michael E. DeBakey Home Care...: Patient Satisfaction Survey Michael E. DeBakey Home Care Program, VA Form 10-0476. OMB Control Number...

  4. Probabilistic model fitting for spatio-temporal variability studies of precipitation: the Sara-Brut system - a case study

    International Nuclear Information System (INIS)

    Dorado Delgado, Jennifer; Burbano Criollo, Juan Carlos; Molina Tabares, Jose Manuel; Carvajal Escobar, Yesid; Aristizabal, Hector Fabio

    2006-01-01

    In this study, space and time variability of monthly and annual rainfall was analyzed for the downstream influence zone of a Colombian supply-regulation reservoir, Sara-Brut, located on the Cauca valley department. Monthly precipitation data from 18 gauge stations and for a 29-year record (1975-2003) were used. These data were processed by means of time series completion, consistency analyses and sample statistics computations. Theoretical probabilistic distribution models such as Gumbel, normal, lognormal and wake by, and other empirical distributions such as Weibull and Landwehr were applied in order to fit the historical precipitation data set. The fit standard error (FSE) was used to test the goodness of fit of the theoretical distribution models and to choose the best of this probabilistic function. The wake by approach showed the best goodness of fit in 89% of the total gauges taken into account. Time variability was analyzed by means of wake by estimated values of monthly and annual precipitation associated with return periods of 1,052, 1,25, 2, 10, 20 and 50 years. Precipitation space variability is presents by means of ArcGis v8.3 and using krigging as interpolation method. In general terms the results obtained from this study show significant distribution variability in precipitation over the whole area, and particularity, the formation of dry and humid nucleus over the northeastern strip and microclimates at the southwestern and central zone of the study area were observed, depending on the season of year. The mentioned distribution pattern is likely caused by the influence of pacific wind streams, which come from the Andean western mountain range. It is expected that the results from this work be helpful for future planning and hydrologic project design

  5. Theory and practice in action: the contributions of Michael Perkins to clinical linguistics.

    Science.gov (United States)

    Damico, Jack S; Lynch, Karen E

    2013-01-01

    This article reviews the scholarly contributions of Michael R. Perkins in the discipline of clinical linguistics and provides some indication of the reasons that he has been so successful. Three primary attributes were described through an analysis of his publications.

  6. Tõsine fotoelamus Dubrovnikus / Wade Goddard, Heidi Levine, Michael Robinson Chaver ; interv. Ahto Külvet

    Index Scriptorium Estoniae

    Goddard, Wade

    2007-01-01

    Dubrovniku vanalinnas asub Sõjafotokeskus. Intervjuu keskuse asutaja, kanadalasest fotograafi Wade Goddardi ja kahe seal augustis avatud näitusel osalenud fotograafi Heidi Levine'i ja Michael Robinson Chavez'iga. Sõjafotograafi tööst

  7. Joseph and Michael Haydn in the Bohemian music archives. An anniversary tribute

    Czech Academy of Sciences Publication Activity Database

    Freemanová, Michaela

    2012-01-01

    Roč. 20, č. 1 (2012), s. 117-126. ISBN 978-3-486-58949-8. ISSN 1865-5696 Institutional support: RVO:68378076 Keywords : Joseph Haydn * Michael Haydn * music archives Subject RIV: AL - Art, Architecture, Cultural Heritage

  8. Chiral Aminophosphines as Catalysts for Enantioselective Double-Michael Indoline Syntheses

    Directory of Open Access Journals (Sweden)

    Ohyun Kwon

    2012-05-01

    Full Text Available The bisphosphine-catalyzed double-Michael addition of dinucleophiles to electron-deficient acetylenes is an efficient process for the synthesis of many nitrogen-containing heterocycles. Because the resulting heterocycles contain at least one stereogenic center, this double-Michael reaction would be even more useful if an asymmetric variant of the reaction were to be developed. Aminophosphines can also facilitate the double-Michael reaction and chiral amines are more readily available in Nature and synthetically; therefore, in this study we prepared several new chiral aminophosphines. When employed in the asymmetric double-Michael reaction between ortho-tosylamidophenyl malonate and 3-butyn-2-one, the chiral aminophosphines produced indolines in excellent yields with moderate asymmetric induction.

  9. Arenethiolatecopper(I) complexes as homogeneous catalysts for Michael addition reactions

    NARCIS (Netherlands)

    Koten, G. van; Klaveren, M. van; Lambert, F.; Eijkelkamp, D.J.F.M.; Grove, D.M.

    1994-01-01

    Arenethiolatocopper(I) complexes are shown to be efficient homogeneous catalysts in Michael addition reactions of several Grignard reagents to acyclic enones; the addition products are formed with excellent chemoselectivity (>99%) and good enantioselectivity (76% e.e.).

  10. Hexafluorobenzene: A powerful solvent for a noncovalent stereoselective organocatalytic Michael addition reaction

    KAUST Repository

    Lattanzi, Alessandra; De Fusco, Claudia; Russo, Alessio; Poater, Albert; Cavallo, Luigi

    2012-01-01

    A dramatic enhancement of the diastereo- and enantioselectivity in the nitro-Michael addition reaction organocatalysed by a commercially available α,α-l-diaryl prolinol was disclosed when performing the reaction in unconventional hexafluorobenzene

  11. Eesti disain on kõva, ent see tuleb moondada ekspordiks / Michael Thomson ; interv. Urmas Oja

    Index Scriptorium Estoniae

    Thomson, Michael

    2008-01-01

    Euroopa Disainiassotsiatsioonide Liidu presidendi ja Tallinnas toimunud festivali Disainiöö Eesti disainiauhinna Bruno žürii juhi Michael Thomsoni arvamus eesti disainist ning disainipoliitika vajalikkusest Eestis. Auhinnasaajate nimekiri

  12. Reports of the working groups / Eino Tamm, Sahlin Michael, Valve Kirsipuu...[jt.

    Index Scriptorium Estoniae

    1999-01-01

    Töögruppide "EU enlargement and relevant institutional reforms" (juhatajad Eino Tamm, Michael Sahlin) ja "Maintaining of competitiveness of Estonia and other candidate countries" (juhatajad Valve Kirsipuu, Terry Calbom) tööst. Autor: Reformierakond

  13. Michael Bloomberg ähvardab USA valimised "ära rikkuda" / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2008-01-01

    New Yorgi praegune linnapea Michael Bloomberg võib kolmanda kandidaadina sekkuda presidendikandidaatide valimiskampaaniasse, probleem on aga tema vähene tuntus. Lisa: Seni on riigipeakoha jaganud kaks suurparteid

  14. Prints Charles ja prints Michael külastasid Tallinna kirikuid / Allan Tammiku

    Index Scriptorium Estoniae

    Tammiku, Allan

    2001-01-01

    Prints Charles külastas 6. novembril Eesti-visiidi ajal Tallinna toomkirikut ja Pühavaimu kirikut, prints Michael viibis Tallinnas 11. novembril eravisiidil, ta külastas toomkirikut, Niguliste ja Pühavaimu kirikut

  15. Chinese Middle Classes: Taiwan, Hong Kong, Macao and China. Edited by Hsin-Huang Michael Hsiao

    DEFF Research Database (Denmark)

    Brødsgaard, Kjeld Erik

    2018-01-01

    Book review of: Chinese Middle Classes:Taiwan, Hong Kong, Macao and China. Edited by Hsin-Huang Michael Hsiao. Abingdon: Routledge, 2014. Pp. 268. ISBN 10: 1138120847; ISBN 13: 978-1138120846......Book review of: Chinese Middle Classes:Taiwan, Hong Kong, Macao and China. Edited by Hsin-Huang Michael Hsiao. Abingdon: Routledge, 2014. Pp. 268. ISBN 10: 1138120847; ISBN 13: 978-1138120846...

  16. The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

    International Nuclear Information System (INIS)

    Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan

    2013-01-01

    Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques

  17. SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-04-01

    The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

  18. A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta

    OpenAIRE

    Carvalho, Marieta

    2014-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...

  19. Michael Goodsite gæsteprofessor på Thunderbird School of Global Management

    DEFF Research Database (Denmark)

    Pedersen, Jens Christian

    2010-01-01

    Professor Michael Goodsite er blevet udnævnt til "Visiting Professor of Global Processes and Senior Research Fellow in Climate Strategy" ved Thunderbird School of Global Management, som har verdens højst rangerede MBA uddannelse inden for international handel.......Professor Michael Goodsite er blevet udnævnt til "Visiting Professor of Global Processes and Senior Research Fellow in Climate Strategy" ved Thunderbird School of Global Management, som har verdens højst rangerede MBA uddannelse inden for international handel....

  20. A Greener, Efficient Approach to Michael Addition of Barbituric Acid to Nitroalkene in Aqueous Diethylamine Medium

    Directory of Open Access Journals (Sweden)

    Hany J. Al-Najjar

    2014-01-01

    Full Text Available An efficient method for the synthesis of a variety of pyrimidine derivatives 3a–t by reaction of barbituric acids 1a,b as Michael donor with nitroalkenes 2a–k as Michael acceptor using an aqueous medium and diethylamine is described. This 1,4-addition strategy offers several advantages, such as using an economic and environmentally benign reaction media, high yields, versatility, and shorter reaction times. The synthesized compounds were identified by 1H-NMR, 13C-NMR, CHN, IR, and MS. The structure of compound 3a was further confirmed by single crystal X-ray structure determination.

  1. Aza-Michael Mono-addition Using Acidic Alumina under Solventless Conditions

    Directory of Open Access Journals (Sweden)

    Giovanna Bosica

    2016-06-01

    Full Text Available Aza-Michael reactions between primary aliphatic and aromatic amines and various Michael acceptors have been performed under environmentally-friendly solventless conditions using acidic alumina as a heterogeneous catalyst to selectively obtain the corresponding mono-adducts in high yields. Ethyl acrylate was the main acceptor used, although others such as acrylonitrile, methyl acrylate and acrylamide were also utilized successfully. Bi-functional amines also gave the mono-adducts in good to excellent yields. Such compounds can serve as intermediates for the synthesis of anti-cancer and antibiotic drugs.

  2. The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

    Directory of Open Access Journals (Sweden)

    John M Morrison

    2012-03-01

    Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.

  3. Identification of new proton-rich rare earth nuclei by means of the coupled system helium jet-isotope separator of SARA

    International Nuclear Information System (INIS)

    Ollivier, T.

    1986-01-01

    In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr

  4. Análise SWOT global da exploração dos suínos da raça Bísara

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...

  5. Asymmetric organocatalytic Michael addition of Meldrum's acid to nitroalkenes: probing the mechanism of bifunctional thiourea organocatalysts

    OpenAIRE

    Kataja, Antti O.; Koskinen, Ari M.P.

    2010-01-01

    The asymmetric Michael addition of Meldrum’s acid to nitroalkenes was studied using a novel type of Cinchona alkaloid-based bifunctional thiourea organocatalyst. The functionality of the thiourea catalysts was also probed by preparing and testing thiourea-N-methylated analogues of the well-known bis-(3,5-trifluoromethyl)phenyl-substituted catalyst. Peer reviewed

  6. Passings to note: Paul Michael Packman, MD; S. Charles Schulz, MD.

    Science.gov (United States)

    Black, Donald W

    2018-02-01

    One of the keys to the success of Annals of Clinical Psychiatry has always been the tireless efforts of our dedicated Editorial Board. We recently lost 2 longtime Editorial Board members, Drs. Paul Michael Packman and S. Charles Schulz. Both will be greatly missed.

  7. Michael Perelman: An ecological future in view of Marxist Economics (Ⅱ)

    Institute of Scientific and Technical Information of China (English)

    Ren Xiaomei

    2009-01-01

    @@ Interviewee profile: Michael Perelman, currently professor of Economics Department of California State University, USA, American economist and economic historian with nearly 20 publications in the field of economics criticism, including Railroading Economics, Manufacturing Discontent, The Perverse Economy, and The Invention of Capitalism.

  8. Wolff-Michael Roth's passibility: at the limits of the constructivist metaphor: a book review

    Science.gov (United States)

    Brendel, Michelle

    2014-12-01

    Wolff-Michael Roth deconstructs the preeminent role conceded to constructivism in Science Education and demonstrates how we learn and know through pain, suffering, love or passion. This review explores his book "Passibility: At the Limits of the Constructivist Metaphor" through the eyes of an outsider to the world of science education.

  9. Assessment of lipid profile of a group of undergraduates in Michael ...

    African Journals Online (AJOL)

    Objective: The aim of this study was to measure the lipid fractions in serum blood samples of apparently healthy undergraduates of Michael Okpara University of Agriculture, Umudike. Methods: A total of one hundred consenting males and females aged between 19-30 years were purposively selected from the ...

  10. Highly Functionalized Cyclopentane Derivatives by Tandem Michael Addition/Radical Cyclization/Oxygenation Reactions

    Czech Academy of Sciences Publication Activity Database

    Holan, Martin; Pohl, Radek; Císařová, I.; Klepetářová, Blanka; Jones, P. G.; Jahn, Ullrich

    2015-01-01

    Roč. 21, č. 27 (2015), s. 9877-9888 ISSN 0947-6539 R&D Projects: GA ČR GA13-40188S Institutional support: RVO:61388963 Keywords : cyclization * domino reactions * electron transfer * Michael addition * radical reactions Subject RIV: CC - Organic Chemistry Impact factor: 5.771, year: 2015

  11. Hexafluorobenzene: A powerful solvent for a noncovalent stereoselective organocatalytic Michael addition reaction

    KAUST Repository

    Lattanzi, Alessandra

    2012-01-01

    A dramatic enhancement of the diastereo- and enantioselectivity in the nitro-Michael addition reaction organocatalysed by a commercially available α,α-l-diaryl prolinol was disclosed when performing the reaction in unconventional hexafluorobenzene as a medium. DFT calculations were performed to clarify the origin of stereoselectivity and the role of C 6F 6. © The Royal Society of Chemistry 2012.

  12. Briti ekspert : euroliidus kaob Eestist tööpuudus / Michael Richardson ; interv. Airi Ilisson

    Index Scriptorium Estoniae

    Richardson, Michael

    2003-01-01

    Eestis Suurbritannia tööreformi tutvustava töö- ja sotsiaalnõuniku sõnul on Suurbritannias peaaegu kadunud pikaajaline töötus noorte hulgas, vanematest inimestest on vaid üksikud tööta kauem kui aasta. Vt. samas: Kes on Michael Richardson?

  13. Moral Education and Education in Altruism: Two Replies to Michael Hand

    Science.gov (United States)

    White, John

    2016-01-01

    This article is a critical discussion of two recent papers by Michael Hand on moral education. The first is his "Towards a Theory of Moral Education", published in the "Journal of Philosophy of Education" in 2014 (Volume 48, Issue 4). The second is a chapter called "Beyond Moral Education?" in an edited book of new…

  14. Recollections of Jack Michael and the Application of Skinner's Analysis of Verbal Behavior

    Science.gov (United States)

    Sundberg, Mark L.

    2017-01-01

    Jack Michael offered a course on verbal behavior almost every year throughout his teaching career. Jack was also interested in the application of Skinner's work and in 1976 began to offer a graduate course at Western Michigan University titled Verbal Behavior Applications. Jack and his students pursued the application of Skinner's work on verbal…

  15. From Gouldner to Gramsci: The Making of Michael Apple's "Ideology and Curriculum"

    Science.gov (United States)

    Gottesman, Isaac

    2012-01-01

    Michael Apple's "Ideology and Curriculum", published in 1979, helped initiate a broad turn in the field of education in the United States to Marxist thought as a lens through which to analyze the relationship between school and society. This classic text continues to inform scholarship in the field. While "Ideology" has…

  16. Outside in America: George Michael's music video, public sex and global pop culture

    NARCIS (Netherlands)

    Kooijman, J.

    2004-01-01

    Six months after his controversial arrest for ‘lewd conduct’ at a men’s public restroom in Beverly Hills, British pop star George Michael released the song and music video ‘Outside’ which can be seen as an explicit commentary on the controversy. In this article, I read the music video in three ways:

  17. Tandem Michael addition/radical cyclizations for the construction of highly functionalized cyclopentanes

    Czech Academy of Sciences Publication Activity Database

    Holan, Martin; Pohl, Radek; Císarová, I.; Jahn, Ullrich

    2012-01-01

    Roč. 106, - (2012), s1298-s1298 ISSN 0009-2770. [EuCheMS Chemistry Congress /4./. 26.08.2012-30.08.2012, Prague] Institutional research plan: CEZ:AV0Z40550506 Keywords : cyclization * diastereoselectivity * Michael addiction * radical reactions * domino reactions Subject RIV: CC - Organic Chemistry

  18. "Raising Standards" or Reducing Aspirations and Opportunities Still Further? Michael Gove and Examination Reforms

    Science.gov (United States)

    Allen, Martin

    2013-01-01

    Well before the examinations grade crisis of 2012, Michael Gove had set out clear intentions for reforming public examinations. Though he claimed to be improving examinations and assessment by replicating practices that took place in high-performing countries and thus improving the ability of the UK economy to "compete", this…

  19. The Educational Philosophies of Mordecai Kaplan and Michael Rosenak: Surprising Similarities and Illuminating Differences

    Science.gov (United States)

    Schein, Jeffrey; Caplan, Eric

    2014-01-01

    The thoughts of Mordecai Kaplan and Michael Rosenak present surprising commonalities as well as illuminating differences. Similarities include the perception that Judaism and Jewish education are in crisis, the belief that Jewish peoplehood must include commitment to meaningful content, the need for teachers to teach from a position of…

  20. Astronaut C. Michael Foale is briefed on use of Sky Genie

    Science.gov (United States)

    1994-01-01

    Astronaut C. Michael Foale, STS-63 mission specialist, is briefed on the use of Sky Genie device by Karin L. Porter. The device would aid in emergency egress operations aboard a troubled Space Shuttle. Porter, an employee of Rockwell International, helps train astronauts in egress procedures at JSC's Shuttle mockup and integration laboratory.

  1. Gender Relations and Sexual Harassment in the Workplace: Michael Crichton's "Disclosure" as a Teaching Tool.

    Science.gov (United States)

    Comer, Debra R.; Cooper, Elizabeth A.

    1998-01-01

    Describes how to use Michael Crichton's novel "Disclosure" and the film based on it for class discussions of such issues as what constitutes sexual harassment, harassment of men, relationship between sexual harassment and power, organizational responses to harassment, and gender differences in career advancement tactics. (SK)

  2. The power of virtual integration: an interview with Dell Computer's Michael Dell. Interview by Joan Magretta.

    Science.gov (United States)

    Dell, M

    1998-01-01

    Michael Dell started his computer company in 1984 with a simple business insight. He could bypass the dealer channel through which personal computers were then being sold and sell directly to customers, building products to order. Dell's direct model eliminated the dealer's markup and the risks associated with carrying large inventories of finished goods. In this interview, Michael Dell provides a detailed description of how his company is pushing that business model one step further, toward what he calls virtual integration. Dell is using technology and information to blur the traditional boundaries in the value chain between suppliers, manufacturers, and customers. The individual pieces of Dell's strategy--customer focus, supplier partnerships, mass customization, just-in-time manufacturing--may be all be familiar. But Michael Dell's business insight into how to combine them is highly innovative. Direct relationships with customers create valuable information, which in turn allows the company to coordinate its entire value chain back through manufacturing to product design. Dell describes how his company has come to achieve this tight coordination without the "drag effect" of ownership. Dell reaps the advantages of being vertically integrated without incurring the costs, all the while achieving the focus, agility, and speed of a virtual organization. As envisioned by Michael Dell, virtual integration may well become a new organizational model for the information age.

  3. Kunstlik viljastamine - kas rahva püsimajäämise võti? / Michael Cook

    Index Scriptorium Estoniae

    Cook, Michael

    2007-01-01

    Kunstlikust viljastamisest pole üksi abi - vaid siis, kui noored mehed ja naised pööravad selja tarbimiskultusele ja individualismile, hakkab sündimus tõusma taastootmisest kõrgemale, kirjutab BioEdge toimetaja Michael Cook

  4. Training and Mastery of Techniques in Wittgenstein's Later Philosophy: A Response to Michael Luntley

    Science.gov (United States)

    Stickney, Jeff

    2008-01-01

    Responding to Michael Luntley's article, "Learning, Empowerment and Judgement," the author shows he cannot successfully make the following three moves: (1) dissolve the analytic distinction between learning by training and learning by reasoning, while advocating the latter; (2) diminish the role of training in Wittgenstein's philosophy, nor…

  5. Vision and Elusiveness in Philosophy of Education: R. S. Peters on the Legacy of Michael Oakeshott

    Science.gov (United States)

    Williams, Kevin

    2009-01-01

    Despite his elusiveness on important issues, there is much in Michael Oakeshott's educational vision that Richard Peters quite rightly wishes to endorse. The main aim of this essay is, however, to consider Peters' justifiable critique of three features of Oakeshott's work. These are (1) the rigidity of his distinction between vocational and…

  6. Hydrogeochemical and stream sediment reconnaissance basic data for St. Michael Quadrangle, Alaska

    International Nuclear Information System (INIS)

    1981-01-01

    Field and laboratory data are presented for 159 water samples from the St. Michael Quadrangle, Alaska. The samples were collected by Los Alamos National Laboratory; laboratory analysis and data reporting were performed by the Uranium Resource Evaluation Project at Oak Ridge, Tennessee

  7. SYNTHESIS OF SOME PROLINE DERIVATIVES BY MEANS OF MICHAEL ADDITIONS OF GLYCINE ESTERS

    NARCIS (Netherlands)

    VANDERWERF, A; KELLOGG, RM

    1991-01-01

    Addition of the Schiff bases derived from reaction of glycine alkyl esters with benzophenoneimine to alpha,beta-unsaturated ketones, followed by hydrogenation of the addition products, leads to 5- or 3,5-substituted prolines. Hydrolysis of the Michael adducts rather than hydrogenation allows

  8. Gulliver's Travels: Michael Moore the Explorer in "Who to Invade Next"

    Science.gov (United States)

    Beck, Bernard

    2016-01-01

    America is identified as a nation of immigrants. These immigrants are thought to be the source of its subcultures. It is also a nation of individual explorers and inventors. Their activities are also a source of diverse subcultures. Many notable movies have made heroes of such innovators in different fields of endeavor. Michael Moore's movie…

  9. A Critical Analysis of Michael Tippett's "A Child of Our Time"

    Science.gov (United States)

    Vallee, Jean-Sebastien

    2009-01-01

    After more than ten years of thoughtful planning, Michael Tippett (1905-1998) summed up his musical, political, spiritual and philosophical beliefs in his first oratorio, "A Child of Our Time" (1941). Representing the emergence of a new level of confidence and musical maturity for Tippett, the oratorio has become the composer's most widely known…

  10. Q & A with Ed Tech Leaders: Interview with Michael W. Allen

    Science.gov (United States)

    Shaughnessy, Michael F.

    2014-01-01

    Michael W. Allen, the Chairman and CEO of Allen Interactions, is an architect of interactive multimedia learning and is recognized for his many insights, inventions, and presentations. With over 50 years of experience in e-learning, both in academic and corporate settings, he is known for his role in creating Authorware and overseeing the work of…

  11. European Management: an emerging competitive advantage of European nations : A reply to Michael Porter

    NARCIS (Netherlands)

    F.A.J. van den Bosch (Frans); A.A. van Prooijen

    1992-01-01

    textabstractThis article extends the debate begun in the June 1992 issue of EMJ when the authors first criticized Michael Porter's explanatory framework in his Competitive Advantage of Nations (1990), over the role of national culture on the competitive advantage of nations. In this paper, Frans van

  12. New Models at Lasell: Q&A with President Michael Alexander

    Science.gov (United States)

    Harney, John O.

    2018-01-01

    The "New England Journal of Higher Education" ("NEJHE") Executive Editor John O. Harney had the chance to catch up with Lasell College President Michael Alexander about the small Newton, Massachusetts, college's plans to challenge the higher education business model. The interview is presented in this article.

  13. Subjectivity and Cultural Adjustment in Mathematics Education: A Response to Wolff-Michael Roth

    Science.gov (United States)

    Brown, Tony

    2012-01-01

    In this volume, Wolff-Michael Roth provides a critical but partial reading of Tony Brown's book "Mathematics Education and Subjectivity". The reading contrasts Brown's approach with Roth's own conception of subjectivity as derived from the work of Vygotsky, in which Roth aims to "reunite" psychology and sociology. Brown's book, however, focuses on…

  14. Little Mosie from the Margaree: A Biography of Moses Michael Coady.

    Science.gov (United States)

    Welton, Michael R.

    This book examines the life of the Reverend Moses Michael Coady (1890-1959), a Roman Catholic priest who led the Antigonish Movement. During the Antigonish Movement, residents of the small maritime town of Antigonish, Nova Scotia, worked to achieve a nonviolent alternative to communism and fascism and to effect the social and economic…

  15. An efficient oxa-Michael addition to diethyl vinylphosphonate under mild reaction conditions

    Czech Academy of Sciences Publication Activity Database

    Baszczyňski, Ondřej; Jansa, Petr; Dračínský, Martin; Kaiser, Martin Maxmilian; Špaček, Petr; Janeba, Zlatko

    2012-01-01

    Roč. 2, č. 4 (2012), s. 1282-1284 ISSN 2046-2069 R&D Projects: GA MV VG20102015046 Institutional research plan: CEZ:AV0Z40550506 Keywords : oxa-Michael addition * secondary alcohols * diethyl vinylphosphonate Subject RIV: CC - Organic Chemistry Impact factor: 2.562, year: 2012

  16. What Work Do the Concepts of "Language" and "Literature" Do for Michael Rosenak?

    Science.gov (United States)

    Levisohn, Jon A.

    2014-01-01

    Michael Rosenak uses the twin metaphors of "language" and "literature," borrowed from Oakeshott and Peters, to argue that the goal of education is initiation into a language. This goal transcends the study of literature in that language. It includes, as well, the development of the capacity both to critique literature and to…

  17. Michael Faraday on the Learning of Science and Attitudes of Mind.

    Science.gov (United States)

    Crawford, Elspeth

    1998-01-01

    Makes use of Michael Faraday's ideas on learning, focusing on his attitudes toward the unknowns of science and the development of an attitude that improves scientific decision making. This approach acknowledges that there is an inner struggle involved in facing unknowns. (DDR)

  18. An Interview with Michael Horn: Blending Education for High-Octane Motivation

    Science.gov (United States)

    Patterson, Gregory A.

    2012-01-01

    Blended learning holds the potential of improving the way we educate students and of making them more motivated. Blended education--the melding of information technology based distance learning with school attendance--is perhaps the best way to educate students for 21st century skills, says Michael Horn in a "Kappan" interview. Horn points out…

  19. DNA-based catalytic enantioselective intermolecular oxa-Michael addition reactions

    NARCIS (Netherlands)

    Megens, Rik P.; Roelfes, Gerard

    2012-01-01

    Using the DNA-based catalysis concept, a novel Cu(II) catalyzed enantioselective oxa-Michael addition of alcohols to enones is reported. Enantioselectivities of up to 86% were obtained. The presence of water is important for the reactivity, possibly by reverting unwanted side reactions such as

  20. C. P. Snow's "The Two Cultures": Michael Polanyi's Response and Context

    Science.gov (United States)

    Jacobs, Struan

    2011-01-01

    C. P. Snow's "The Two Cultures" controversially contrasted science and literature, suggesting that neither scientists nor literary intellectuals have much in common with, and seldom bother speaking to, the other. Responding to Snow, Michael Polanyi argued that specialization has made modern culture, not twofold but manifold. In his major work,…

  1. Noted astrophysicist Michael S. Turner to Head NSF'S mathematical and physical sciences directorate

    CERN Multimedia

    2003-01-01

    "The National Science Foundation has named celebrated astrophysicist Michael S. Turner of the University of Chicago as Assistant Director for Mathematical and Physical Sciences. He will head a $1 billion directorate that supports research in mathematics, physics, chemistry, materials and astronomy, as well as multidisciplinary programs and education" (1/2 page).

  2. 77 FR 69550 - Proposed Information Collection (Patient Satisfaction Survey Michael E. DeBakey Home Care Program...

    Science.gov (United States)

    2012-11-19

    ... (Patient Satisfaction Survey Michael E. DeBakey Home Care Program) Activity: Comment Request AGENCY.... DeBakey Home Care Program. DATES: Written comments and recommendations on the proposed collection of...: Patient Satisfaction Survey Michael E. DeBakey Home Care Program, VA Form 10-0476. OMB Control Number...

  3. 76 FR 624 - Proposed Information Collection (Patient Satisfaction Survey Michael E. DeBakey Home Care Program...

    Science.gov (United States)

    2011-01-05

    ... Collection (Patient Satisfaction Survey Michael E. DeBakey Home Care Program) Activity: Comment Request... satisfaction with the quality of services/care provided by home care program staff. An agency may not conduct... Form 10-0476).'' SUPPLEMENTARY INFORMATION: Title: Patient Satisfaction Survey Michael E. DeBakey Home...

  4. 78 FR 6851 - Proposed Information Collection (Patient Satisfaction Survey Michael E. DeBakey Home Care Program...

    Science.gov (United States)

    2013-01-31

    ... (Patient Satisfaction Survey Michael E. DeBakey Home Care Program) Activity: Comment Request AGENCY... Satisfaction Survey Michael E. DeBakey Home Care Program, VA Form 10-0476. OMB Control Number: 2900-0775. Type... home care program staff. An agency may not conduct or sponsor, and a person is not required to respond...

  5. 77 FR 30047 - Notice of Opportunity for Public Comment on Surplus Property Release at Michael J Smith Field...

    Science.gov (United States)

    2012-05-21

    ... Comment on Surplus Property Release at Michael J Smith Field, Beaufort, NC AGENCY: Federal Aviation... J Smith Field, be used for aeronautical purposes. DATES: Comments must be received on or before June... property at the Michael J Smith Field. The property consists of one parcel located on the north side of...

  6. Brändi näkyy musiikkivideossa : Esimerkkitapaus Michael Jackson

    OpenAIRE

    Kontinen, Noora

    2016-01-01

    Tutkin opinnäytetyössäni brändin ja musiikkivideon suhdetta toisiinsa. Työssä käsitellään lyhyesti myös tähteyttä. Esittelen ensin vähän historiaa ja peruskäsitteitä, minkä jälkeen käytän Michael Jacksonin Billie Jean -musiikkivideota esimerkkinä tutkiessani Michael Jacksonin brändiä. Teoksessa käytetään lähdeaineistoa sekä omaa analyysia. Keskityn tarkastelemaan musiikkivideoita, ja niihin liittyviä sisältöjä yleisesti, ei niinkään teknisesti. Toivon, että työstäni on apua jollekin,...

  7. Interviews with Michael Baxandall, February 3rd and 4th, 1994, Berkeley, CA

    Directory of Open Access Journals (Sweden)

    Allan Langdale

    2009-12-01

    Full Text Available The following interviews with Michael Baxandall were conducted in Berkeley on February 3rd and 4th of 1994. The content of these interviews include general responses about developments in art history in the years between 1960 and 1985, a period of dramatic modifications in the discipline. Among the issues are the rise of the social history of art and the sources from anthropology that informed Baxandall’s concept of the ‘Period Eye’. Baxandall talks about his own work, his personal intellectual history, and the scholars of past and current generations who influenced him. Other topics include Baxandall’s professional trajectory, the Warburg Library, and aspects of cultural history having to do with Renaissance Humanism. These interviews first appeared as an appendix to the PhD dissertation by Allan Langdale, Art History and Intellectual History: Michael Baxandall’s Work between 1963 and 1985, U. C. Santa Barbara, 1995.

  8. [An exceptional human relationship (Michael P. Kierkegaard, Søren Kierkegaard)].

    Science.gov (United States)

    Jacobs, R

    1978-01-01

    There were a father and a son, Michael and Sören Kierkegaard, both highly talented, imaginitive, witty, humorous, especially interested in shrewd dialectrical dialogues respectively debates, both profound melancholy ponderers. But according to very own individuality their congeniality wasn't absolute. The father, being under a questionable rigorous opinion of sin, suffered from undeserved divine grace since early childhood. And Michael Kierkegaard made Sören anxious with the religious experience of original sin. This anxiety moved (touched or affected) the sensitive son mighty. Nevertheless he should not despair hopelessly like his unlucky father. On the contrary: Sørens incomparable melancholy, mental agony and anxiety (fear or anguish) forced the faith, existing independently of them, in a radical refining. That is why Sören Kierkegaard succeeded in sublimation of all psychological and philosophic (al) attitudes (or opinions) in the sphere of religiousness. And the result? A novel philosophy of life: Christian existentialism.

  9. Michael K. Scullin: Psi Chi/APA Edwin B. Newman Graduate Research Award.

    Science.gov (United States)

    2011-11-01

    Presents Michael K. Scullin as the 2011 winner of the American Psychological Association Psi Chi/APA Edwin B. Newman Graduate Research Award. "For an outstanding research paper that examines the relationship between prospective memory in executing a goal and various lapses of time from 20 minutes up to a 12- hour wake delay and a 12-hour sleep delay. The results suggest that consolidation processes active during sleep increase the probability of goal execution. The paper, titled 'Remembering to Execute a Goal: Sleep On It!' was published in Psychological Science in 2010 and was the basis for Michael K. Scullin's selection as the recipient of the 2011 Psi Chi/APA Edwin B. Newman Graduate Research Award. Mark A. McDaniel, PhD, served as faculty research advisor." (PsycINFO Database Record (c) 2011 APA, all rights reserved). 2011 APA, all rights reserved

  10. Navigating Transition: Freedom, Limitation and the Post-colonial Persona in Michael Ondaatje's The Cat's Table

    Directory of Open Access Journals (Sweden)

    Alaa Alghamdi

    2012-11-01

    Full Text Available Michael Ondaatje's 2011 novel The Cat's Table follows a young boy's voyage from Colombo, Sri Lanka to London, England. Through this character and the unique environment of the ship, which forms a compelling sense of transitory place, Ondaatje explores liminality and its relationship with limitations or barriers. The young protagonist, Michael, and his companions enjoy an unusual level of freedom aboard the contained and hierarchically segmented ship. Polarization and transition between Eastern and Western culture is present but pales in importance compared to the validation of the self that is located within and defined by the sense of the in-between, an essential rite of passage undertaken before re-joining society.

  11. Learned Helplessness Encountered by Michael Oher in the Blind Side Movie

    OpenAIRE

    PAMUNGKAS, DIMAS PROBO

    2014-01-01

    Pamungkas, Dimas Probo. 2014. Learned Helplessness Encountered by Michael Oher in The Blind Side Movie. Study Program of English, Department of Languages and Literature, Faculty of Culture Studies, Universitas Brawijaya. Supervisor: Dyah Eko Hapsari;Co-supervisor: Sarlettina Vidyayani EkaKeywords: Learned Helplessness, African-American, Psychological, Social Behavior, Depression, The Blind Side.Social behavior shows several interactions between person and social situations, which stress...

  12. Dropping The Bomb? On Critical and Cinematic Reactions to Michael Ondaatje's The English Patient

    OpenAIRE

    Pesch, Josef

    2018-01-01

    This paper analyses Anthony Minghella's film adaptation of Michael Ondaatje’s The English Patient. It aims at establishing patterns of transformation and strategies of adaptation. Not only the nostalgie romanticisation, but also the de-politicisation of the novel is critically scrutinized. As dropping all reference to the atomic bomb from the film is the most blatant example of deviation from the novel, critical and political background is provided which may explain this act of self-censorshi...

  13. Organocatalytic asymmetric michael addition of aldehydes to beta-nitroacroleine dimethyl acetal.

    Science.gov (United States)

    Reyes, Efraim; Vicario, Jose L; Badía, Dolores; Carrillo, Luisa

    2006-12-21

    [Structure: see text] The organocatalytic asymmetric Michael addition of aldehydes to beta-nitroacroleine dimethyl acetal has been studied in detail. The reaction took place with excellent yields and high stereoselectivities when a chiral beta-amino alcohol such as L-prolinol was employed as the catalyst, leaving a formation of highly functionalized enantioenriched compounds containing two differentiated formyl groups together with a nitro moiety.

  14. Horror movie aspects and experimentation in Michael Jackson’s Thriller music video

    OpenAIRE

    Vargas, Herom; Universidade Municipal de São Caetano do Sul - USCS; Gonçalves, Rafael; Universidade Municipal de São Caetano do Sul - USCS

    2016-01-01

    This article analyzes the use of elements from the horror fi lm genre in the music video Thriller (1982), by Michael Jackson, as experimentation within the field of pop music. Based on the semiotics of culture, grounded on the concepts of cultural text, semiosphere, border and modeling, developed by Iuri Lotman, the analysis identified innovations in the use of horror as humor and, in the music, modeling of creatures, moving among horror, the fantastic and the reality.Keywords: horror, music ...

  15. Review: Cornelia Behnke & Michael Meuser (1999). Geschlechterforschung und qualitative Methoden [Gender Research and Qualitative Methods

    OpenAIRE

    Nicola Döring

    2001-01-01

    In less than 100 pages Cornelia BEHNKE and Michael MEUSER explain how gender studies evolved from women's studies and what feminist methodology is all about. They also discuss the interrelation of qualitative research and gender studies. The great potential of qualitative research based on a constructivist gender concept is demonstrated with a group discussion study involving different men only groups. Finally the authors deal with the question of how the researcher's gender affects both data...

  16. Feeding Health: Michael Pollan on Improving Public Health through the Food Systems

    Centers for Disease Control (CDC) Podcasts

    2009-08-19

    In this podcast, author Michael Pollan discusses his March 2009 visit to CDC and offers his thoughts on the intersection between the government, the food systems, and public health.  Created: 8/19/2009 by National Center for Environmental Health (NCEH), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP), Office of Sustainability.   Date Released: 4/15/2010.

  17. En memoria de Michael Jiménez (1948-2001

    Directory of Open Access Journals (Sweden)

    Mauricio Archila Neira

    2001-01-01

    Full Text Available El 1 de septiembre de 2001 murió el historiador Michael Jiménez. Su apellido provenía de España de donde emigró su abuelo en busca de mejor suerte al otro lado del Atlántico. Nacido en el pequeño pueblo de Merced, California (Estados Unidos en agosto de 1948 en el seno de una familia obrera, Michael vivió su infancia en Colombia. A fines de ese año, su padre se desplazó a estas tierras para ser funcionario de la Texas, una multinacional petrolera que tenía sus reales en Puerto Boyacá. Michael estudió en el colegio Nueva Granada -becado por la Texas- hasta los catorce años. En dicho colegio fue compañero de pupitre de Herbert Braun, descendiente a su vez de una familia de emigrantes a Colombia, y con quien la vida lo juntaría de nuevo en las tierras del norte y en oficios similares.

  18. Between Irish National Cinema and Hollywood: Neil Jordan’s Michael Collins

    Directory of Open Access Journals (Sweden)

    Raita Merivirta-Chakrabarti

    2007-03-01

    Full Text Available When Neil Jordan’s film Michael Collins was released in 1996, it was seen by some as a Hollywood epic, by others as a great national film. I would argue that Michael Collins combines these two traditions and occupies a space between Irish national cinema and Hollywood. The subject matter, the creative talent and the locations were Irish and the film was produced by using the Irish filmmaking infrastructure and the Irish government’s support mechanisms, but it was largely financed and distributed by a Hollywood studio. Also, to make it more appealing especially globally, but probably also locally (since Hollywood is now the international standard, it makes use of Hollywood conventions, making it accessible to international audiences as well. Despite the Hollywood mode, the fact remains that Michael Collins is a national film text, and Jordan does not make too many concessions to the non-Irish audiences.

  19. A celebration of mechanics: from nano to macro. The J. Michael T. Thompson Festschrift issue.

    Science.gov (United States)

    Elishakoff, Isaac

    2013-06-28

    This Theme Issue is dedicated to the topic 'Mechanics: from nano to macro' and marks the 75th birthday of Dr J. Michael T. Thompson, Fellow of the Royal Society, whose current affiliations are as follows: (i) Honorary Fellow, Department of Applied Mathematics and Theoretical Physics, Centre for Mathematical Sciences, University of Cambridge; (ii) Emeritus Professor of Nonlinear Dynamics, Department of Civil, Environmental and Geomatic Engineering, University College London; and (iii) Professor of Theoretical and Applied Dynamics (Distinguished Sixth Century Chair, part-time), University of Aberdeen. He also serves as Chairman of the Board of Directors at ES-Consult (consulting engineers) in Copenhagen, Denmark. The pertinent question that arises from the very start is: should we first salute Michael and then describe the Theme Issue, or vice versa? Indeed, according to Blaise Pascal (1623-1662), the last thing one discovers in composing a work is what to put first. I would like to take the liberty of deviating from the tradition of the Philosophical Transactions and start with the tribute to Michael; after all he is the prime cause of this Theme Issue.

  20. The conceptualization of love in religious thought of George Florovsky and Michael Pomazansky

    Directory of Open Access Journals (Sweden)

    Pavenkov Oleg Vladimirovich

    2015-04-01

    Full Text Available The present article is concerned with the question of conceptualization of love in works of Fr. George Florovsky and Fr. Michael Pomazansky, Russian religious thinkers and theologists. We are studying the meaning and appropriacy of two words, ‘love’ (English and ‘любовь’ (Russian, that are the best to represent the agapelogical positive evaluation in Russian religious thought. Data for study was taken from ten different articles and extracts from books written by Fr. George Florovsky and Fr. Michael Pomazansky. On the basis of this analysis we develop semantic explications of words ‘love’ and ‘любовь’ as Christian spiritual concepts within the framework of theoretical approach of Natural Semantic Metalanguage (NSM. In summary we state that this article discusses, describes and determines some similarities and differences in understanding of concept ‘love’ in the affore-referenced works by Fr. George Florovsky and Fr. Michael Pomazansky.

  1. Organocatalytic Asymmetric Michael Addition of 4-Hydroxycoumarin to β,γ-Unsaturated α-Keto Esters

    Energy Technology Data Exchange (ETDEWEB)

    Suh, Chang Won; Han, Tae Hyun; Kim, Dae Young [Soonchunhyang Univ., Asan (Korea, Republic of)

    2013-06-15

    In conclusion, we have developed organocatalytic enantioselective conjugate addition reaction of 4-hydroxycoumarin (1) to β,γ-unsaturated α-keto esters 2 to afford biologically valuable warfarin derivatives 3. The process is efficiently catalyzed by a binaphthyl-modified thiourea organocatalyst. The coumarin core is present as a characteristic structural motif in a large number of natural products and biologically active molecules.1 Particularly, many of these naturally occurring 4-hydroxycoumarin and their synthetic analogues are important precursors for the synthesis of natural products and pharmaceuticals. Enantioselective organocatalytic conjugate addition of 4-hydroxycoumarin to α,β-unsaturated ketones is a straightforward method to access warfarin which is an effective anticoagulants. Although a number of reactions of α,β-unsaturated ketones as Michael acceptors have been reported, the corresponding β,γ-unsaturated α-keto esters have received relatively little attention as Michael acceptors. Recently, several groups have reported the asymmetric Michael addition of 4-hydroxycoumarin to β,γ-unsaturated α-keto esters catalyzed by Cu(II)-bisoxazoline, N,N'-dioxide-Ni(II) complexes, thiourea catalysts. Although several efficient methods have been achieved by these systems, an effective method for the synthesis of warfarin analogues is still a challenge.

  2. Organocatalytic Asymmetric Michael Addition of 4-Hydroxycoumarin to β,γ-Unsaturated α-Keto Esters

    International Nuclear Information System (INIS)

    Suh, Chang Won; Han, Tae Hyun; Kim, Dae Young

    2013-01-01

    In conclusion, we have developed organocatalytic enantioselective conjugate addition reaction of 4-hydroxycoumarin (1) to β,γ-unsaturated α-keto esters 2 to afford biologically valuable warfarin derivatives 3. The process is efficiently catalyzed by a binaphthyl-modified thiourea organocatalyst. The coumarin core is present as a characteristic structural motif in a large number of natural products and biologically active molecules.1 Particularly, many of these naturally occurring 4-hydroxycoumarin and their synthetic analogues are important precursors for the synthesis of natural products and pharmaceuticals. Enantioselective organocatalytic conjugate addition of 4-hydroxycoumarin to α,β-unsaturated ketones is a straightforward method to access warfarin which is an effective anticoagulants. Although a number of reactions of α,β-unsaturated ketones as Michael acceptors have been reported, the corresponding β,γ-unsaturated α-keto esters have received relatively little attention as Michael acceptors. Recently, several groups have reported the asymmetric Michael addition of 4-hydroxycoumarin to β,γ-unsaturated α-keto esters catalyzed by Cu(II)-bisoxazoline, N,N'-dioxide-Ni(II) complexes, thiourea catalysts. Although several efficient methods have been achieved by these systems, an effective method for the synthesis of warfarin analogues is still a challenge

  3. Unsymmetric ordering using a constrained Markowitz scheme

    Energy Technology Data Exchange (ETDEWEB)

    Amestoy, Patrick R.; Xiaoye S.; Pralet, Stephane

    2005-01-18

    We present a family of ordering algorithms that can be used as a preprocessing step prior to performing sparse LU factorization. The ordering algorithms simultaneously achieve the objectives of selecting numerically good pivots and preserving the sparsity. We describe the algorithmic properties and challenges in their implementation. By mixing the two objectives we show that we can reduce the amount of fill-in in the factors and reduce the number of numerical problems during factorization. On a set of large unsymmetric real problems, we obtained the median reductions of 12% in the factorization time, of 13% in the size of the LU factors, of 20% in the number of operations performed during the factorization phase, and of 11% in the memory needed by the multifrontal solver MA41-UNS. A byproduct of this ordering strategy is an incomplete LU-factored matrix that can be used as a preconditioner in an iterative solver.

  4. A perspectiva de Michael Apple para os estudos das políticas educacionais

    Directory of Open Access Journals (Sweden)

    Luís Armando Gandin

    Full Text Available Resumo Este artigo tem como objetivo analisar as contribuições de Michael Apple para o campo da pesquisa em políticas educacionais. Na extensa obra de Michael Apple, destacamos seis elementos que podem auxiliar aqueles que estão interessados na área de políticas em educação: o princípio epistemológico da análise relacional; o exame do Estado como relação; a herança de Antonio Gramsci e de Raymond Williams que Michael Apple incorpora no uso de conceitos como hegemonia e senso comum; a análise que Michael Apple faz das políticas educacionais como políticas culturais, como disputas por visão de mundo, como luta por consolidação de uma hegemonia que vai além do econômico; a sua postura de pesquisador; e a capacidade que Michael Apple tem de ir além da lógica da reprodução e determinação para enfatizar o papel da agência e da contra-hegemonia. Através de exemplos práticos da própria obra de Apple e de outras pesquisas empíricas, apresentam-se as implicações de cada um dos seis pontos acima citados para os pesquisadores interessados na área de políticas educacionais. Conclui-se que muitas das contribuições de Apple podem auxiliar em pesquisas nessa área, tendo em vista a discussão que o autor realiza em sua obra e sua crítica ao determinismo econômico nas análises do campo educacional, salientando a importância, assim, de aspectos que estão relacionados à esfera da cultura.

  5. Tagasipöördumine esteetika juurde = Return to aesthetics / Keith Moxey, Michael Ann Holly ; interv. Anu Allas

    Index Scriptorium Estoniae

    Moxey, Keith

    2007-01-01

    Ameerika kunstiajaloolased Keith Moxey ning Michael Ann Holly tutvustavad uut lähenemist kunstiajaloole (new art history). Nn. naasmine esteetika juurde tähendab püüet integreerida kunstiajalukku ja -teooriasse uuesti ja tugevamalt kunstiteos

  6. Review: Barr, Michael and Zlatko Skrbiš (2008, Constructing Singapore. Elitism, Ethnicity and the Nation-Building Project

    Directory of Open Access Journals (Sweden)

    Boris Michel

    2009-01-01

    Full Text Available Review of the monograph: Barr, Michael and Zlatko Skrbiš, Constructing Singapore. Elitism, Ethnicity and the Nation-Building Project, Copenhagen: NIAS Press, 2008, ISBN 978-87-7694-029-4, 304 pages

  7. Correction: Synthesis of pyrrolidine-3-carboxylic acid derivatives via asymmetric Michael addition reactions of carboxylate-substituted enones.

    Science.gov (United States)

    Yin, Feng; Garifullina, Ainash; Tanaka, Fujie

    2018-04-25

    Correction for 'Synthesis of pyrrolidine-3-carboxylic acid derivatives via asymmetric Michael addition reactions of carboxylate-substituted enones' by Feng Yin et al., Org. Biomol. Chem., 2017, 15, 6089-6092.

  8. Tandem Knoevenagel–Michael reactions in aqueous diethylamine medium: A greener and efficient approach toward bis-dimedone derivatives

    Directory of Open Access Journals (Sweden)

    Abdullah Mohammed Al-Majid

    2017-02-01

    The use of inexpensive, eco-friendly and readily available reagents, easy work-up, and high purity products makes the procedure a convenient and robust method for the synthesis of tandem Knoevenagel–Michael adducts.

  9. Michael T. Westrate. Living Soviet in Ukraine from Stalin to Maidan: Under the Falling Red Star in Kharkiv.

    Directory of Open Access Journals (Sweden)

    Charitie V. Hyman

    2017-09-01

    Full Text Available Book review of Michael T. Westrate. Living Soviet in Ukraine from Stalin to Maidan: Under the Falling Red Star in Kharkiv. Rowman & Littlefield, 2016. xx, 232 pp. Illustrations. Appendices. Bibliography. Index. $85.00, cloth.

  10. The big picture : What the Baltics may learn from Ireland's success story / Michael Bourke ; interv. Maris Biezaitis

    Index Scriptorium Estoniae

    Bourke, Michael

    2002-01-01

    Ilmunud ka: Baltiiskii kurss 2002/Zima/Vesna nr. 20 lk. 14-17. Iirimaa aukonsul Lätis, Michael Joseph Bourke arutleb Iirimaa majandusedu teemal ning pakub välja, mida Baltimaad saaksid sellest õppida. Tabel, diagramm. Lisa

  11. Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973

    Directory of Open Access Journals (Sweden)

    Guillermina Feudal

    2017-12-01

    Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.

  12. Review: Michael Crandall & Karen E. Fisher (Eds) Digital Inclusion: Measuring the Impact of Information and Community Technology

    DEFF Research Database (Denmark)

    Pors, Niels Ole

    2010-01-01

    Review: Michael Crandall & Karen E. Fisher (Eds) Digital Inclusion: Measuring the Impact of Information and Community Technology. Medford. Information Today. ASIS&T Monographs, 2009. 185 pages. $ 59.50. ISBN 978-1-57387-373-4......Review: Michael Crandall & Karen E. Fisher (Eds) Digital Inclusion: Measuring the Impact of Information and Community Technology. Medford. Information Today. ASIS&T Monographs, 2009. 185 pages. $ 59.50. ISBN 978-1-57387-373-4...

  13. Compassionate leadership? Some reflections on the work and life of Michael Lapsley

    Directory of Open Access Journals (Sweden)

    Ian A. Nell

    2016-03-01

    Full Text Available In June 2007, I had the privilege of attending a Healing of Memories workshop lead by Father Michael Lapsley, one of the founder members of the Institute for Healing of Memories. The purpose of the workshop was to help the predominantly white members of a middle class Dutch Reformed congregation in the Northern Suburbs of Cape Town and the predominantly coloured members of a congregation of the Evangelical Lutheran Church in Elsies River on the Cape Flats, to share their stories of the past with regard to apartheid with each other. Apart from the stories that were told and the sharing of experiences about the apartheid history that took place, I was struck by the way in which Father Lapsley conducted the workshop. There was a deep compassion for all the participants as was embodied through the way in which he treated each of us with respect. But apart from his cordiality in leading the workshop, one could sense a deeper source of compassion, a source revealing a compassionate understanding of God�s presence amidst the violence and turmoil in our broken world. The aim of this article is to reflect on whether one could speak of something like �compassionate leadership�, and to take a closer look at the relationship between compassion and God images in the life and work of Michael Lapsley. Special attention will be given to the way in which he exercises leadership through his many involvements related to his own personal story of trauma.Intradisciplinary and/or interdisciplinary implications: This article presents literary research on the notion of compassionate leadership as a specific kind of leadership. The results indicate that the leadership of Father Michael Lapsley does indeed portray features of this kind of leadership. The research can become the source for finding new strategies for religious leadership.

  14. An Interview with Michael Betancourt, author of Agnotology & Crisis in Digital Capitalism

    OpenAIRE

    Sean Scanlan; Michael Betancourt

    2015-01-01

    Sean Scanlan, NANO's editor, interviews artist, curator, art historian and critical theorist Michael Betancourt to discuss the nature of agnotology, a term that means the “creation of uncertainty and ambivalent ‘fact’; it is a competitive tool incompatible with the idealized ‘free market’ of capitalism.” Betancourt is skeptical of Big Data and the ways that the consumers who unknowingly “produce” data for business interpretation are increasingly becoming transformed into a “token of exchange ...

  15. Athlete endorsement as a marketing strategy: a case study of Nike and Michael Jordan

    OpenAIRE

    Masár Vieites, Laura Virginia

    2014-01-01

    Les empreses intenten obrir mercats nous constantment, aconseguint atraure nous clients objectiu i augmentar el reconeixement de la marca. Aquest treball investiga el cóm i per què el patrocini d'atletes, per a que aquests representin els productes d'una empresa, ja que és una eina cada vegada més àmplia i popular en el màrqueting mix de les empreses. Michael Jordan, un estel retirada de bàsquet, ha rebut molta atenció dels mitjans publicitaris i ha representat sota patrocini a diversos produ...

  16. [The problem of evil in families--the filmmaker Michael Haneke].

    Science.gov (United States)

    Skårderud, Finn

    2010-09-23

    With the beautiful and dark film "The white ribbon", from 2009, the Austrian film director Michael Haneke consolidated his status as an international success. A central theme in his films is evilness and its roots. But just as important is his ambition to develop films where evil is not only portrayed, but where spectators are challenged to relate to their own ethical standards and their role as spectators. Haneke is a highly original filmmaker with his consistent search for a film aesthetic that stimulates ethical self-reflection and mentalizing. He partly succeeds in this quest.

  17. Organocatalytic Michael and Friedel–Crafts reactions in enantioselective synthesis of biologically active compounds

    International Nuclear Information System (INIS)

    Maltsev, O V; Beletskaya, Irina P; Zlotin, Sergei G

    2011-01-01

    Recent applications of organocatalytic Michael and Friedel–Crafts reactions in enantioselective synthesis of biologically active compounds: natural products, pharmaceutical agents and plant protection agents are reviewed. The key mechanisms of stereoinduction, types of organocatalysts and reagents used in these reactions are considered. The material is classified according to the type of newly formed bonds incorporating the asymmetric carbon atom, and the information for the most numerous C–C coupling reactions is systematized according to the natures of the electrophile and the nucleophile. The bibliography includes 433 references.

  18. The Great War and All That in A Hundred Doors by Michael Longley

    Directory of Open Access Journals (Sweden)

    Elisabeth Delattre

    2015-03-01

    Full Text Available The Great War has featured regularly in Michael Longley’s poetry, for personal, family, aesthetic and political reasons. His collection published in 2011 under the title A Hundred Doors contains a number of poems relating to his father and the so-called War Poets, in connection with others in which love and nature, life and death are also dominant themes. This article will show how, as elsewhere in his poetry, everything is interrelated, “the nature poetry”, in Longley’s words, “fertilizing the war poetry”.

  19. European Management: an emerging competitive advantage of European nations: A reply to Michael Porter

    OpenAIRE

    Bosch, Frans; Prooijen, A.A.

    1992-01-01

    textabstractThis article extends the debate begun in the June 1992 issue of EMJ when the authors first criticized Michael Porter's explanatory framework in his Competitive Advantage of Nations (1990), over the role of national culture on the competitive advantage of nations. In this paper, Frans van den Bosch and Arno van Prooijen stress that Europe is a locus of competitive advantage if one is prepared to pay attention to the possibility of ‘European Management’ as a potential asset of Europ...

  20. POLYETHYLENEIMINE (PEI ON SILICA AS CATALYST IN KNOEVENAGEL AND MICHAEL REACTIONS

    Directory of Open Access Journals (Sweden)

    FATIHA ZAOUI

    2017-03-01

    Full Text Available After the synthesis of polyethylenimine supported on silica, it has been used as a new and efficient catalyst in Knoevenagel and Michael condensations. The presence of the polyethylenimine in the catalytic system together with silica displays an acido-basic character allows a better catalytic activity in the condensations. Carried out under microwave irradiation, without organic solvent and during short time, the syntheses are respectful towards green chemistry. The solid catalyst can be easily reused. This catalyst has the acido-basic character at the same time.

  1. LECTURE CANCELLED - “The power of collaboration - innovating collaborative relationships" by Michael Kimmel | 8 March

    CERN Multimedia

    2013-01-01

    PLEASE NOTE THAT THIS LECTURE IS CANCELLED Friday, 8 March -  from 11.30 a.m. to 1 p.m. Globe of Science and Innovation Route de Meyrin, 1211 Geneva International Women’s Day Conference Lecture will be in English - Interpreting available in French Limited number of seats - registration is essential Reservation: + 41 22 767 76 76 or cern.reception@cern.ch Dr. Michael Kimmel, a renowned sociologist and an expert on male-female relationships, will share his latest findings on gender collaboration and how it can lead to innovation and improved relationships both at work and in the world outside. Michael Kimmel is among the world’s leading experts on male-female relationships. A Professor of Sociology at the State University of New York at Stony Brook, he is the author or editor of more than 20 books on the topic. He consults corporations, NGOs and public sector organisations all over the world on gender equity issues, including work-family balance, reducing workplac...

  2. Michael Polanyi and his generation origins of the social construction of science

    CERN Document Server

    Nye, Mary Jo

    2011-01-01

    In Michael Polanyi and His Generation, Mary Jo Nye investigates the role that Michael Polanyi and several of his contemporaries played in the emergence of the social turn in the philosophy of science. This turn involved seeing science as a socially based enterprise that does not rely on empiricism and reason alone but on social communities, behavioral norms, and personal commitments. Nye argues that the roots of the social turn are to be found in the scientific culture and political events of Europe in the 1930s, when scientific intellectuals struggled to defend the universal status of scientific knowledge and to justify public support for science in an era of economic catastrophe, Stalinism and Fascism, and increased demands for applications of science to industry and social welfare. At the center of this struggle was Polanyi, who Nye contends was one of the first advocates of this new conception of science. Nye reconstructs Polanyi’s scientific and political milieus in Budapest, Berlin, and Manchester f...

  3. Production of Low-Freezing-Point Highly Branched Alkanes through Michael Addition.

    Science.gov (United States)

    Jing, Yaxuan; Xia, Qineng; Liu, Xiaohui; Wang, Yanqin

    2017-12-22

    A new approach for the production of low-freezing-point, high-quality fuels from lignocellulose-derived molecules was developed with Michael addition as the key step. Among the investigated catalysts, CoCl 2 ⋅6 H 2 O was found most active for the Michael addition of 2,4-pentanedione with FA (single aldol adduct of furfural and acetone, 4-(2-furanyl)-3-butene-2-one). Over CoCl 2 ⋅6 H 2 O, a high carbon yield of C 13 oxygenates (about 75 %) can be achieved under mild conditions (353 K, 20 h). After hydrodeoxygenation, low-freezing-point (hydrodeoxygenation, high density (0.8415 g mL -1 ) and low-freezing-point (<223 K) branched alkanes with 18, 23 carbons within lubricant range were also obtained over a Pd/NbOPO 4 catalyst. These highly branched alkanes can be directly used as transportation fuels or additives. This work opens a new strategy for the synthesis of highly branched alkanes with low freezing point from renewable biomass. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. Adapting Shakespeare – Converting Shylock in Michael Radford’s the Merchant of Venice

    Directory of Open Access Journals (Sweden)

    Oakes Luke

    2016-08-01

    Full Text Available This article aims to explore the extension and evolution of Shakespeare’s The Merchant of Venice through Michael Radford’s 2004 cinematic adaptation. By investigating the concept of adaptation and the significance of intertextuality, Shakespeare’s source text is considered alongside Radford’s twenty-first century recreation to reimagine and redefine the construction of Shylock as both a comic and tragic device utilized across film and play. Issues of racial and religious prejudices alongside anti- Semitic views were particularly prominent in Elizabethan England and, by concentrating on recontextualisation, this article looks to expose Shakespeare’s characterization as a reflective commentary concerning societal discriminations at the time of the play’s performance. By focusing primarily on Shakespeare’s Jewish Usurer, Radford is able to reconstruct and reestablish the dramatic devices and characters within the cinematic version, metaphorically converting Shylock from comic villain to tragic victim. Finally, it argues that this dynamic shift inevitably metamorphoses Shylock from a spectator’s perspective and provides Michael Radford with an opportunity to offer a social commentary on social inequality in the twenty-first century.

  5. Cuestión de tiempo: Michael Fried y el tiempo del arte moderno A matter of time: Michael Fried and modernist art the time of modernist art

    Directory of Open Access Journals (Sweden)

    David Díaz Soto

    2011-07-01

    Full Text Available En el siglo XIX, autores fundacionales del formalismo, como Fiedler o Hildebrand, contrapusieron estrictamente las artes plásticas, «puramente visuales», a las artes verbales del discurso, proscribiéndoles la narración y disociándolas de la temporalidad: se trata del «principio de exclusión del tiempo», vinculado al formalismo. Más tarde, el crítico «modernista» de arte Clement Greenberg planteó la instantaneidad, en tanto que opuesta a la duración, como modalidad ideal de la experiencia artística. Pero el historiador y crítico de arte Michael Fried, en sus textos de los años 60 sobre arte abstracto, se distancia de Greenberg, desarrollando un discurso sobre la temporalidad en las artes plásticas, con nociones como «tiempo visual»; y en sus posteriores textos historiográficos investiga las modalidades temporales de la representación pictórica. La aparente paradoja entre la crítica de Fried a la hipóstasis «literalista» de la duración en las tardovanguardias y el papel crucial que concede a Manet y a la instantaneidad en el origen del arte moderno, la resolveremos atendiendo a su reivindicación de la temporalidad durativa de «lo cotidiano». Así cabe comprender la concepción de la modalidad temporal característica de la modernidad y del arte moderno, a la que apunta su noción teórica de presentness.In the nineteenth century, seminal authors of Formalism, like Fiedler or Hildebrand, strictly compared the «purely visual» plastic arts to the discursive arts of verbal language, ruling out narrativity from plastic arts, which they dissociated from temporality - the formalist «principle of exclusion of time». Later on, «modernist» art critic Clement Greenberg claimed that instantaneousness, as opposed to duration, was the ideal modality for artistic experience. Art critic and historian Michael Fried did not share Greenberg's position, but developed instead a discourse about time in plastic arts. In his early

  6. N-Heterocyclic Carbene-Catalysed Diastereoselective Vinylogous Michael Addition Reaction of gamma-Substituted deconjugated Butenolides

    KAUST Repository

    Guo, Hao; Xing, Fen; Du, Guang-Fen; Huang, Kuo-Wei; Dai, Bin; He, Lin

    2015-01-01

    An efficient N-heterocyclic carbene (NHC)-catalysed vinylogous Michael addition of deconjugated butenolides was developed. In the presence of 5 mol% of the NHC catalyst, both γ-alkyl and aryl-substituted deconjugated butenolides undergo vinylogous Michael addition with various α, β-unsaturated ketones, esters, or nitriles to afford γ,γ-disubstituted butenolides containing adjacent quaternary and tertiary carbon centers in good to excellent yields with excellent diastereoselectivities. In this process, the free carbene is assumed to act as a strong Brønsted base to promote the conjugate addition.

  7. N-Heterocyclic Carbene-Catalysed Diastereoselective Vinylogous Michael Addition Reaction of gamma-Substituted deconjugated Butenolides

    KAUST Repository

    Guo, Hao

    2015-11-16

    An efficient N-heterocyclic carbene (NHC)-catalysed vinylogous Michael addition of deconjugated butenolides was developed. In the presence of 5 mol% of the NHC catalyst, both γ-alkyl and aryl-substituted deconjugated butenolides undergo vinylogous Michael addition with various α, β-unsaturated ketones, esters, or nitriles to afford γ,γ-disubstituted butenolides containing adjacent quaternary and tertiary carbon centers in good to excellent yields with excellent diastereoselectivities. In this process, the free carbene is assumed to act as a strong Brønsted base to promote the conjugate addition.

  8. Enantio- and Stereoselective Construction of Atisane Scaffold via Organocatalytic Intramolecular Michael Reaction and Diels-Alder Reaction.

    Science.gov (United States)

    Sekita, Hiroko; Adachi, Kyohei; Kobayashi, Ippei; Sato, Yusuke; Nakada, Masahisa

    2017-05-05

    An enantio- and stereoselective construction of the atisane scaffold via organocatalytic intramolecular Michael reaction and Diels-Alder reaction is described. The organocatalytic intramolecular Michael reaction has been found to stereoselectively generate a trans-stereodiad comprising an all-carbon quaternary and a tertiary stereogenic centers. Use of the chiral secondary amine bearing thiourea with benzoic acid as additive is the key to obtaining the desired product with excellent ee in synthetically acceptable yield. The prepared chiral building block has been successfully converted to the compound including the atisane scaffold via the highly stereoselective intramolecular Diels-Alder reaction.

  9. Las relaciones entre la Iglesia y el Estado en la teoría de la justicia de Michael Walzer

    OpenAIRE

    Roldán, Alberto Fernando

    2009-01-01

    Roldan, A. F. (2009). Las relaciones entre la Iglesia y el Estado en la teoría de la justicia de Michael Walzer (Tesis de Maestría). Universidad Nacional de Quilmes, Bernal, Argentina. En la presente tesis, se discuten las relaciones entre la Iglesia –término que se utiliza no en el sentido confesional sino en tanto institución religiosa- y el Estado moderno. Se escoge como marco teórico la filosofía política del pensador judío americano Michael Walzer, exponente del “comunitarismo”, un...

  10. Isoindolinones as Michael Donors under Phase Transfer Catalysis: Enantioselective Synthesis of Phthalimidines Containing a Tetrasubstituted Carbon Stereocenter

    Directory of Open Access Journals (Sweden)

    Francesco Scorzelli

    2015-05-01

    Full Text Available Readily available chiral ammonium salts derived from cinchona alkaloids have proven to be effective phase transfer catalysts in the asymmetric Michael reaction of 3-substituted isoindolinones. This protocol provides a convenient method for the construction of valuable asymmetric 3,3-disubstituted isoindolinones in high yields and  moderate to good enantioselectivity. Diastereoselectivity was also investigated in the construction of contiguous tertiary and quaternary stereocenters. The use of acrolein as Michael acceptor led to an interesting tricyclic derivative, a pyrroloisoindolinone analogue, via a tandem conjugated addition/cyclization reaction.

  11. Michael Fordham and the Journal of Analytical Psychology: the view from Hangman's Hill.

    Science.gov (United States)

    Urban, Elizabeth

    2015-09-01

    This short paper was presented to a conference in honour of the 60(th) year of the JAP and was one of others that acknowledged the contribution of Michael Fordham. The subtitle refers to the paper's overview of Fordham's published oeuvre and the particular place of the Journal of Analytical Psychology, for which he was the founding editor. Fordham's contribution to a Jungian-based model of development is discussed, with reference to his papers in the British Journal of Medical Psychology. The paper notes miscellaneous pieces from Fordham's commentaries, obituaries, papers and reviews which capture not only the development of Fordham as a thinker but also his character. There is discussion of his reviews of Melanie Klein's Envy and Gratitude and manuscripts by Erich Neumann. A reminiscence of Fordham as supervisor is recounted. © 2015, The Society of Analytical Psychology.

  12. Lizards, ticks and contributions to Australian parasitology: C. Michael Bull (1947-2016).

    Science.gov (United States)

    Godfrey, Stephanie S; Gardner, Michael G

    2017-12-01

    Professor C. Michael Bull was a great scientist and mentor, and an Associate Editor of this journal. While his research career spanned the fields of behavioural ecology, conservation biology and herpetology, in this article, we pay tribute to his major contribution to Australian parasitology. Mike authored more than eighty articles on host-parasite ecology, and revealed major insights into the biology and ecology of ticks from his long term study of the parapatric boundary of two tick species ( Amblyomma limbatum and Bothriocroton hydrosauri ) on the sleepy lizard ( Tiliqua rugosa ). In this article, we provide an overview of how this research journey developed to become one of the longest-running studies of lizards and their ticks, totalling 35 years of continuous surveys of ticks on lizards, and the insights and knowledge that he generated along that journey.

  13. A History of Experiences and Thinking Men. The History of Political Thought according to Michael Oakeshott

    Directory of Open Access Journals (Sweden)

    Spartaco Pupo

    2014-12-01

    Full Text Available Michael Oakeshott conceives the history of European political thought as a structuring of ideas and arguments of the practical experience aimed to understanding political expressions in vogue in the culture of a people. It is not a continuous and cumulative history of abstract and disembodied ideas, as it is wrongly conceived, but of some men who thought politics in a certain way on the basis of the language and of the set of actions, moral beliefs and contingencies of the people which they belong to. The article highlights the comparison between Oakeshott, Quentin Skinner and Gianfranco Miglio on the search for the most appropriate method to be applied in the study of the history of political thought.

  14. 'Introducing Michael Gove to Loïc Wacquant': Why Social Work Needs Critical Sociology.

    Science.gov (United States)

    Michael Garrett, Paul

    2016-06-01

    In 2013, Michael Gove, then Secretary of State for Education and Health in the UK coalition government, criticised social workers for laying insufficient emphasis on the 'agency' of individuals and for being too preoccupied with social and economic inequalities. Such a perspective, which is not unique to Gove, needs to be countered by reaffirming the significance of an expansively critical sociology for social work. In this context, the thematic concerns of the French theorist, Loïc Wacquant, illuminates key aspects of social work engagement with clients which Gove and his ideological associates appear intent on ignoring. The issues raised have significant political resonances given the pending UK General Election taking place in May 2015.

  15. Modalities of representation and perception in Michael Ondaatje’s Anil’s Ghost

    Directory of Open Access Journals (Sweden)

    Sigrid Renaux

    2017-01-01

    Full Text Available http://dx.doi.org/10.5007/2175-8026.2017v70n1p113 This study analyses the way in which the interdependence of the representation and perception of reality is exemplified and questioned in Michael Ondaatje’s Anil’s Ghost (2000. As we enter this work of resistance literature by way of an omniscient narrator, we enter not just the geographical spaces and cultural history of Sri Lanka, but find ourselves taking part in the daily struggle of the people to survive, to identify and do justice to the many dead in this conflict between ethnic groups and the government. This fragmentation of the narrative structure – casting doubt on the conflicting relationships established between the characters’ present and the past, between western and eastern values in relation to the concept of truth, the search for lost identity and love – highlights still further the interchangeability of representation and perception of reality.

  16. Michael Oakeshott´s Work as a Liberal-Conserv ative Paradigm

    Directory of Open Access Journals (Sweden)

    Josep Baqués

    2014-01-01

    Full Text Available As is the case with other thinkers linked to what can be broadly defined as conservatism, it is arguable whether Michael Oakeshott was just a conservative, or whether he was also a liberal. He often rejected this last label. He also tried to avoid the classic debate between the left/right wing divide, conferring instead a mantle of neutrality on his work. This analysis shows, on the one hand, that Oakeshott´s work is ideologically orientated and, on the other hand, that it contains a substantial liberal component. In fact, he offered a liberal-conservative synthesis in which the free market appears to be not only the best, but the only feasible outcome in the proposed scenario of political prudence. I will fi rst connect Oakeshott with the main traditions of thought, then analyse the theoretical implications of his position, and finally explore the consequences derived from all this for everyday political practice.

  17. The role of Michael Pupin in solving of Serbian national question

    Directory of Open Access Journals (Sweden)

    Grčić Mirko D.

    2004-01-01

    Full Text Available Michael I. Pupin was a professor at the University of Columbia, member and the president of Academy of Science in New York; one of the esteemed members of USA National Academy of Science; member and president of many experts and scientific institutions and societies in the USA; member of State Council for Scientific Research by president of the USA during the World War I. Of the great importance for political geography and geopolitics was his activity in Paris during the Peace Conference after the World War I in 1919 also as his great contribution to establishment of state borders of Kingdom of Serbs, Croats and Slovenians (later Yugoslavia, which helped those nations to establish their national borders at maximum level. Pupin claimed that he was Yugoslav patriot and American citizen. Role of M. Pupin in battle for national interests and Yugoslav borders after the World War I is shown in this article.

  18. Rationalism and traditionalism in politics. The correspondence between Karl R. Popper and Michael Oakeshott

    Directory of Open Access Journals (Sweden)

    Spartaco Pupo

    2016-07-01

    Full Text Available The correspondence of 1948 between Karl Popper and Michael Oakeshott, translated for the first time in Italian and published in the appendix to this paper, demonstrates the existence of two different ways of thinking about politics: the rationalist approach, founded on the “argumentation” as a rational means for the non-violent solution of problems (Popper, and the traditionalist mode, inspired by the method of “conversation” as a guarantee of constant openness to the diversity of identities (Oakeshott. To rise from the letters is a mutual influence on the interpretation of the key concepts that characterize the thought of the two authors, which however does not cancel the fundamental divergence of their political orientation.

  19. Inverting the diastereoselectivity of the mukaiyama-michael addition with graphite-based catalysts

    KAUST Repository

    Acocella, Maria Rosaria

    2014-02-07

    Here, we show that graphite-based catalysts, mainly graphite oxide (GO) and exfoliated GO, are effective recyclable catalysts for a relevant stereoselective Mukaiyama-Michael addition, outperforming currently available catalysts. Moreover, the graphite-based catalysts described here invert the diastereoselectivity relative to that observed with known catalysts, with the unprecedented large prevalence of the anti diastereoisomer. This inverted diastereoselectivity is increased when the catalyst concentration is reduced and after catalyst recycling. Density functional theory calculations suggest that the selectivity is determined by two types of supramolecular interactions operating between the catalyst and the substrates at the diastereoselectivity- determining transition state, specifically, the π-stacking of b-nitrostyrene with graphite and the van der Waals interaction between the SiMe3 group of the silyl ether and the graphite. © 2013 American Chemical Society.

  20. "Alarme de incêndio": Michael Löwy e a crítica ecossocialista da civilização capitalista moderna "Fire alarm": Michael Löwy and the ecosocialist critique of the modern capitalist civilization

    Directory of Open Access Journals (Sweden)

    Fabio Mascaro Querido

    2013-04-01

    Full Text Available A emergência da crise ecológica, como sintoma mais nítido de uma verdadeira crise civilizató-ria, impôs novos desafios ao pensamento crítico e, em especial, ao marxismo. Partindo desse pressuposto, o objetivo deste artigo é apresentar a defesa de Michael Löwy de uma radicalização ecossocialista da crítica marxista da modernidade, tarefa para a qual a grande recusa de Walter Benjamin das ideologias do pro- gresso é uma das fontes decisivas de inspiração. Para Michael Löwy, a ruptura com as ideologias do progresso e com o paradigma civilizatório capitalista moderno é uma condição indispensável para a atua-lização ecossocialista do marxismo.The emergence of the ecological crisis as a clearer symptom of a true civilizatory crisis has imposed new challenges to critical thought and, in particular, to Marxism. Based on this assumption, this article aims to present Michael Löwy's defense of an ecosocialist radicalization of the Marxist critique of modernity, a task for which Walter Benjamin's great refusal of the ideologies of progress is one of the critical sources of inspiration. To Michael Löwy, breaking away from the ideologies of progress and from the modern capitalistic civilizatory paradigm is a prerequisite for the ecosocialist updating of Marxism.

  1. Sharing AIS Related Anomalies (SARA)

    Science.gov (United States)

    2016-03-01

    78 6.3.7 SQL Versus NoSQL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 6.4 Data Processing...43 6.1 Overview of SQL and NoSQL differences, from [56]. . . . . . . . . . . . . . . . . . 82 A.1 Description of the ship anomaly upload use...constraints must be considered. These requirements, however, can only be defined when lower level implementation decisions, such as SQL versus NoSQL

  2. Severe accident recriticality analyses (SARA)

    DEFF Research Database (Denmark)

    Frid, W.; Højerup, C.F.; Lindholm, I.

    2001-01-01

    with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality-both super-prompt power bursts and quasi steady-state power......Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies......, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g(-1), was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s(-1). In most cases, however, the predicted energy deposition was smaller, below...

  3. Michael Novak's "Business as a Calling" as a Vehicle for Addressing Ethical and Policy Concerns in a Business Law Course

    Science.gov (United States)

    Murphy, Tonia Hap

    2008-01-01

    This article describes the author's experience of incorporating Michael Novak's "Business as a Calling: Work and the Examined Life" into a Business Law course. The author views it as a positive addition to the course, one that may be of interest to her colleagues at other institutions. Accordingly, after an overview of Novak's analysis in…

  4. N-Heterocyclic-Carbene-Catalysed Diastereoselective Vinylogous Mukaiyama/Michael Reaction of 2-(Trimethylsilyloxy)furan and Enones

    KAUST Repository

    Wang, Ying; Du, Guang Fen; Xing, Fen; Huang, Kuo-Wei; Dai, Bin; He, Lin

    2015-01-01

    N-heterocyclic carbenes have been utilised as highly efficient nucleophilic organocatalysts to mediate vinylogous Mukaiyama/Michael reactions of 2-(trimethylsilyloxy)furan with enones to afford γ-substituted butenolides in 44-99% yield with 3:1-32:1 diastereoselectivity. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Komparativistlikke ja kultuuriteaduslikke ärgitusi Baltimaade germanistikale / Michael Schwidtal ; saksa keelest tõlkinud Vahur Aabrams

    Index Scriptorium Estoniae

    Schwidtal, Michael

    2001-01-01

    3. - 5. sept. 2001 toimus Riias sümpoosion "Unter diesem braunen Himmel. Jakob Michael Reinhold Lenz und die deutsche Literatur des Baltikums", 7. - 9. sept. Tartus "Torm ja tung Liivimaal. Mässu mudelid", pühendatud J. M. R. Lenzi ja Kristian Jaak Petersoni loomingule. Ülevaade

  6. A Symposium on the Relevance of Michael Polanyi's Insights to a Reformulated Understanding of Science, Technology, and Society

    Science.gov (United States)

    Mead, Walter B.

    2011-01-01

    This is intended as an introductory statement to the explorations undertaken in the essays that follow. The authors of these essays attempt to introduce the reader to some of the insights of Michael Polanyi and their implications for the reader who wishes to come to a greater understanding of modern technological society, which--for better or…

  7. Jack Michael's Musings on the 60th Anniversary of Skinner's "Verbal Behavior"

    Science.gov (United States)

    Esch, Barbara E.; Esch, John W.; Palmer, David C.

    2017-01-01

    When the B. F. Skinner Foundation reprinted Skinner's "Verbal Behavior" in 1992, Jack Michael wrote one of its two forewords, a detailed outline of the book's purpose and scope. On the 60th anniversary of the first publication (1957) of "Verbal Behavior", Jack reflects on the book's impact and its importance to the…

  8. What I Think I May Have Learned--Reflections on 50 Years of Teaching: An Interview with Michael Wertheimer

    Science.gov (United States)

    Michael, Kurt D.

    2006-01-01

    Kurt Michael is an associate professor in the Department of Psychology at Appalachian State University (ASU) where he teaches history and systems of psychology, abnormal psychology, child psychopathology, and interventions for children and adolescents. He received his BA (cum laude) from the University of Colorado at Boulder and his MS and PhD in…

  9. Effective Integration of Technology and Instruction. Q&A with Michael Jay. REL Mid-Atlantic Educator Effectiveness Webinar Series

    Science.gov (United States)

    Regional Educational Laboratory Mid-Atlantic, 2015

    2015-01-01

    In this webinar, long-time educator and developer of education technology Michael Jay discussed the importance of using technology to support learning and gave examples of how teachers can integrate technology into their instruction based on the Common Core State Standards and the Next Generation Science Standards. The PowerPoint presentation and…

  10. N-Heterocyclic-Carbene-Catalysed Diastereoselective Vinylogous Mukaiyama/Michael Reaction of 2-(Trimethylsilyloxy)furan and Enones

    KAUST Repository

    Wang, Ying

    2015-10-15

    N-heterocyclic carbenes have been utilised as highly efficient nucleophilic organocatalysts to mediate vinylogous Mukaiyama/Michael reactions of 2-(trimethylsilyloxy)furan with enones to afford γ-substituted butenolides in 44-99% yield with 3:1-32:1 diastereoselectivity. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Progress in ultrasonic spray pyrolysis for condensed matter sciences developed from ultrasonic nebulization theories since Michael Faraday

    CSIR Research Space (South Africa)

    Mwakikunga, BW

    2014-01-01

    Full Text Available This review outlines, in great detail, the history of the phenomenon of ultrasonic nebulization of liquids since the discovery of such an effect by Michael Faraday and the explanation of the phenomenon by capillary wave mechanism and “cavitation...

  12. Jack Michael's Appointments at the University of Houston and Arizona State University: Reflections from a Former Student

    Science.gov (United States)

    Mabry, John H.

    2016-01-01

    Jack Michael was an early enthusiast for what is now called applied behavior analysis. His many seminal contributions were through early publications in applied behavior analysis and the work of the students he trained (e.g., T. Ayllon, M. M. Wolf). His close mentorship of students earned him acclaim as a teacher along with his many theoretical…

  13. Solvent-free, catalyst-free aza-Michael addition of cyclohexylamine to diethyl maleate: reaction mechanism and kinetics

    Czech Academy of Sciences Publication Activity Database

    Bláha, Michal; Trhlíková, Olga; Podešva, Jiří; Abbrent, Sabina; Steinhart, Miloš; Dybal, Jiří; Dušková-Smrčková, Miroslava

    2018-01-01

    Roč. 74, č. 1 (2018), s. 58-67 ISSN 0040-4020 Institutional support: RVO:61389013 Keywords : Aza-Michael addition * solvent-free * catalyst-free Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 2.651, year: 2016

  14. Thomas DaCosta Kaufmann and Michael North (eds., Mediating Netherlandish Art and Material Culture in Asia

    Directory of Open Access Journals (Sweden)

    Claartje Rasterhoff

    2015-12-01

    Full Text Available Book notice of: Thomas DaCosta Kaufmann and Michael North (eds., Mediating Netherlandish Art and Material Culture in Asia (Amsterdam Studies in the Dutch Golden Age Amsterdam, Amsterdam University Press, 2014. 348 pp. ISBN 978-90-8964-569-2. € 99,00.

  15. Der Wert von Worten. Michael Serrer aus dem Literaturbüro Düsseldorf im Interview mit der Textpraxis-Redaktion

    Directory of Open Access Journals (Sweden)

    Michael Serrer

    2014-11-01

    Full Text Available Die Textpraxis-Redaktion unterhält sich mit Michael Serrer über Literaturvermittlung in Zeiten der Digitalisierung, über Kanonisierung und die Rolle der Literatur in der Gesellschaft. Michael Serrer ist Leiter des Literaturbüros NRW und Feuilletonist.

  16. Book Review: America’s Blind Spot: Chávez, Oil and US Security by Andrés Cala and Michael Economides

    DEFF Research Database (Denmark)

    Boscan, Luis

    2014-01-01

    Review of: America’s Blind Spot: Chávez, Oil and US Security. Andrés Cala and Michael Economides. Continuum Books. 2012.......Review of: America’s Blind Spot: Chávez, Oil and US Security. Andrés Cala and Michael Economides. Continuum Books. 2012....

  17. A Relação entre o Risco e as Práticas de Governança Corporativa Diferenciada no Mercado Brasileiro de Ações: uma abordagem sob a égide da teoria dos portfólios de MarkowitzRisk Relation and the Corporative Governance Practice in the Brazilian Stock Market: an approach according to the portfolio theory by MarkowitzLa Relación entre el Riesgo y las Prácticas de Gobernanza Corporativa Diferenciada en el Mercado Brasileño de Acciones: un análisis bajo la égida de la teoría de los portafolios de Markowitz

    Directory of Open Access Journals (Sweden)

    SILVA, Rhoger Fellipe Marinho da

    2011-06-01

    Full Text Available RESUMOEste estudo objetivou analisar se há uma relação entre o risco de uma carteira, considerada suficientemente diversificada no mercado brasileiro de ações, composta pelas empresas classificadas no IGC, em comparação à Carteira de Mercado. Para tanto, utilizou-se preliminarmente do proceder metodológico de pesquisa bibliográfico-documental de caráter exploratório e, posteriormente, do levantamento das carteiras teóricas do índice de ações com governança corporativa diferenciada da BM&FBOVESPA válidas para o primeiro, segundo e terceiro quadrimestres de 2009. E, com o auxílio da planilha eletrônica Excel, utilizando-se do modelo de Markowitz (1952 e da metodologia desenvolvida por Gonçalves Junior, Pamplona e Montevechi (2002, buscou-se encontrar as carteiras de variância mínima para cada quadrimestre, a fim de testar a hipótese de que há uma relação entre o risco dessas carteiras, consideradas suficientemente diversificadas no mercado brasileiro de ações (de acordo com os achados de Sanvicente e Bellato, 2004, compostas por empresas classificadas no IGC. Assim, os resultados indicaram que tais carteiras compostas pelos ativos do IGC, são superiores à carteira de mercado, uma vez que teriam seus riscos representados por cerca de 34%, 32% e 21% do risco do IBOVESPA de seu período correspondente, em níveis de retorno idênticos, ou seja, por meio da teoria de diversificação é possível obter uma relação inversa entre o risco e as boas práticas de governança corporativa. Adicionalmente, a carteira selecionada IGC domina a carteira do IGC e do IBOVESPA, respectivamente, utilizando-se o coeficiente de variação, ou seja, possui o menor risco contido por cada retorno adicional.ABSTRACTThis study examines whether there is a relationship between the risk of a portfolio that would be sufficiently diversified in the Brazilian stock market, made by companies classified in the IGC, in comparison with the Market

  18. Entrevista com Mathieu Dosse, Gian Luigi de Rosa e Michael Kegler

    Directory of Open Access Journals (Sweden)

    Andréia Guerini

    2017-09-01

    Full Text Available O conjunto das três entrevistas que seguem aborda a mesma temática, isto é, aspectos de tradução/adaptação em geral e da tradução do romance Estive em Lisboa e lembrei de você de Luiz Ruffato em particular. O romance de Ruffato foi escrito em 2009, editado em Portugal (Quetzal, 2010 e traduzido para diferentes línguas, como italiano (La Nuova Frontiera, 2011, espanhol (Eterna Cadencia, 2011, francês (Chandeigne, 2015, alemão (Assoziation A, 2016 e, nos próximos meses será publicado em finlandês (Into. O livro foi adaptado para o cinema em 2015, pelo cineasta português José Barahona, sendo exibido em festivais nacionais e internacionais. As entrevistas abaixo foram feitas com os tradutores Gian Luigi De Rosa, Mathieu Dosse e Michael Kegler em 2016. Gian Luigi De Rosa (Itália/1969-- possui doutorado em “Culture e Istituzioni dei paesi di lingue iberiche in età moderna e contemporanea” e é professor de português na Universidade do Salento, em Lecce. É autor de livros e ensaios sobre língua e linguística portuguesa, literatura portuguesa e brasileira e tradução audiovisual e intersemiótica. É também responsável pela elaboração das legendas em italiano do filme Estive em Lisboa e lembrei de você. Mathieu Dosse (Brasil/1978-- é formado pela Université Paris 8, onde estudou Teoria da Tradução. Traduziu para o francês Graciliano Ramos, Luiz Ruffato e João Guimarães Rosa. Michael Kegler (Alemanha/1967-- estudou literatura brasileira e portuguesa na universidade de Frankfurt, sem concluir o curso. Trabalhou como livreiro no Centro do Livro de Língua Portuguesa, antes de se tornar tradutor literário. Traduziu para o alemão José Eduardo Agualusa, Moacyr Scliar, Luiz Ruffato, entre outros autores. Em julho de 2016, junto com Ruffato, recebeu o prêmio literário Hermann Hesse na Alemanha, pela qualidade da obra publicada em conjunto com a sua tradução.

  19. An Oral History Interview with MICHAEL M. CERNEA (interviewer: Judith Freidenberg

    Directory of Open Access Journals (Sweden)

    MICHAEL M. CERNEA

    2008-01-01

    Full Text Available The editors and editorial board of Human Organization are pleased to introduce readers to the following oral history interview with Michael M. Cernea, a development social scientist who has militated throughout his academic career and applied work for "putting people first", in the forefront of development projects and policies. Working for a long time for the promotion of anthropological and sociological knowledge, either in the activities of the World Bank or in the policies and programs of governments of both developed and developing countries, Dr. Cernea cleared pathways for applied social science that are sure to benefit people in development settings for many years to come. Undoubtedly many readers already know Dr. Cernea's work well, especially those of us who teach the anthropology of development or work in applied settings and organizations, but this interview embeds his broad body of work into a personal, human, and at times tragic context that opens with brushes with death, Nazi brutality, and exile. It also provides valuable insights for carrying out the work of development anthropologists within large-scale organizations and governments.This interview with Dr. Cernea was conducted by Dr. Judith Freidenberg, of the University of Maryland, on June 30, 2003, for the Society for Applied Anthropology Oral History Project, headquartered at the University of Kentucky Libraries. This Project aims to create, through the vehicle of oral histories, a record of the life, activities and experiences of number of selected scholars-anthropologists who devoted a great part of their scientific work to research, to applied work in different settings, to inducing development, including to hands-on work on crafting public social policies and actual development programs. The present transcript of the interview was reviewed by both participants for editorial purposes. Michael M. Cernea expanded some of his oral responses, for historical accuracy or to add

  20. Ecossocialismo, romantismo e (autocrítica da modernidade em Michael Löwy

    Directory of Open Access Journals (Sweden)

    Fabio Mascaro Querido

    2008-12-01

    Full Text Available Partindo da concreticidade da crise ecológica e das transformações contemporâneas no âmbito dos processos de acumulação capitalista, o objetivo geral deste artigo é versar algumas notas preliminares a propósito da perspectiva teórica e política do assim chamado ecossocialismo, tal qual formulado em Michael Löwy. “Corrente de pensamento e de ação” cuja resposta à crise ecológica, a um só tempo romântica e socialista, constitui igualmente uma crítica às potencialidades destrutivas contidas no interior do paradigma societário e produtivo da modernidade. Neste trajeto, busca -se uma aproximação à apropriação löwiniana da obra de Walter Benjamin, especialmente de sua crítica do “progresso” moderno e das ideologias apologetas da “modernização”. Almeja -se assim antever a forma através da qual Michael Löwy e os ecossocialistas respondem às profundas transformações da (pós modernidade capitalista contemporânea, com ênfase particular sobre um argumento central projetado na obra do intelectual franco -brasileiro, qual seja: a defesa da necessidade de que o marxismo radicalize “sua crítica da modernidade, do paradigma da civilização ocidental, industrial, moderna, burguesa” (LÖWY, 2000c, p.242, argumento que o levaria, já em meados da década de 1980, a valorizar as potencialidades revolucionárias subjacentes a crítica romântica da modernidade. Por fim, indaga -se sobre a projeção ecossocialista da necessidade de superação revolucionária do paradigma civilizatório propalado pelo capitalismo moderno

  1. Michael Jackson, Bin Laden and I: functions of positive and negative, public and private flashbulb memories.

    Science.gov (United States)

    Demiray, Burcu; Freund, Alexandra M

    2015-01-01

    This study examined the perceived psychosocial functions of flashbulb memories: It compared positive and negative public flashbulb memories (positive: Bin Laden's death, negative: Michael Jackson's death) with private ones (positive: pregnancy, negative: death of a loved one). A sample of n = 389 young and n = 176 middle-aged adults answered canonical category questions used to identify flashbulb memories and rated the personal significance, the psychological temporal distance, and the functions of each memory (i.e., self-continuity, social-boding, directive functions). Hierarchical regressions showed that, in general, private memories were rated more functional than public memories. Positive and negative private memories were comparable in self-continuity and directionality, but the positive private memory more strongly served social functions. In line with the positivity bias in autobiographical memory, positive flashbulb memories felt psychologically closer than negative ones. Finally, middle-aged adults rated their memories as less functional regarding self-continuity and social-bonding than young adults. Results are discussed regarding the tripartite model of autobiographical memory functions.

  2. Novel Interecting Blends Based on Amino Terminited Oligoimides by Using Michael Addition Reaction-II

    Directory of Open Access Journals (Sweden)

    Rita R. Patel

    2012-01-01

    Full Text Available New amino terminated oligoimides (AOIs were prepared by the Michael addition reaction of various bismaleimide (1, namely, 1-(4-((4-((2, 5-dioxocyclopent-3 enylamino methyl cyclohexyl methyl cyclohexyl-1, 6-dihydropyridine-2, 5-dione with excess of various diamines (2a-c. These AOIs were characterized by elemental analysis, FT-IR spectral studies and number average molecular weight estimated by non-aqueous conductometric titrations. AOIs were then treated with acrylol chloride and resultant acryl terminated oligoimides (AcOIs samples were also characterized thermogravimetrically. Each of these AcOI was then combined with the N-phenyl maleimide (PM in THF solvent. The resultant suspensions were then heated in the presence of azobisisobutyronitrile (AIBN as an initiator. The AcOI and PM polymerized through double bond simultaneously and form interacting blends, which were analyzed thermogravimetrically. The glass fiber reinforced composites were fabricated by using the suspensions of the AcOI and PM. The composites of Interacting blends were analyzed for their mechanical, chemical and electrical properties.

  3. Nacionalismos e internacionalismo: um debate entre Michael Löwy e Michel Cahen

    Directory of Open Access Journals (Sweden)

    Ângela Lazagna

    2008-11-01

    Full Text Available Este artigo consiste em um debate realizado entre Michel Löwy e Michael Cahen em meados dos anos 1990 e revisto para esta publicação. Mesmo que a discussão refira-se a acontecimentos que até certo ponto podem ser considerados datados, a preocupação de fundo que é comum a esses artigos concede-lhes atualidade: a necessidade do aprofundamento de uma reflexão, a partir da teoria marxista, sobre o problema dos nacionalismos e do internacionalismo em tempos de mundialização. Esse aprofundamento, segundo os autores, faz-se necessário sobretudo por meio de uma reflexão que rompa criticamente com uma visão eurocêntrica dos diferentes nacionalismos e que supere a atitude de muitos marxistas de desprezarem tudo aquilo que não seja diretamente relevante à "consciência de classe".

  4. A man and his island: The island mirror in Michael Crummey’s Sweetland

    Directory of Open Access Journals (Sweden)

    Laurie Brinklow

    2016-05-01

    Full Text Available Between 1946 and 1975, dozens of islands and outports in the Canadian province of Newfoundland and Labrador were abandoned as part of a government resettlement policy. Families and communities were torn apart, and a culture and way of life that revolved around the fishery changed irrevocably. The practice, which continues to this day, has been well documented, particularly by artists and writers. Michael Crummey’s 2014 novel Sweetland is a recent iteration. The relationship between humans and place is complex: on an island, with compressed space and a very real boundary that is the ocean, emotional attachments to one’s place are often heightened and distilled. What happens when a person is displaced from his or her island; when bonds of attachment are severed and one’s mirrored double is destroyed? Sweetland offers a fictional lens through which we see an example of a mirrored relationship between an island protagonist and his island setting. Exploring themes of attachment to place, and what Barry Lopez calls a “storied” or “reciprocal” relationship with the land, this paper examines what happens to a man when confronted with leaving an island he knows as deeply as his own body and soul; and how the island reacts.

  5. Selective bird predation on the peppered moth: the last experiment of Michael Majerus.

    Science.gov (United States)

    Cook, L M; Grant, B S; Saccheri, I J; Mallet, J

    2012-08-23

    Colour variation in the peppered moth Biston betularia was long accepted to be under strong natural selection. Melanics were believed to be fitter than pale morphs because of lower predation at daytime resting sites on dark, sooty bark. Melanics became common during the industrial revolution, but since 1970 there has been a rapid reversal, assumed to have been caused by predators selecting against melanics resting on today's less sooty bark. Recently, these classical explanations of melanism were attacked, and there has been general scepticism about birds as selective agents. Experiments and observations were accordingly carried out by Michael Majerus to address perceived weaknesses of earlier work. Unfortunately, he did not live to publish the results, which are analysed and presented here by the authors. Majerus released 4864 moths in his six-year experiment, the largest ever attempted for any similar study. There was strong differential bird predation against melanic peppered moths. Daily selection against melanics (s ≈ 0.1) was sufficient in magnitude and direction to explain the recent rapid decline of melanism in post-industrial Britain. These data provide the most direct evidence yet to implicate camouflage and bird predation as the overriding explanation for the rise and fall of melanism in moths.

  6. Creative Industries, Value Theory and Michael Heinrich’s New Reading of Marx

    Directory of Open Access Journals (Sweden)

    Frederick H. Pitts

    2015-06-01

    Full Text Available This article utilises the new reading of Marx found in the work of Michael Heinrich to analyse the creative industries. It considers the role played in the production of value by the labour that takes place in the sphere of circulation. The specific focus is on creative industries such as graphic design, advertising and branding. It applies Heinrich's conceptualisation of 'social validation' to these sectors. This suggests that valorisation depends upon goods and services attaining commodity status by selling for money. Value is subject to this validation. The capitalist use of advertising, graphic design and branding guarantees the possibility of this validation. Using Heinrich, it reevaluates claims made about the creative industries and cognate fields in three main respects. First, it exposes as inadequate certain Marxist understandings of productive and unproductive labour and the place of circulation activities within this distinction. Second, it refutes autonomist Marxist claims as to the immeasurability of immaterial labour and the redundancy of the law of value. Third, it suggests that creative industries possess a significant role in a capitalist economy blighted by a necessity towards the overproduction of commodities.

  7. Diffusible gradients are out - an interview with Lewis Wolpert. Interviewed by Richardson, Michael K.

    Science.gov (United States)

    Wolpert, Lewis

    2009-01-01

    In 1969, Lewis Wolpert published a paper outlining his new concepts of "pattern formation" and "positional information". He had already published research on the mechanics of cell membranes in amoebae, and a series of classic studies of sea urchin gastrulation with Trygve Gustavson. Wolpert had presented his 1969 paper a year earlier at a Woods Hole conference, where it received a very hostile reception: "I wasnt asked back to America for many years!". But with Francis Crick lining up in support of diffusible morphogen gradients, positional information eventually became established as a guiding principle for research into biological pattern formation. It is now clear that pattern formation is much more complex than could possibly have been imagined in 1969. But Wolpert still believes in positional information, and regards intercalation during regeneration as its best supporting evidence. However, he and others doubt that diffusible morphogen gradients are a plausible mechanism: "Diffusible gradients are too messy", he says. Since his retirement, Lewis Wolpert has remained active as a theoretical biologist and continues to publish in leading journals. He has also campaigned for a greater public understanding of the stigma of depression. He was interviewed at home in London on July 26th, 2007 by Michael Richardson.

  8. Regression and new beginnings: Michael, Alice and Enid Balint and the circulation of ideas.

    Science.gov (United States)

    Sklar, Jonathan

    2012-08-01

    This article offers a new evaluation of Michael Balint's history. It starts with his growing up in Hungary and examines the central concepts of his writing: the analytic pair, regression and the basic fault and creativity, up to and including his renowned work on the eponymous Balint groups (which forged a unique link between psychoanalysis and medicine). While his name is, of course, well known, this article aims to bring his ideas to the attention of a modern analytic audience. Having trained in the 1920s with Ferenczi, Balint brought Ferenczi's literary inheritance to England where he lived until his death in 1970. His connections to Klein, Winnicott and Lacan, all of whom respected his analytic stance, are also examined. Furthermore, this article argues that his ideas were filtered through the theoretical lens of his first wife Alice Balint and later through Enid Balint, both of whom played a key - and rarely recognised - role in the development of his thought. It ends with a brief discussion of his ideas on analytic training and his quest, successful only after his death, to publish the complete Freud-Ferenczi correspondence, together with Ferenczi's diary. Copyright © 2012 Institute of Psychoanalysis.

  9. Losing Touch: A Theology of Death for Michael Haneke’s Amour

    Directory of Open Access Journals (Sweden)

    Taylor Worley

    2016-11-01

    Full Text Available This proposed theology of death for Michael Haneke’s Amour, a fraught but poignant piece of cinema, will employ Martin Heidegger’s existentialism to reframe the ethical structure of the film and apply a “lived theology” rejoinder to its perceived hopelessness. The proposal will address the question of ethics in relation to Haneke’s cinema, in particular his seemingly nihilistic perspective and confrontational style. To do so, it will revisit the film itself and examine the ways that Georges and Anne’s love is tested. Principally, we examine the film’s great question, which—in the filmmaker’s own words—is: “How do I cope with the suffering of a loved one?” With aid from the theologian Dietrich Bonhoeffer, this ‘lived theology’ proposal will attempt to give an account of love’s irrepressible strength in the midst of even astounding suffering. While Heidegger’s ethic of resoluteness calls for interiority and solitude, Bonhoeffer’s account of death more satisfactorily invokes a transcendent summons contained within our own pledges to loved ones. Such a theological reading of Haneke’s Amour will draw two distinct conclusions: first, the film exposes the superficiality of any hoped-for solitude or escape from a loved one’s death, and secondly, it demonstrates that the mutuality of authentic love entails impossible sacrifices.

  10. La figura del libro in Die unendliche Geschichte di Michael Ende: da finestra a varco

    Directory of Open Access Journals (Sweden)

    Elena Di Cesare

    2015-01-01

    Full Text Available The book is an object which can be considered as a window in the novel Die unendliche Geschichte (1979 written by Michael Ende. It allows Bastian to look at the world of Phantasien and to communicate indirectly with the Childlike Empress. Furthermore, this object will show its function as an symbol of evolution, which will enable the passage of the protagonist into the world of Phantasien: first the book appears as a window, then it becomes a two-way-mirror that allows Bastian and Atreju to look at each other, and finally it turns into a gate which enables them to live many adventures together. Die unendliche Geschichte can be considered as a modern Bildungsroman in which the young protagonist gradually reaches his maturation. This progress must be seen in a psychological perspective: it is the growth of a child-mind through literature which makes reference to the German novel tradition but also (as children’s literature to the world of unconsciousness.

  11. Synthesis of some pyridine and pyrimidine derivatives via Michael-Addition

    International Nuclear Information System (INIS)

    El-Baih, Fatma E.M.; Al-Rasheed, Hessa H.; Al-Hazimi, Hassan M.

    2006-01-01

    Synthesis of pyridine and pyrimidine analogues 4 and 6-9 were achieved by Michael-addition of compounds containing either active methylene groups like, malononitrile , ethyl cyanoacetate and 1-tetralone or compounds containing active hydrogen atoms like, guanidine in the presence of an oxidizing agent and thiourea to 2-arylmethylidine-1-tetralone and 2-arylmethylidine-6-methoxy-1-tetralone (2) (enones). Addition of malononitrile in piperidine at room temperature to 2-amino-3-cyno-naphtho [1, 2-malonoitrile in sodium alkoxide or sodium hydroxide to 2 gave 4. Cyclization of 3a with acetic anhydride in the presence of conc. H2sO4 gave the naphtha-pyrano[2, 3-d]pyrimidin-8-one (5). Condensation of the pyrimidine thione derivatives 9 with chloroacetic acid gave the 3-oxobenzo[h]thiazoladino[2, 3-b]quinazoline derivatives (10), which were reacted through their active methylene groups with aromatic aldehydes to give the arylidine derivatives 11. These compounds were also prepared in one step by reacting 9 with chloroacetic acid and aromatic aldehydes. Condensation of 9 with 3-bromopropanoic acid gave 4-oxo-benzo[h]1, 3-thiazino[2, 3-b]quinazoline derivatives (12). The structures of the prepared compounds were mainly confirmed on the basis of spectroscopic methods. (author)

  12. “This fabulous flotsam”: Michael Moorcock’s Urban Anthropology in “London under London”

    Directory of Open Access Journals (Sweden)

    Houswitschka Christoph

    2015-07-01

    Full Text Available Michael Moorcock is often described as “one of the most prolific and varied writers working in Britain” (Malcolm 146. His success as a writer and editor of science fiction and fantasy literature is well established, but he is also the author of two novels about London, Mother London (1988 and King of the City (2000. Hardly known, Mother London by Michael Moorcock, offers itself to a variety of approaches that have been widely discussed in the context of studies on English literature during the Thatcher years, post-modernism, and psycho-geography. The novel resonates with the author’s own childhood in war-time London without being autobiographical. It tells the story of three Londoners who were traumatised during the Blitz. The following article focuses on the mysteries of subterranean London that represents the hidden and unconscious identities of its inhabitants in the post-war period.

  13. Theoretical study on the reaction mechanisms of Michael chirality addition between propionaldehyde and nitroalkene catalyzed by an enantioselective catalyst.

    Science.gov (United States)

    Zhou, Xinming; Li, Ling; Sun, Xuejun; Wang, Yajun; Du, Dongmei; Fu, Hui

    2018-06-01

    The asymmetric Michael addition between propionaldehyde and nitroalkene catalyzed by 8-(ethoxycarbonyl)-1,2,3,3a,8,8a-hexahydropyrrolo[2,3-b]indole-2-carboxylic acid has obtained relatively high yields and excellent enantioselectivities at room temperature. In this study, the molecular structures and optical activity of the most stable conformation I are optimized at B3LYP/6-311++ G(d,p) level. We find that levorotatory conformation I catalyzing the same Michael addition can produce laevo-product A and dextrorotatory conformation I' can obtain the dextral-product A'. These results have guiding significance for further studying on the new chemzymes and the mechanism of the obtained different chiral products. © 2018 Wiley Periodicals, Inc.

  14. O que é a Multidão? Questões para Michael Hardt e Antonio Negri

    Directory of Open Access Journals (Sweden)

    Nicholas Brown

    2006-07-01

    Full Text Available Multidão, livro mais recente de Michael Hardt e Antonio Negri, é uma tentativa de nomear e compreender as condições que envolvem a dinâmica social do século xxi. Na entrevista a seguir, Hardt e Negri discorrem sobre as possibilidades de constituição da multidão como agente político, discutem os fundamentos do livro e defendem conceitos que consideram determinantes para a compreensão dos novos tempos, tais como biopolítica e biopoder.Multitude, Michael Hardt and Antonio Negri’s latest book, is an attempt at understanding conditions involving social dynamics in the xxi century. In the interview below, Hardt and Negri consider the constitution of the multitude as a political agent, discuss the structure of their book and support concepts seen as crucial for the comprehension of our time, such as biopolitics and biopower.

  15. The works of Joseph and Michael Haydn in Ondřej Horník's collection

    Czech Academy of Sciences Publication Activity Database

    Freemanová, Michaela

    2017-01-01

    Roč. 9, 1-2 (2017), s. 14-23 ISSN 1803-7828 Institutional support: RVO:68378076 Keywords : music manuscripts * Joseph Haydn * Michael Haydn * Ondřej Horník's collection * church music Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Performing arts studies ( Music ology, Theater science, Dramaturgy) http://www.nm.cz/publikace/archiv.php?id=16

  16. Leadership and creativity in public services: An interview with Lord Michael Bichard, Chair of the National Audit Office

    OpenAIRE

    Bolden, R.; O'Regan, N.

    2018-01-01

    This interview with Lord Michael Bichard, one of the most distinguished public sector leaders in the UK, explores his ideas around the relationship between leadership, creativity and innovation. A champion of place-based approaches to public services, where citizens are actively involved in service design, delivery and appraisal, Bichard advocates the need for inclusive and supportive leadership that enables the emergence of the kinds of creativity required to respond to the financial challen...

  17. Catalytic Enantioselective Synthesis of 3,4-Unsubstituted Thiochromenes through Sulfa-Michael/Julia-Kocienski Olefination Cascade Reaction.

    Science.gov (United States)

    Simlandy, Amit Kumar; Mukherjee, Santanu

    2017-05-05

    A highly enantioselective cascade sulfa-Michael/Julia-Kocienski olefination reaction between 2-mercaptobenzaldehydes and β-substituted vinyl PT-sulfones has been realized for the synthesis of 3,4-unsubstituted 2H-thiochromenes. This reaction, catalyzed by diphenylprolinol TMS ether, proceeds through an aromatic iminium intermediate and furnishes a wide range of 2-substiuted 2H-thiochromenes with excellent enantioselectivities (up to 99:1 er).

  18. Notas sobre Feral y las cigüeñas, de Fernando Alonso, y la "Historia del califa cigüeña" (Wilhelm Hauff, Sara Cone Bryant

    Directory of Open Access Journals (Sweden)

    Hans Christian Hagedorn

    2011-01-01

    Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.

  19. Solid State Ionics: from Michael Faraday to green energy-the European dimension.

    Science.gov (United States)

    Funke, Klaus

    2013-08-01

    Solid State Ionics has its roots essentially in Europe. First foundations were laid by Michael Faraday who discovered the solid electrolytes Ag 2 S and PbF 2 and coined terms such as cation and anion , electrode and electrolyte . In the 19th and early 20th centuries, the main lines of development toward Solid State Ionics, pursued in Europe, concerned the linear laws of transport, structural analysis, disorder and entropy and the electrochemical storage and conversion of energy. Fundamental contributions were then made by Walther Nernst, who derived the Nernst equation and detected ionic conduction in heterovalently doped zirconia, which he utilized in his Nernst lamp. Another big step forward was the discovery of the extraordinary properties of alpha silver iodide in 1914. In the late 1920s and early 1930s, the concept of point defects was established by Yakov Il'ich Frenkel, Walter Schottky and Carl Wagner, including the development of point-defect thermodynamics by Schottky and Wagner. In terms of point defects, ionic (and electronic) transport in ionic crystals became easy to visualize. In an 'evolving scheme of materials science', point disorder precedes structural disorder, as displayed by the AgI-type solid electrolytes (and other ionic crystals), by ion-conducting glasses, polymer electrolytes and nano-composites. During the last few decades, much progress has been made in finding and investigating novel solid electrolytes and in using them for the preservation of our environment, in particular in advanced solid state battery systems, fuel cells and sensors. Since 1972, international conferences have been held in the field of Solid State Ionics, and the International Society for Solid State Ionics was founded at one of them, held at Garmisch-Partenkirchen, Germany, in 1987.

  20. Solid State Ionics: from Michael Faraday to green energy—the European dimension

    Science.gov (United States)

    Funke, Klaus

    2013-01-01

    Solid State Ionics has its roots essentially in Europe. First foundations were laid by Michael Faraday who discovered the solid electrolytes Ag2S and PbF2 and coined terms such as cation and anion, electrode and electrolyte. In the 19th and early 20th centuries, the main lines of development toward Solid State Ionics, pursued in Europe, concerned the linear laws of transport, structural analysis, disorder and entropy and the electrochemical storage and conversion of energy. Fundamental contributions were then made by Walther Nernst, who derived the Nernst equation and detected ionic conduction in heterovalently doped zirconia, which he utilized in his Nernst lamp. Another big step forward was the discovery of the extraordinary properties of alpha silver iodide in 1914. In the late 1920s and early 1930s, the concept of point defects was established by Yakov Il'ich Frenkel, Walter Schottky and Carl Wagner, including the development of point-defect thermodynamics by Schottky and Wagner. In terms of point defects, ionic (and electronic) transport in ionic crystals became easy to visualize. In an ‘evolving scheme of materials science’, point disorder precedes structural disorder, as displayed by the AgI-type solid electrolytes (and other ionic crystals), by ion-conducting glasses, polymer electrolytes and nano-composites. During the last few decades, much progress has been made in finding and investigating novel solid electrolytes and in using them for the preservation of our environment, in particular in advanced solid state battery systems, fuel cells and sensors. Since 1972, international conferences have been held in the field of Solid State Ionics, and the International Society for Solid State Ionics was founded at one of them, held at Garmisch-Partenkirchen, Germany, in 1987. PMID:27877585

  1. Corrupting Capitalism: Michael Ende’s Momo and “Cathedral Station”

    Directory of Open Access Journals (Sweden)

    Heike Polster

    2016-01-01

    Full Text Available Michael Ende, the well-known author of The Neverending Story , foresaw dramatic changes in the fabric of society resulting from a turn toward neoliberal policies. One such far-reaching and dangerous change has to do with a diminishing of temporal autonomy, the ability to freely determine the use and meaning of our time. This article explores how neoliberalism is shaping our concept of time and our experience of it. In an effort to demonstrate the process and the line of reasoning behind the monetization of time, and to connect time to more qualitative considerations of the human condition, I shall demonstrate how Ende conceptualizes time as an integral part of the accumulation process of capitalism. I also discuss a fairly cryptic short story, “Cathedral Station,” that envisions “the mystery of money.” Utilizing Walter Benjamin’s critique issued in his 1921 fragment “Capitalism as Religion,” I outline Ende’s dystopian vision of the uncontested, unquestioned reign of capitalism as a religious cult. Read together, the novel and the short story offer a way of contrasting two extreme byproducts of capitalism’s colonization of time, namely what I would call an “ideology of work” and an “ideology of growth.” The first of these is a result of capitalism’s commodification of time according to liberal ideals such as choice, freedom, and self-interest. The second is a decidedly neoliberal phenomenon in that the “financialization of everything,” to use David Harvey’s phrase, results in the ever-present expectation of unlimited, exponential growth. By drawing out these two interconnected ideologies through close readings, the subtle processes of capitalism’s colonization of time are revealed.

  2. Solid State Ionics: from Michael Faraday to green energy—the European dimension

    Directory of Open Access Journals (Sweden)

    Klaus Funke

    2013-01-01

    Full Text Available Solid State Ionics has its roots essentially in Europe. First foundations were laid by Michael Faraday who discovered the solid electrolytes Ag2S and PbF2 and coined terms such as cation and anion, electrode and electrolyte. In the 19th and early 20th centuries, the main lines of development toward Solid State Ionics, pursued in Europe, concerned the linear laws of transport, structural analysis, disorder and entropy and the electrochemical storage and conversion of energy. Fundamental contributions were then made by Walther Nernst, who derived the Nernst equation and detected ionic conduction in heterovalently doped zirconia, which he utilized in his Nernst lamp. Another big step forward was the discovery of the extraordinary properties of alpha silver iodide in 1914. In the late 1920s and early 1930s, the concept of point defects was established by Yakov Il'ich Frenkel, Walter Schottky and Carl Wagner, including the development of point-defect thermodynamics by Schottky and Wagner. In terms of point defects, ionic (and electronic transport in ionic crystals became easy to visualize. In an 'evolving scheme of materials science', point disorder precedes structural disorder, as displayed by the AgI-type solid electrolytes (and other ionic crystals, by ion-conducting glasses, polymer electrolytes and nano-composites. During the last few decades, much progress has been made in finding and investigating novel solid electrolytes and in using them for the preservation of our environment, in particular in advanced solid state battery systems, fuel cells and sensors. Since 1972, international conferences have been held in the field of Solid State Ionics, and the International Society for Solid State Ionics was founded at one of them, held at Garmisch-Partenkirchen, Germany, in 1987.

  3. Suspense, culpa y cintas de vídeo. Caché/Escondido de Michael Haneke

    Directory of Open Access Journals (Sweden)

    Miguel Martínez-Cabeza

    2011-12-01

    Full Text Available Caché/Escondido (2005 representa dentro de la filmografía de Michael Haneke el ejemplo más destacado de síntesis de los planteamientos formales e ideológicos del cineasta austriaco. Este artículo analiza el filme como manifiesto cinematográfico y como explotación de las convenciones genéricas para construir un modelo de espectador reflexivo. La investigación del modo en que el director plantea y abandona las técnicas del suspense aporta claves para explicar el éxito casi unánime de crítica y la respuesta mucho menos homogénea de las audiencias. El desencadenante de la trama, unas cintas de vídeo que reciben los Laurent, es alusión directa a Carretera Perdida (1997 de David Lynch; no obstante, el misterio acerca del autor de la videovigilancia pierde interés en relación al sentimiento de culpa que desencadena en el protagonista. El episodio infantil de celos y venganza hacia un niño argelino y la actitud del Georges adulto representan una alegoría de la relación de Francia con su pasado colonial que tampoco cierra la narración de Haneke. Es precisamente la apertura formal con que el filme (desestructura cuestiones actuales como el límite entre la responsabilidad individual y colectiva lo que conforma un espectador tan distanciado de la diégesis como consciente de su propio papel de observador.

  4. Aza‐Michael addition reaction: Post‐polymerization modification and preparation of PEI/PEG‐based polyester hydrogels from enzymatically synthesized reactive polymers

    DEFF Research Database (Denmark)

    Hoffmann, Christian; Stuparu, Mihaiela C.; Daugaard, Anders Egede

    2015-01-01

    The utility of aza‐Michael addition chemistry for post‐polymerization functionalization of enzymatically prepared polyesters is established. For this, itaconate ester and oligoethylene glycol are selected as monomers. A Candida Antarctica lipase B catalyzed polycondensation reaction between the two...... monomers provides the polyesters, which carry an activated carbon‐carbon double bond in the polymer backbone. These electron deficient alkenes represent suitable aza‐Michael acceptors and can be engaged in a nucleophilic addition reaction with small molecular mono‐amines (aza‐Michael donors) to yield...... functionalized linear polyesters. Employing a poly‐amine as the aza‐Michael donor, on the other hand, results in the formation of hydrophilic polymer networks....

  5. Enantioselective organocatalyzed Oxa-Michael-Aldol cascade reactions: Construction of chiral 4H-chromenes with a trifluoromethylated tetrasubstituted carbon stereocenter

    KAUST Repository

    Zhang, Jing; Ajitha, Manjaly John; He, Lin; Liu, Kai; Dai, Bin; Huang, Kuo-Wei

    2015-01-01

    The first organocatalytic asymmetric synthesis of 4H-chromenes bearing a trifluoromethylated tetrasubstituted carbon center is presented. Chiral secondary amines promote the oxa-Michael-aldol cascade reaction between alkynals and 2

  6. Why There Are Certain Parallels Between Joachim C. Fest’s Hitler-Biography and Michael Wolff’s Trump-Book

    Directory of Open Access Journals (Sweden)

    Christian Fuchs

    2018-02-01

    Full Text Available Joachim C. Fest published one of the most widely read Hitler biographies in 1973. Are there parallels of its analytical approach to Michael Wolff’s “Fire and Fury: Inside the Trump White House”?

  7. New eco-friendly animal bone meal catalysts for preparation of chalcones and aza-Michael adducts

    Directory of Open Access Journals (Sweden)

    Riadi Yassine

    2012-06-01

    Full Text Available Abstract Two efficient reactions were successfully carried out using Animal Bone Meal (ABM and potassium fluoride or sodium nitrate doped ABMs as new heterogeneous catalysts under very mild conditions. After preparation and characterization of the catalysts, we first report their use in a simple and convenient synthesis of various chalcones by Claisen–Schmidt condensation and then in an aza-Michael addition involving several synthesized chalcones with aromatic amines. All the reactions were carried out at room temperature in methanol; the chalcone synthesis was also achieved in water environment under microwave irradiation. Doping ABM enhances the rate and yield at each reaction. Catalytic activities are discussed and the ability to re-use the ABM is demonstrated. Results For Claisen–Schmidt the use of ABM alone, yields never exceeded 17%. In each entry, KF/ABM and NaNO3/ABM (79-97% gave higher yields than using ABM alone under thermic condition. Also the reaction proceeded under microwave irradiation in good yields (72-94% for KF/ABM and 81-97% for NaNO3/ABM and high purity. For aza-Michael addition the use of ABM doped with KF or NaNO3 increased the catalytic activity remarkably. The very high yields could be noted (84-95% for KF/ABM and 81-94% for NaNO3/ABM. Conclusion The present method is an efficient and selective procedure for the synthesis of chalcones an aza-Michael adducts. The ABM and doped ABMs are a new, inexpensive and attractive solid supports which can contribute to the development of catalytic processes and reduced environmental problems.

  8. Late Quaternary vegetation and climate history of the central Bering land bridge from St. Michael Island, western Alaska

    Science.gov (United States)

    Ager, T.A.

    2003-01-01

    Pollen analysis of a sediment core from Zagoskin Lake on St. Michael Island, northeast Bering Sea, provides a history of vegetation and climate for the central Bering land bridge and adjacent western Alaska for the past ???30,000 14C yr B.P. During the late middle Wisconsin interstadial (???30,000-26,000 14C yr B.P.) vegetation was dominated by graminoid-herb tundra with willows (Salix) and minor dwarf birch (Betula nana) and Ericales. During the late Wisconsin glacial interval (26,000-15,000 14C yr B.P.) vegetation was graminoid-herb tundra with willows, but with fewer dwarf birch and Ericales, and more herb types associated with dry habitats and disturbed soils. Grasses (Poaceae) dominated during the peak of this glacial interval. Graminoid-herb tundra suggests that central Beringia had a cold, arid climate from ???30,000 to 15,000 14C yr B.P. Between 15,000 and 13,000 14C yr B.P., birch shrub-Ericales-sedge-moss tundra began to spread rapidly across the land bridge and Alaska. This major vegetation change suggests moister, warmer summer climates and deeper winter snows. A brief invasion of Populus (poplar, aspen) occurred ca. 11,000-9500 14C yr B.P., overlapping with the Younger Dryas interval of dry, cooler(?) climate. During the latest Wisconsin to middle Holocene the Bering land bridge was flooded by rising seas. Alder shrubs (Alnus crispa) colonized the St. Michael Island area ca. 8000 14C yr B.P. Boreal forests dominated by spruce (Picea) spread from interior Alaska into the eastern Norton Sound area in middle Holocene time, but have not spread as far west as St. Michael Island. ?? 2003 University of Washington. Published by Elsevier Inc. All rights reserved.

  9. Michael additions of thiocompounds to {alpha}, {beta}-unsaturated carbonyl compounds in aqueous media: stereoselectivity with unambiguous characterization by NMR

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, Queli Aparecida Rodrigues de; Pereira, Maria Luiza de Oliveira; Coelho, Ricardo Bezerra; Kaiser, Carlos Roland; Jones Junior, Joel; Silva, Flavia Martins da [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Inst. de Quimica. Dept. de Quimica Organica]. E-mail: soa@iq.ufrj.br; Carvalho, Erika Martins de [Instituto de Tecnologia em Farmacos (Far-Manguinhos), Rio de Janeiro, RJ (Brazil)

    2008-07-01

    The reactions of crotonaldehyde (8) with thiophenol (2) and benzalacetone (10) with ethane-1,2- dithiol (11) yield Michael addition products. The reactions of thiophenol (2) with (R)-carvone (13) and (S)-perillaldehyde (15) lead to (2S,3R,5S)-5-isopropenyl-2-methyl-3-(phenylthio)cyclohexanone (14) and (1R,2R,4S)-4-isopropenyl-2-(phenylthio)cyclohexanecarbaldehyde (16), respectively. An unambiguous elucidation of the stereochemistry of 14 and 16 by NMR is also presented. (author)

  10. Tandem Aldol-Michael Reactions in Aqueous Diethylamine Medium: A Greener and Efficient Approach to Bis-Pyrimidine Derivatives

    Directory of Open Access Journals (Sweden)

    Abdullah M. Al-Majid

    2013-12-01

    Full Text Available A simple protocol, involving the green synthesis for the construction of novel bis-pyrimidine derivatives, 3a–i and 4a–e are accomplished by the aqueous diethylamine media promoted tandem Aldol-Michael reaction between two molecules of barbituric acid derivatives 1a,b with various aldehydes. This efficient synthetic protocol using an economic and environmentally friendly reaction media with versatility and shorter reaction time provides bis-pyrimidine derivatives with high yields (88%–99%.

  11. Kochin, Michael S. 2009. Five Chapters on Rhetoric: Character, Action, Things, Nothing and Art (University Park: Pennsylvania State University Press

    Directory of Open Access Journals (Sweden)

    Eithan Orkibi

    2010-04-01

    Full Text Available Deux constatations traversent le nouvel ouvrage de Michael Kochin, et nous invitent à reconsidérer la rhétorique dans la communication persuasive. D’abord, que ce sont les événements concrets et les faits mis à l’épreuve qui ont la plus grande force de conviction ; et ensuite, que le discours a souvent une fonction autre que la persuasion : celle de maintenir les canaux de communication pour sauvegarder les relations et les institutions humaines. Pour l’auteur de cet ouvrage qui porte sur les...

  12. A propósito del libro "Accounting theory: research, regulation and accounting practice" de Michael Gaffikin

    Directory of Open Access Journals (Sweden)

    Garcia Nohora

    2012-09-01

    Full Text Available En el libro “Accounting theory: research, regulation and accounting practice”, el profesor australiano Michael Gaffikin ofrece al lector una idea del origen y amplio desenvolvimiento de la teoría contable durante el siglo XX “cuyo desarrollo ha sido dominado por Estados Unidos” (Gaffikin, 2008, p. 32. Plantea, igualmente, los desafíos y problemas actuales de la regulación y la profesión contable. Por ejemplo, el autor precisa que ante la incapacidad de lograr un acuerdo sobre las mediciones apropiadas, la tendencia mundial es a instaurar medidas determinadas arbitrariamente (Gaffikin, 2008, p. 154.

  13. New 'Master of Science in Nuclear Engineering' study course launched. Interview with Professor Horst-Michael Prasser

    International Nuclear Information System (INIS)

    Anon.

    2008-01-01

    In the fall of 2008, the Zurich Technical University (ETH) and the Lausanne EPF will launch their joint master course of studies in Nuclear Engineering. Horst-Michael Prasser, Professor for Nuclear Energy Systems at Zurich ETH, is responsible for designing the course. In this interview he comments, among other things, on fundamental questions which may determine a future student's choice of a course of studies, and on the special opportunities offered by the new Nuclear Engineering course. Other subjects addressed include the renaissance of nuclear power and the future prospects of safety research and new reactor developments. (orig.)

  14. ‘Doxographical or Philosophical History of Philosophy: On Michael Frede’s Precepts for Writing the History of Philosophy’

    DEFF Research Database (Denmark)

    Catana, Leo

    2016-01-01

    In a series of articles from the 1980s and 1990s, Michael Frede analysed the history of histories of philosophy written over the last three hundred years. According to Frede, modern scholars have degenerated into what he calls a “doxographical” mode of writing the history of philosophy. Instead, he...... argued, these scholars should write what he called “philosophical” history of philosophy, first established in the last decades of the seventeenth century but since abandoned. In the present article it is argued that Frede’s reconstruction of the history of histories of philosophy is historically...

  15. Constructing Singapore : Elitism, Ethnicity and the Nation-Building Project, Michael D. Barr & Zlatko Skrbis

    Directory of Open Access Journals (Sweden)

    Jean-Louis Margolin

    2010-12-01

    Full Text Available Michael Barr, seul ou en collaboration, est depuis une décennie l’un des auteurs les plus prolifiques et les plus reconnus sur la structuration politique et sociologique du Singapour contemporain. Longtemps attaché à l’université du Queensland (Brisbane, aujourd’hui à Flinders (Adelaide, il est assez représentatif de la nouvelle génération (singapourienne aussi bien qu’étrangère des spécialistes de la cité-état : fermement critique, et parfois même hyper-critique, elle n’en reconnaît pas m...

  16. Advances in Statistical Control, Algebraic Systems Theory, and Dynamic Systems Characteristics A Tribute to Michael K Sain

    CERN Document Server

    Won, Chang-Hee; Michel, Anthony N

    2008-01-01

    This volume - dedicated to Michael K. Sain on the occasion of his seventieth birthday - is a collection of chapters covering recent advances in stochastic optimal control theory and algebraic systems theory. Written by experts in their respective fields, the chapters are thematically organized into four parts: Part I focuses on statistical control theory, where the cost function is viewed as a random variable and performance is shaped through cost cumulants. In this respect, statistical control generalizes linear-quadratic-Gaussian and H-infinity control. Part II addresses algebraic systems th

  17. Trajetória acadêmica e perspectivas acerca do turismo sob o olhar de Colin Michael Hall

    Directory of Open Access Journals (Sweden)

    Elayne Gouveia da Silva

    2016-04-01

    Full Text Available Este trabalho versa sobre a visão do Colin Michael Hall na temática do turismo. Para analisar essa temática imbricou-se em duas leituras principais como parâmetro para a discussão. A primeira é a obra “Planejamento turístico: política, processo e planejamento” e, a segunda, “Turismo como El Ciencia Social de La Movilidade”. Estas obras marcam a mudança de visão do autor, onde o mesmo se dedica a fomentar um novo olhar sobre o turismo suscitando sete aspectos para se pensar no turismo. O objetivo deste artigo é analisar a visão de Colin Michael Hall acerca do Turismo. Como metas intermediárias pretende-se, a partir da compilação de informações sobre sua vida acadêmica e suas principais contribuições realizar uma breve crítica. Para o trabalho utilizou-se a pesquisa bibliográfica, e entrevista com o autor. Como resultado obteve-se uma reunião das principais ideias e posições ideológicas do autor, e algumas de suas contribuições com o estudo do turismo.

  18. Synthesis of l-threitol-based crown ethers and their application as enantioselective phase transfer catalyst in Michael additions.

    Science.gov (United States)

    Rapi, Zsolt; Nemcsok, Tamás; Pálvölgyi, Ádám; Keglevich, György; Grün, Alajos; Bakó, Péter

    2017-06-01

    A few new l-threitol-based lariat ethers incorporating a monoaza-15-crown-5 unit were synthesized starting from diethyl l-tartrate. These macrocycles were used as phase transfer catalysts in asymmetric Michael addition reactions under mild conditions to afford the adducts in a few cases in good to excellent enantioselectivities. The addition of 2-nitropropane to trans-chalcone, and the reaction of diethyl acetamidomalonate with β-nitrostyrene resulted in the chiral Michael adducts in good enantioselectivities (90% and 95%, respectively). The substituents of chalcone had a significant impact on the yield and enantioselectivity in the reaction of diethyl acetoxymalonate. The highest enantiomeric excess (ee) values (99% ee) were measured in the case of 4-chloro- and 4-methoxychalcone. The phase transfer catalyzed cyclopropanation reaction of chalcone and benzylidene-malononitriles using diethyl bromomalonate as the nucleophile (MIRC reaction) was also developed. The corresponding chiral cyclopropane diesters were obtained in moderate to good (up to 99%) enantioselectivities in the presence of the threitol-based crown ethers. © 2017 Wiley Periodicals, Inc.

  19. Asymmetric synthesis of α-amino acids via homologation of Ni(II) complexes of glycine Schiff bases. Part 3: Michael addition reactions and miscellaneous transformations.

    Science.gov (United States)

    Aceña, José Luis; Sorochinsky, Alexander E; Soloshonok, Vadim

    2014-09-01

    The major goal of this review is a critical discussion of the literature data on asymmetric synthesis of α-amino acids via Michael addition reactions involving Ni(II)-complexes of amino acids. The material covered is divided into two conceptually different groups dealing with applications of: (a) Ni(II)-complexes of glycine as C-nucleophiles and (b) Ni(II)-complexes of dehydroalanine as Michael acceptors. The first group is significantly larger and consequently subdivided into four chapters based on the source of stereocontrolling element. Thus, a chiral auxiliary can be used as a part of nucleophilic glycine Ni(II) complex, Michael acceptor or both, leading to the conditions of matching vs. mismatching stereochemical preferences. The particular focus of the review is made on the practical aspects of the methodology under discussion and mechanistic considerations.

  20. Invited Commentary: Continuing to Loosen the Constraints on Epidemiology in an Age of Change-A Comment on McMichael's "Prisoners of the Proximate".

    Science.gov (United States)

    Galea, Sandro

    2017-06-01

    Published in 1999, McMichael's "Prisoners of the Proximate: Loosening the Constraints on Epidemiology in an Age of Change" (Am J Epidemiol. 1999;149(10):887-897) outlined an exciting vision for epidemiology as the field that that can help us better understand the drivers of population health so that we may intervene, paving the way for healthier populations. McMichael's paper remains today what it was when it was first published: clear, thoughtful, provocative, and usefully prescriptive in its call to action. McMichael identified 4 constraints facing epidemiology. The field has risen to this challenge and addressed some of these constraints. I discuss how successful (or not) we have been in addressing each of these 4 challenges. © The Author 2017. Published by Oxford University Press on behalf of the Johns Hopkins Bloomberg School of Public Health. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  1. A facile and efficient method of enzyme immobilization on silica particles via Michael acceptor film coatings: immobilized catalase in a plug flow reactor.

    Science.gov (United States)

    Bayramoglu, Gulay; Arica, M Yakup; Genc, Aysenur; Ozalp, V Cengiz; Ince, Ahmet; Bicak, Niyazi

    2016-06-01

    A novel method was developed for facile immobilization of enzymes on silica surfaces. Herein, we describe a single-step strategy for generating of reactive double bonds capable of Michael addition on the surfaces of silica particles. This method was based on reactive thin film generation on the surfaces by heating of impregnated self-curable polymer, alpha-morpholine substituted poly(vinyl methyl ketone) p(VMK). The generated double bonds were demonstrated to be an efficient way for rapid incorporation of enzymes via Michael addition. Catalase was used as model enzyme in order to test the effect of immobilization methodology by the reactive film surface through Michael addition reaction. Finally, a plug flow type immobilized enzyme reactor was employed to estimate decomposition rate of hydrogen peroxide. The highly stable enzyme reactor could operate continuously for 120 h at 30 °C with only a loss of about 36 % of its initial activity.

  2. Tetrabutylammonium Bromide Media Aza-Michael Addition of 1,2,3,6-Tetrahydrophthalimide to Symmetrical Fumaric Esters and Acrylic Esters under Solvent-Free Conditions

    Directory of Open Access Journals (Sweden)

    Mohammadreza Zamanloo

    2010-10-01

    Full Text Available The aza-Michael addition of 1,2,3,6-tetrahydrophthalimide with symmetrical fumaric esters has been performed efficiently in a solvent-free system at 100 °C and using 1,4-diazabicyclo[2.2.2]octane (DABCO as a base in the presence of tetrabutylammonium bromide (TBAB. The products were obtained in good to high yields within 2.5-7.0 h. This reaction worked well on linear alkyl fumarates and was not effective with nonlinear alkyl fumarates. Although the reaction was also applicable to acrylates such as n-butyl acrylate, methacrylates and crotonates were not suitable Michael acceptors for this reaction.

  3. Switchable Diastereoselectivity in the Fluoride Promoted Vinylogous Mukaiyama-Michael Reaction of 2-Trimethylsilyloxyfuran Catalyzed by Crown Ethers

    KAUST Repository

    Della Sala, Giorgio

    2017-05-31

    The fluoride promoted vinylogous Mukaiyama-Michael reaction (VMMR) of 2-trimethylsilyloxyfuran with diverse α,β-unsaturated ketones is described. The TBAF catalyzed VMMR afforded high anti-diastereoselectivity irrespective of the solvents used. The KF/crown ethers catalytic systems proved to be highly efficient in terms of yields and resulted in a highly diastereoselective unprecedented solvent/catalyst switchable reaction. Anti-adducts were obtained as single diastereomers or with excellent diastereoselectivities when benzo-15-crown-5 in CH2Cl2 was employed. On the other hand, high syn-diastereoselectivities (from 76:24 to 96:4) were achieved by employing dicyclohexane-18-crown-6 in toluene. Based on DFT calculations, the catalysts/solvents-dependent switchable diastereoselectivities are proposed to be the result of loose or tight cation-dienolate ion pairs.

  4. Analysis of the Competitive Potential of Bioethanol in Colombia: An approach from Michael Porter's 5 Competitive Forces

    International Nuclear Information System (INIS)

    Ramirez Velasquez, Alejandro; Montoya R, Ivan Alonso; Montoya Restrepo, Alexandra

    2012-01-01

    The search for alternative energy production and consumption require a look into the industry of biofuels such as bioethanol as an alternative energy to overcome the disadvantages generated by the traditional methods of production and consumption, especially in the political, environmental and social issues and generate competitive advantages compared to other primary energy sources. In the present document, and from the Michael Porter five (5) Forces model is detailed an evaluation of the bioethanol industry as an alternative fuel and is described how attractive or competitive may become the industry today. To achieve this purpose, an evaluation of the competitive forces was proposed to a group of experts, using a Likert scale. Thus, it was evaluated the potential usefulness of the proposal.

  5. WHEN DYLAN MET THE BARD: TRANSLATING HAMLET FROM TEXT TO SCREEN (SOUND: MICHAEL ALMEREYDA’S HAMLET

    Directory of Open Access Journals (Sweden)

    Marina Gerzic

    2015-12-01

    Full Text Available Director Michael Almereyda’s diverse musical choices in the film are a threshold into understanding his cinematic interpretation of Hamlet (2000. Almereyda recontextualises Hamlet in terms of contemporary social problems. Hamlet and Ophelia are confronted with and battle against urban claustrophobia, conspiracy and global corporate power. A fragment of the Bob Dylan song ‘All Along the Watchtower’ (1966 is used as a filmic shortcut to translate Shakespeare’s iconic ‘gravedigger scene’ between Hamlet and the Gravedigger from playtext to screen. ‘All Along the Watchtower’ encapsulates certain ideas about mortality and the worth of life from the ‘gravedigger scene’ and demonstrates these issues still resonate in the contemporary urban world the film is set.

  6. QCD propagators and vertices from lattice QCD (in memory of Michael Müller-Preußker

    Directory of Open Access Journals (Sweden)

    Sternbeck André

    2017-01-01

    Full Text Available We review lattice calculations of the elementary Greens functions of QCD with a special emphasis on the Landau gauge. These lattice results have been of interest to continuum approaches to QCD over the past 20 years. They are used as reference for Dyson-Schwinger- and functional renormalization group equation calculations as well as for hadronic bound state equations. The lattice provides low-energy data for propagators and three-point vertices in Landau gauge at zero and finite temperature even including dynamical fermions. We summarize Michael Müller-Preußker’s important contributions to this field and put them into the perspective of his other research interests.

  7. ‘Introducing Michael Gove to Loïc Wacquant’: Why Social Work Needs Critical Sociology

    Science.gov (United States)

    Michael Garrett, Paul

    2016-01-01

    In 2013, Michael Gove, then Secretary of State for Education and Health in the UK coalition government, criticised social workers for laying insufficient emphasis on the ‘agency’ of individuals and for being too preoccupied with social and economic inequalities. Such a perspective, which is not unique to Gove, needs to be countered by reaffirming the significance of an expansively critical sociology for social work. In this context, the thematic concerns of the French theorist, Loïc Wacquant, illuminates key aspects of social work engagement with clients which Gove and his ideological associates appear intent on ignoring. The issues raised have significant political resonances given the pending UK General Election taking place in May 2015. PMID:27559203

  8. Mother's love' for bacterial babies: the commitment of Audrey Michael, Mition Yoannes and Tilda Orami to medical research.

    Science.gov (United States)

    Gibbs, Tammy; Vilakiva, Geraldine

    2013-01-01

    Audrey Michael, Mition Yoannes and Tilda Orami are long-term health researchers at the Papua New Guinea Institute of Medical Research (PNGIMR). Face-to-face interviews were conducted with all three women for the purpose of profiling women who are leaders in health and medicine in Papua New Guinea. They were asked questions about their early life and childhood, education, work life and training, and mentors who have supported their career path and leadership role. Audrey, Mition and Tilda have all made significant contributions to the PNGIMR and to the health of the people of PNG. In particular, all three have been part of pneumococcal conjugate vaccine (PCV) studies--looking at the safety, immunogenicity and priming for immunological memory of a 7-valent PCV and investigating the safety and immune responses to two different, recently licensed types of PCV, a 13-valent and a 10-valent vaccine.

  9. On Politics and Education Finance: A Bibliography of Joel S. Berke, James W. Guthrie, and Michael W. Kirst. Vance Bibliographies, Public Administration Series: Bibliography P-821.

    Science.gov (United States)

    Quay, Richard H.

    A bibliography of Joel S. Berke, James W. Guthrie, and Michael W. Kirst on politics and educational finance is presented. Specific topics include the following: whether financial support of public schools should be assumed completely by states, school finance policies and practices, school finance reform versus the spending and tax limitation…

  10. Facile Iodine-Catalyzed Michael Addition of Indoles to α,α′-Bis(arylmethylene)cyclopentanones: An Efficient Synthesis of E-2-(3-Indolylphenylmethyl)-5-phenylmethylenecyclopentanones

    Science.gov (United States)

    Pal, Rammohan; Das Gupta, Arpita; Mallik, Asok K.

    2012-01-01

    Iodine-catalyzed reaction of indoles with α,α′-bis(arylmethylene)cyclopentanones afforded one diastereomer of the corresponding Michael adducts, namely, E-2-(3-indolylphenylmethyl)-5-phenylmethylenecyclopentanones, in a good yield. The products form a new group of indole derivatives. PMID:24052849

  11. LEBANON AFTER THE CEDAR REVOLUTION/ARE KNUDSEN AND MICHAEL KERR (eds; LEBANON: A HISTORY, 600--2011/by WILLIAM HARRIS

    Directory of Open Access Journals (Sweden)

    Franck Salameh

    2013-05-01

    Full Text Available LEBANON AFTER THE CEDAR REVOLUTION, ARE KNUDSEN AND MICHAEL KERR (eds; London: C. Hurst & Company, 2012. 323 pp. $29.95. LEBANON: A HISTORY, 600--2011, WILLIAM HARRIS; Oxford, New York: Oxford University Press, 2012. 360 pp. $34.95.

  12. How "The Right" Continues to "Do Wrong" by Our Young People: Contemporary Reflections on Michael Apple's Analysis of the "Rightist Turn" in Education

    Science.gov (United States)

    McGregor, Glenda

    2018-01-01

    Michael Apple's 2005 article, "Doing Things the 'Right' Way: Legitimating Educational Inequalities in Conservative Times", is a seminal piece of writing that highlights some of his core concerns with the effects of neo-liberal and neo-conservative ideologies on education. Since its publication, this article has incited much debate about…

  13. Domino Aza-Michael-ih-Diels-Alder Reaction to Various 3-Vinyl-1,2,4-triazines: Access to Polysubstituted Tetrahydro-1,6-naphthyridines.

    Science.gov (United States)

    Jouha, Jabrane; Buttard, Floris; Lorion, Magali; Berthonneau, Clément; Khouili, Mostafa; Hiebel, Marie-Aude; Guillaumet, Gérald; Brière, Jean-François; Suzenet, Franck

    2017-09-15

    A straightforward domino aza-Michael-inverse-electron-demand-hetero-Diels-Alder/retro-Diels-Alder reaction between primary and secondary propargylamine derivatives and 3-vinyl-1,2,4-triazines is developed highlighting not only the uniqueness of this dual-heterocyclic platform but also a novel and unprecedented path to polysubstituted tetrahydro-1,6-naphthyridine scaffolds.

  14. Stereoselective synthesis of organosulfur compounds incorporating N-aromatic heterocyclic motifs and quaternary carbon centers via a sulfa-Michael triggered tandem reaction.

    Science.gov (United States)

    Qin, Tianyou; Cheng, Lu; Zhang, Sean Xiao-An; Liao, Weiwei

    2015-06-14

    A novel sulfa-Michael addition (SMA)-triggered tandem reaction was developed by combining a SMA reaction with a simultaneous rearomatization process utilizing a less reactive carbonyl group as an intramolecular electrophile partner, which provided a unique synthetic route to access various organosulfur compounds incorporating an N-aromatic heterocyclic motif and quaternary carbon centers.

  15. Using Our Voices, Losing Our Bodies: Michael Brown, Trayvon Martin, and the Spirit Murders of Black Male Professors in the Academy

    Science.gov (United States)

    Johnson, Lamar; Bryan, Nathaniel

    2017-01-01

    The recent deaths of Michael Brown, Trayvon Martin, and other Black males have generated new civil rights urgencies in Black communities and spirited academic discourses in higher education regarding the educational and social plight of Black males in America. Connecting the deaths of Black males to our lived experiences in the academy, we use a…

  16. Catalyst-free and solvent-free Michael addition of 1,3-dicarbonyl compounds to nitroalkenes by a grinding method

    Science.gov (United States)

    Xie, Zong-Bo; Wu, Ming-Yu; He, Ting; Le, Zhang-Gao

    2012-01-01

    Summary An environmentally benign, fast and convenient protocol has been developed for the Michael addition of 1,3-dicarbonyl compounds to β-nitroalkenes in good to excellent yields by a grinding method under catalyst- and solvent-free conditions. PMID:22563352

  17. Review Article: Yamada, Jeni "Laura: A Case for the Modularity of Language"; Tomasello, Michael "First Verbs: A Case Study of Early Grammatical Development."

    Science.gov (United States)

    Shatz, Marilyn

    1994-01-01

    Jeni Yamada's "Laura" and Michael Tomasello's "First Verbs" continue a tradition of providing useful information on the language ability of individuals in a depth rarely found in multisubject studies; however, these efforts are unusual for case studies in that both take strong theoretical positions on the essence of language and language learning.…

  18. Asymmetric Domino Aza-Michael Addition/[3+2] Cycloaddition Reactions as a Versatile Approach to alpha,beta,gamma,-Triamino Acid Derivatives

    Czech Academy of Sciences Publication Activity Database

    Kapras, Vojtěch; Pohl, Radek; Císařová, I.; Jahn, Ullrich

    2014-01-01

    Roč. 16, č. 4 (2014), s. 1088-1091 ISSN 1523-7060 Institutional support: RVO:61388963 Keywords : 1,3-dipolar cycloaddition * lithium amides * aza-Michael addition * amino acids * pyrazoles Subject RIV: CC - Organic Chemistry Impact factor: 6.364, year: 2014

  19. Hexamethoxylated Monocarbonyl Analogues of Curcumin Cause G2/M Cell Cycle Arrest in NCI-H460 Cells via Michael Acceptor-Dependent Redox Intervention.

    Science.gov (United States)

    Li, Yan; Zhang, Li-Ping; Dai, Fang; Yan, Wen-Jing; Wang, Hai-Bo; Tu, Zhi-Shan; Zhou, Bo

    2015-09-09

    Curcumin, derived from the dietary spice turmeric, holds promise for cancer prevention. This prompts much interest in investigating the action mechanisms of curcumin and its analogues. Two symmetrical hexamethoxy-diarylpentadienones (1 and 2) as cucumin analogues were reported to possess significantly enhanced cytotoxicity compared with the parent molecule. However, the detailed mechanisms remain unclear. In this study, compounds 1 and 2 were identified as the G2/M cell cycle arrest agents to mediate the cytotoxicity toward NCI-H460 cells via Michael acceptor-dependent redox intervention. Compared with curcumin, they could more easily induce a burst of reactive oxygen species (ROS) and collapse of the redox buffering system. One possible reason is that they could more effectively target intracellular TrxR to convert this antioxidant enzyme into a ROS promoter. Additionally, they caused up-regulation of p53 and p21 and down-regulation of redox-sensitive Cdc25C along with cyclin B1/Cdk1 in a Michael acceptor- and ROS-dependent fashion. Interestingly, in comparison with compound 2, compound 1 displayed a relatively weak ability to generate ROS but increased cell cycle arrest activity and cytotoxicity probably due to its Michael acceptor-dependent microtubule-destabilizing effect and greater GST-inhibitory activity, as well as its enhanced cellular uptake. This work provides useful information for understanding Michael acceptor-dependent and redox-mediated cytotoxic mechanisms of curcumin and its active analogues.

  20. The Impact of Socio-Cultural Differences on Educational Values: A Comparison of the Pedagogy of Michael Oakeshott and John McGahern

    Science.gov (United States)

    Williams, Kevin

    2017-01-01

    The year 2016 marked the tenth anniversary of the death of John McGahern (born 1934), the widely acclaimed Irish author. There is a shared temper of mind and several common strands in the work of McGahern and that of the English philosopher, Michael Oakeshott (1900-1990). Despite the very different cultural environments in which they grew up and…

  1. What's in a Name? That Which We Call a Crisis? A Commentary on Michael Young's Article "Overcoming the Crisis in Curriculum Theory"

    Science.gov (United States)

    Lundgren, Ulf P.

    2015-01-01

    Michael Young's article "Overcoming the crisis in curriculum theory: a knowledge-based approach" ("JCS, 45", 2) is discussed from the starting point that the claimed crisis is constructed from a decisive solution, that is the solution determines what is a crisis. But curriculum research and curriculum theory are in need of…

  2. Polyfunctional beta-Dicarbonyl Compounds by Michael Addition Reactions of Ester Enolates to alpha-Benzylidene and alpha-Alkylidene-beta-dicarbonyl Compounds

    Czech Academy of Sciences Publication Activity Database

    Holan, Martin; Pohl, Radek; Císařová, I.; Jahn, Ullrich

    -, č. 18 (2012), s. 3459-3475 ISSN 1434-193X R&D Projects: GA ČR GA203/09/1936 Institutional research plan: CEZ:AV0Z40550506 Keywords : Michael addition * diastereoselectivity * regioselectivity * enols * dicarbonyl compounds Subject RIV: CC - Organic Chemistry Impact factor: 3.344, year: 2012

  3. Cadrage, décadrage et recadrage dans Baa Baa Black Sheep : A Jungle Tale de David Malouf et Michael Berkeley Patrimonial Deconstruction and Reconstruction in David Malouf and Michael Berkeley’s Baa Baa Black Sheep : A Jungle Tale

    Directory of Open Access Journals (Sweden)

    Jean-Philippe Héberlé

    2011-11-01

    Full Text Available This article discusses Michael Berkeley’s first opera, Baa Baa Black Sheep: A Jungle Tale. Premiered under the baton of Paul Daniel on July 3rd 1993 at the Cheltenham International Festival of Music, this opera is based on two texts by Rudyard Kipling: The Jungle Books (1894-1895 and “Baa, Baa, Black Sheep” from the short story collection Wee Willie Winkie and Other Stories, first published in 1888. The libretto was penned by the Australian poet, novelist, playwright and librettist, David Malouf. After a brief survey of some of the earliest transpositions of The Jungle Books, I analyse the way David Malouf deals with both texts. “Baa Baa Black Sheep” is used as the central element of his libretto, and episodes and characters from The Jungle Books are incorporated to draw parallelism between the main topics of the two texts. Both Malouf’s endeavour and Berkeley’s, through the music, aims at deconstructing the preposterous oldest transpositions of The Jungle Books and at focusing on the key elements of Kipling’s famous book, notably identity and hybridism, two important themes of colonial and postcolonial literature. The aim of David Malouf and Michael Berkeley is to address an adult audience and show that The Jungle Books are not only aimed at children as Disney’s or Baden Powell’s appropriations of the work could wrongly make us believe.Cet article porte sur Baa Baa Black Sheep: A Jungle Tale, le premier opéra de Michael Berkeley. Créé au Everyman Theatre de Cheltenham le 3 juillet 1993 sous la direction de Paul Daniel, cette œuvre est le fruit de la collaboration entre le compositeur britannique et l’écrivain australien David Malouf. Le livret de Malouf se fonde sur deux récits de Rudyard Kipling : la nouvelle autobiographique “Baa, Baa, Black Sheep” auquel l’opéra doit son nom et The Jungle Books. Après m’être intéressé aux premières transpositions musicales de The Jungle books, je montre comment

  4. El movimiento como simulacro en el mundo virtual: Michael Betancourt y el arte de la inmediatez. = Movement as simulacrum in the virtual world: Michael Betancourt and the art of immediacy

    Directory of Open Access Journals (Sweden)

    José Manuel García Perera

    2016-05-01

    Full Text Available La creación artística se ha acercado en los últimos tiempos a la imagen mediática que propone Internet, alterando sustancialmente una experiencia estética antes basada en el movimiento del espectador en torno a la obra y definida ahora por pantallas que inducen a la pasividad. El trabajo en vídeo de Michael Betancourt, encuadrado en el denominado arte glitch, ese que se fija en el fallo ocurrido dentro del ámbito digital, ha sido la base para realizar aquí un estudio comparativo entre diferentes concepciones artísticas del movimiento, así como entre un arte pasado y otro actual que permite ver cómo los avances tecnológicos han originado cambios radicales en la naturaleza corpórea, espacial y móvil de la obra. La investigación de Betancourt propone un nuevo arte cinético que, por medio del error, se hace crítico, se mimetiza con el movimiento en tiempo real que la contemporaneidad demanda y destapa el artificio de imágenes que imitan a la realidad como si quisieran sustituirla.In recent times, artistic creation has come closer to the media image proposed by Internet, thus seriously altering an aesthetic experience based before on movement of the viewer around the work and now defined by screens that induce passivity. Michael Betancourt’s video work, part of the so-called glitch art, which focuses on the failure that can occur within the digital realm, has been here the basis for a comparative study between different concepts of movement in art, as well as between a current and a past art, a comparison that allows us to see clearly how technological advances have produced radical changes in the physical, spatial and mobile nature of the artwork. Betancourt’s investigation proposes a new kinetic art that becomes critical through error, mimics the real-time movement that contemporary culture demands, and uncovers the artificiality of images that mimic reality as if they wanted to replace it.

  5. Dr Michaels® product family (also branded as Soratinex®) versus Methylprednisolone aceponate - a comparative study of the effectiveness for the treatment of plaque psoriasis.

    Science.gov (United States)

    Hercogovấ, J; Fioranelli, M; Gianfaldoni, S; Chokoeva, A A; Tchernev, G; Wollina, U; Tirant, M; Novotny, F; Roccia, M G; Maximov, G K; França, K; Lotti, T

    2016-01-01

    As one of the most common dermatologic chronic-recurrent disease, variable therapeutic options are available today for management of psoriasis. Although topical high potency corticosteroids, alone or in association with salicylic acid or vitamin D analogues, are still considered the best treatment, they do not seem to possess the capability for a long-term control of the disease or prevent recurrences, as their side effects are major contraindications for continuative use. The aim of this study was to investigate whether Dr. Michaels® product family is comparable to methylprednisolone aceponate (MPA) as a viable alternative treatment option for the treatment and management of stable chronic plaque psoriasis. Thirty adults (13 male, 17 female, mean age 40 years) with mild to severe stable chronic plaque psoriasis, were included in the study. Patients were advised to treat the lesions of the two sides of their body (left and right) with two different unknown modalities for 8 weeks; the pack of Dr. Michaels® products on the left side (consisting of a cleansing gel, an ointment and a skin conditioner) and a placebo pack on the right side, consisting of a cleansing gel, methylprednisolone ointment and a placebo conditioner. Assessment was done using the Psoriasis Activity Severity Index (PASI) scores before treatment and after 2, 4, 6 and 8 weeks. The results achieved with the Dr. Michaels® (Soratinex®) product family for the treatment of chronic plaque psoriasis were better than the results achieved with methylprednisolone aceponate (MPA), even though quicker resolution was achieved with the steroid with 45% of patients achieving resolution within 8-10 days in comparison to 5-6 weeks in the Dr. Michaels® (Soratinex®) group. Before therapy, the mean PASI score of the LHS in Dr. Michaels® (Soratinex®) group was 13.8±4.1 SD and 14.2±4.2 SD in the RHS methylprednisolone aceponate (MPA) group. After 8 weeks of treatment 62% of the Dr. Michaels® (Soratinex

  6. Nobody Knows My Name: The Masquerade of Mourning in the Early 1980s Artistic Productions of Michael Jackson and Prince

    Directory of Open Access Journals (Sweden)

    Pochmara Anna

    2017-12-01

    Full Text Available The article analyses Michael Jackson’s album Thriller and Prince’s movie Purple Rain. We explore their camp aesthetics and their recasting of the cultural representations of the black male. Jackson’s and Prince’s performative personas are both liberatory and burdened with the received cultural scripts of black masculinity. We claim that their employment of camp is political rather than escapist and depoliticized. Camp serves them as a platform to mourn the cultural displacement of the black male body in a postslavery America. In particular, the two artists distance themselves from the extensive ideological and physical pressures exerted on the black male body in the early 1980s. As a result, their performances are complexly de-Oedipalized. Prince in Purple Rain refuses to assume the patriarchal position of the Father. Analogously, Jackson fashions himself as a Peter Pan-like eternal adolescent who never makes his final identification as either heterosexual or LGBTQ desiring agent. In the coda to the article, we reach beyond the 1980s to explore a more flexible approach to camp in the artistic output of twenty-first-century African American performers of Queercore and Afrofuturist scenes, which were partially enabled by Jackson’s and Prince’s performances.

  7. Sustainable shape memory polymers based on epoxidized natural rubber cured by zinc ferulate via oxa-Michael reaction

    Directory of Open Access Journals (Sweden)

    Xuhui Zhang

    2015-10-01

    Full Text Available Although various shape memory polymers (SMPs or diverse applications have been widely reported, the SMPs based on rubbers have been rarely realized due to the low triggering temperature of rubbers. In another aspect, the SMPs based on sustainable substances are highly desired for the growing shortage in fossil resources. In the present study, we accordingly developed the sustainable SMPs with tunable triggering temperature, based on natural rubber (NR and ferulic acid (FA as the raw materials. Specifically, the SMPs are based on a crosslinked network of epoxidized natural rubber (ENR crosslinked by in situ formed zinc ferulate (ZDF via oxa-Michael reaction. The excellent shape memory effect (SME is found in these SMPs, as evidenced by the high fixity/recovery ratio and the tunable triggering temperature. With the incorporation of natural halloysite nanotubes (HNTs, the stress and recovery rate of the SMPs are found to be tunable, which widens the application of this kind of SMPs. The combination of adoption of sustainable raw materials, and the excellent and tunable SME makes these SMPs potentially useful in many applications, such as various actuators and heat-shrinkable package materials.

  8. Latter-day Mother Irelands: The Role of Women in Michael Collins and The Wind that Shakes the Barley

    Directory of Open Access Journals (Sweden)

    Pilar Villar-Argáiz

    2007-03-01

    Full Text Available Despite the experimental and subversive work of Irish feminist filmmakers such as Pat Murphy and Margo Harkin in the 1980s, as Gerardine Meaney has contended, “the image of woman as Ireland, Ireland as woman, remains powerful and pervasive in the new Irish cinema” (1998: 250. The cinematic convention of representing Ireland through female characters becomes particularly relevant in two recent Irish historical films: Michael Collins (1996, directed and written by Irish Neil Jordan, and The Wind that Shakes the Barley (2006, written by Scottish Paul Laverty and directed by English Ken Loach. In their dealing with themes such as military occupation, colonisation and the heated debate about the Treaty, both films maintain the nationalist rhetoric that represents Ireland as a woman/mother in a direct manner. Over the course of this essay, I shall try to chart the implications of both films’ representations of women, with a view to demonstrating how, even at present, the trope of Mother Ireland continues to be deep in the national unconscious.

  9. ANÁLISIS DEL POTENCIAL COMPETITIVO DEL BIOETANOL EN COLOMBIA: UN ENFOQUE DESDE LAS 5 FUERZAS COMPETITIVAS DE MICHAEL PORTER

    Directory of Open Access Journals (Sweden)

    RAMIREZ VELASQUEZ ALEJANDRO

    2012-11-01

    Full Text Available La búsqueda de alternativas de producción y consumo energético requiere una mirada hacia la industria de los combustibles biológicos como el bioetanol que, como alternativa energética, permita superar los inconvenientes generados por los métodos tradicionales de producción y consumo, en especial en los temas políticos, ambientales y sociales y generar ventajas competitivas frente a otras fuentes primarias de energía. En el presente documento,a partir del modelo de las cinco (5 Fuerzas de Michael Porter, se realiza una evaluación de la industria del bioetanol como combustible alternativo y se expone qué tan atractiva o competitiva puede llegar a ser su industria en la actualidad. Para lograr este propósito, se propone una evaluación de las fuerzas competitivas a un panel de expertos, usando escalas deLikert, para encontrar el potencial de la propuesta.

  10. Quality evaluation of commercially sold table water samples in Michael Okpara University of Agriculture, Umudike, Nigeria and surrounding environments

    Directory of Open Access Journals (Sweden)

    D.O. Okorie

    2015-01-01

    Full Text Available In Michael Okpara University of Agriculture, Umudike, Nigeria (MOUAU and surrounding environments, table water of different brands is commercially hawked by vendors. To the best of our knowledge, there is no scientific documentation on the quality of these water samples. Hence this study which evaluated the quality of different brands of water samples commercially sold in MOUAU and surrounding environments. The physicochemical properties (pH, total dissolved solids (TDS, biochemical oxygen demand (BOD, total hardness, dissolved oxygen, Cl, NO3, ammonium nitrogen (NH3N, turbidity, total suspended solids (TSS, Ca, Mg, Na and K of the water samples as indices of their quality were carried out using standard techniques. Results obtained from this study indicated that most of the chemical constituents of these table water samples commercially sold in Umudike environment conformed to the standards given by the Nigerian Industrial Standard (NIS, World Health Organization (WHO and American Public Health Association (APHA, respectively, while values obtained for ammonium nitrogen in these water samples calls for serious checks on methods of their production and delivery to the end users.

  11. Entrevista com Michael R. KatzDOI: 10.5007/2175-7968.2011v1n27p329

    Directory of Open Access Journals (Sweden)

    Maria Lúcia Barbosa de Vasconcellos

    2011-11-01

    Full Text Available Michael R. Katz graduated from Horace Mann School (New York and attended Williams College (Massachusetts, where he was the very first Russian major. Following graduation in 1966, he studied at Oxford University and the University of Leningrad, where he received his D.Phil. (or Ph.D. in Literature from Oxford. He first taught Russian at Williams and in 1984 became Chair of the Department of Slavic Language and Director of the Title VI Center for Russian and East European Studies at the University of Texas at Austin,. In 1998, he accepted a position as Dean of Language Schools and Schools Abroad at Middlebury College (Vermont. Since his term as Dean ended in 2004, he has been a full-time professor at the Russian Department. Prof. Katz has published several articles on literary translation and written two books. Additionally, he is a published translator of more than a dozen works into English, including novels by Herzen, Chernyshevsky, Dostoevsky, Turgenev, Tolstoy. In this interview, Katz explains how he became a translator, and addresses some important issues concerning the market for translation, his relationship with editors and publishing houses, translation and its critics, and some of the challenges he encountered translating from Russian into English.

  12. A stale challenge to the philosophy of science: commentary on "Is psychology based on a methodological error?" by Michael Schwarz.

    Science.gov (United States)

    Ruck, Nora; Slunecko, Thomas

    2010-06-01

    In his article "Is psychology based on a methodological error?" and based on a quite convincing empirical basis, Michael Schwarz offers a methodological critique of one of mainstream psychology's key test theoretical axioms, i.e., that of the in principle normal distribution of personality variables. It is characteristic of this paper--and at first seems to be a strength of it--that the author positions his critique within a frame of philosophy of science, particularly positioning himself in the tradition of Karl Popper's critical rationalism. When scrutinizing Schwarz's arguments, however, we find Schwarz's critique profound only as an immanent critique of test theoretical axioms. We raise doubts, however, as to Schwarz's alleged 'challenge' to the philosophy of science because the author not at all seems to be in touch with the state of the art of contemporary philosophy of science. Above all, we question the universalist undercurrent that Schwarz's 'bio-psycho-social model' of human judgment boils down to. In contrast to such position, we close our commentary with a plea for a context- and culture sensitive philosophy of science.

  13. One-pot cascade michael.cyclization reactions of ο-hydroxycinnamaldehydes: Synthesis of functionalized 2,3-dihydrobenzofuranes

    International Nuclear Information System (INIS)

    Gwon, Sung Hyuk; Kim, Sunggon

    2012-01-01

    We described the cascade Michael.cyclization reaction of o-hydroxycinnamaldehydes with diethyl α-bromomalonate promoted by potassium carbonate. The reactions provided functionalized 2,3-dihydrobenzofurans in good yields for a variety of o-hydroxyaromatic α,β-unsaturated aldehydes. Current work focuses on expanding the scope of this reaction to other substrates such as sulfur yields, and on developing an efficient catalytic asymmetric variant. 2,3-Dihydrobenzofurans are found in numerous biologically active natural products and synthetic compounds. These are an attractive type of oxygenated compound because their basic core skeleton is present in neolignans, pterocarpans, and synthetic drugs used in the treatment of pulmonary hypertension, atherosclerotic peripheral arterial disease, and central nervous system trauma and ischemia. Owing to the importance of their structures, numerous synthetic methods for 2,3-dihydrobenzofurans have been developed, primarily: radical cyclizations, Lewis acid promoted reactions, anionic cyclizations, and transition-metal catalyzed processes. However, these methods cannot be generalized as much as is desirable, and they yielded poor chemo- and/or stereoselectivities. Hence, the development of an efficient enantioselective synthetic method for obtaining 2,3-dihydrobenzofuran scaffolds attracted our attention

  14. One-pot cascade michael.cyclization reactions of ο-hydroxycinnamaldehydes: Synthesis of functionalized 2,3-dihydrobenzofuranes

    Energy Technology Data Exchange (ETDEWEB)

    Gwon, Sung Hyuk; Kim, Sunggon [Kyonggi Univ., Suwon (Korea, Republic of)

    2012-04-15

    We described the cascade Michael.cyclization reaction of o-hydroxycinnamaldehydes with diethyl α-bromomalonate promoted by potassium carbonate. The reactions provided functionalized 2,3-dihydrobenzofurans in good yields for a variety of o-hydroxyaromatic α,β-unsaturated aldehydes. Current work focuses on expanding the scope of this reaction to other substrates such as sulfur yields, and on developing an efficient catalytic asymmetric variant. 2,3-Dihydrobenzofurans are found in numerous biologically active natural products and synthetic compounds. These are an attractive type of oxygenated compound because their basic core skeleton is present in neolignans, pterocarpans, and synthetic drugs used in the treatment of pulmonary hypertension, atherosclerotic peripheral arterial disease, and central nervous system trauma and ischemia. Owing to the importance of their structures, numerous synthetic methods for 2,3-dihydrobenzofurans have been developed, primarily: radical cyclizations, Lewis acid promoted reactions, anionic cyclizations, and transition-metal catalyzed processes. However, these methods cannot be generalized as much as is desirable, and they yielded poor chemo- and/or stereoselectivities. Hence, the development of an efficient enantioselective synthetic method for obtaining 2,3-dihydrobenzofuran scaffolds attracted our attention.

  15. Jan Rak and Michael J. Tannenbaum present the book "High-pT physics in the heavy ion era"

    CERN Multimedia

    2013-01-01

    Thursday 13 June 2013 from 4 p.m. to 5 p.m. in the Library, Bldg. 52 1-052 The book provides an overview of the basic concepts of large transverse momentum particle physics, with a focus on pQCD phenomena. It examines high-pT probes of relativistic heavy-ion collisions and will serve as a handbook for those working on RHIC and LHC data analyses. Starting with an introduction and review of the field, the authors look at basic observables and experimental techniques, concentrating on relativistic particle kinematics, before moving onto a discussion about the origins of high-pT physics. The main features of high-pT physics are placed within a historical context and the authors adopt an experimental outlook, highlighting the most important discoveries leading up to the foundation of modern QCD theory. High-pT physics in the heavy ion era, by Jan Rak and Michael J. Tannenbaum,  Cambridge University Press, 2013, ISBN  9780521190299. *Coffee will be served from 3 p.m.*

  16. Michael Jäckel, Julia Derra, Cornelia Eck: SchönheitsAnsichten. Geschlechterbilder in Werbeanzeigen und ihre Bewertung. Baden-Baden: Nomos Verlag 2009.

    Directory of Open Access Journals (Sweden)

    Waltraud Posch

    2010-11-01

    Full Text Available Michael Jäckel, Julia Derra, and Cornelia Eck’s cross-generational study answers the question as to which concepts of beauty are presented in magazine advertisements and how recipients react to these concepts. The book provides an important basis for Media Studies and Gender Sociology particularly because it also shows medial constructions of gender that are initially invisible and because it shows gender related illustrations of physicality and beauty.In einer generationenübergreifenden Studie gehen Michael Jäckel, Julia Derra und Cornelia Eck der Frage nach, welche Schönheitsbilder in der Zeitschriftenwerbung präsentiert und wie diese von Rezipient/-innen aufgenommen werden. Das Buch liefert eine wichtige Basis für Medienforschung und Soziologie der Geschlechter, zumal es auch vordergründig nicht sichtbare mediale Konstruktionen von Geschlecht und die geschlechtsbezogene Darstellung von Körperlichkeit und Schönheit aufzeigt.

  17. El pluralismo y la desigualdad educativa en México. La teoría de la justicia de Michael Walzer

    OpenAIRE

    Aguilar-Sahagún, Luis A.

    2003-01-01

    El presente estudio intenta ofrecer elementos de una teoría sobre la justicia que ilumine los graves problemas de la desigualdad educativa en México. Se trata de la propuesta del filósofo estadunidense Michael Walzer, quien con su obra "Esferas de la justicia. Defensas del pluralismo y la igualdad" ha abierto un horizonte que ha fecundado la discusión sobre este concepto en el contexto del llamado debate liberalismo- comunitarismo.

  18. Evaluation Strategy Michael Porter's five forces model of the competitive environment on the dairy industry (Case Study: Amoll Haraz Dvshh dairy company)

    OpenAIRE

    Mohammad Bolorian Tehrani; Faezeh Rahmani

    2016-01-01

    State of competition in an industry depends on five basic forces. Porter's five forces model including bargaining power of customers, bargaining power of suppliers, threat of newcomers to the industry, threat of substitute products is the intensity of rivalry between competitors. Joint strength of these forces determines the ultimate benefit of potentially any industry. The purpose of this study was to evaluate the competitive environment of the dairy industry based on Michael Por...

  19. Enantioselective organocatalyzed Oxa-Michael-Aldol cascade reactions: Construction of chiral 4H-chromenes with a trifluoromethylated tetrasubstituted carbon stereocenter

    KAUST Repository

    Zhang, Jing

    2015-03-13

    The first organocatalytic asymmetric synthesis of 4H-chromenes bearing a trifluoromethylated tetrasubstituted carbon center is presented. Chiral secondary amines promote the oxa-Michael-aldol cascade reaction between alkynals and 2-trifluoroacetylphenols via iminium-allenamine activation to produce pharmaceutically important heterocycles with excellent enantioselectivities. The proposed reaction can be scaled-up easily with maintenance of the excellent enantioselectivity. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Beyond the center: Sciences in Central and Eastern Europe and their histories. An interview with professor Michael Jordan conducted by Jan Surman

    Directory of Open Access Journals (Sweden)

    Michael Gordin

    2016-11-01

    Full Text Available What is special about sciences in Central and Eastern Europe? What are the obstacles for writing histories of science done beyond metropoles? Is this science different than the science in the centers and what makes it so? How imperial are sciences made by representatives of dominant nations compared to non-dominant nations? These are some of the questions touched upon in the interview with Michael Gordin, a leading historian of science from Princeton University.

  1. Aza-Peptidyl Michael Acceptor and Epoxide Inhibitors—Potent and Selective Inhibitors of Schistosoma mansoni and Ixodes ricinus Legumains (Asparaginyl Endopeptidases)

    Czech Academy of Sciences Publication Activity Database

    Ovat, A.; Muindi, F.; Fagan, C.; Brouner, M.; Hansell, E.; Dvořák, J.; Sojka, Daniel; Kopáček, Petr; McKerrow, J. H.; Caffrey, C. R.; Powers, J. C.

    2009-01-01

    Roč. 52, č. 22 (2009), s. 7192-7210 ISSN 0022-2623 R&D Projects: GA ČR GA206/06/0865; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : legumain * IrAE * aza-peptide Michael acceptors Subject RIV: EC - Immunology Impact factor: 4.802, year: 2009

  2. A small stone column of the altar screen from the treasures of St Archangel Michael's monastery in Prevlaka

    Directory of Open Access Journals (Sweden)

    Crnčević Dejan

    2013-01-01

    Full Text Available Amongst exhibited fragments of carved stone decorations in the monastery of St Archangel Michael in Prevlaka, Boka Kotorska, situated on the ground floor of the monastery's accommodation quarters, there is a segment of stone liturgical furnishings which is, among other things, distinguished by its monumental dimensions, the high level of its craftsmanship, and the important artistic value of its carved decorations. This small stone column was found by chance as a surface-level find on the neighbouring island of St Gavrilo. This stone column is made from a monolithic piece of high- quality, light-grey marble. It is 96 cm in height, 20 cm wide at the front, 18.5 cm wide at the side, and 13cm wide at the rear. These dimensions indicate that the fragment has the form of an elongated hexahedron, with sides of unequal width. Only the front of this stone fragment is marked with relief decorations, comprising a regularly shaped two-part curled sprouting vine. Moving with its undulating rhythm, its arc defines a space in which is located the central motif of the decoration. This comprises the motif of a bud in the form of stylised crinoline flower, composed of two lateral leaves with a pronounced bulge in the middle. These tightly bent lateral leaves with sharp ends, together with the root of the formed shoot, leave an empty space filled with an offshoot in the form of a regularly formed volute. The left lateral side of the stone column is marked by a long but relatively shallow channel, created around its axis, with a width of 7.5 cm. Its rear side is divided by its own height into two vertical fields, of almost the same width - 6 and 7 cm respectively - one slightly elevated compared to the other. The right lateral side of the column is slanted and only lightly sculptured. On the upper surface of the pillar, a relatively shallow circular hole with a small span is visible, intended as a connection point for other segments that would have been placed on

  3. 1980 Annual status report: super-SARA

    International Nuclear Information System (INIS)

    1981-01-01

    The essential tasks of the JRC for the SUPERSARA project during 1980 were therefore twofold: 1. Actuation of an international Task Force with which to: a. discuss in depth the test objectives and the relationships between the SSTP and the world mosaic of activities in the field of LWR fuel behaviour; b. establish a consensus test matrix; c. identify and discuss the major technological problems affecting the feasibility of attaining the consensus test objectives, especially for the boil-down SFD tests. A Task Force with these objectives was necessary in order to provide the elements for a Council decision on phase II. 2. Conservation of the rythm of the main contractor (UKAEA-Harwell) and subcontractors for the timely fabrication of loop components and the timely design of those new aspects of the plant necessary for the boil-down SFD tests

  4. Delayed entry into first marriage and marital stability: Further evidence on the Becker-Landes-Michael hypothesis

    Directory of Open Access Journals (Sweden)

    Evelyn Lehrer

    2013-09-01

    Full Text Available BACKGROUND In their pioneering research, Becker, Landes, and Michael (1977 found that beyond age 30 there is a positive relationship between women's age at first marriage and marital instability. They interpreted this finding as a "poor-match effect" emerging when the biological clock begins to tick. OBJECTIVE Our objective was to ascertain with more recent data whether or not there is evidence of a poor match effect and if so, whether it is associated with higher marital instability. METHODS We used data on non-Hispanic white women from the 2006-2010 National Surveys of Family Growth (NSFG (N = 3,184. RESULTS We found evidence of the existence of a poor-match effect: women who delay marriage disproportionately make unconventional matches, which are generally associated with high marital instability. We also found, however, that their unions are very solid. Both of these results were consistent with earlier findings for the 1995 and 2002-2003 NSFG cycles. In attempting to explain this puzzle, we proposed and tested competing hypotheses. We found that the destabilizing effects associated with indicators of unconventional matches are also present in marriages contracted late, but are dwarfed by the stabilizing influences associated with higher levels of education and older ages. CONCLUSIONS This paper contributes to our understanding of the determinants of marital instability and the poor match effect by providing a new interpretation for the puzzle described above. COMMENTS Our findings have implications for analyses of changes over time in the extent of positive assortative mating in the marriage market, and for the extensive literature showing that heterogamy in traits that are complementary in the context of marriage is destabilizing -- heterogamous marriages contracted at a late age are likely to be stable.

  5. Michael F. Crowley | NREL

    Science.gov (United States)

    Pittsburgh Supercomputing Center, and at The Scripps Research Institute with David Case and Charles Brooks NIH-funded collaboration with Professor Charles L. Brooks III at the University of Michigan Areas of to determine source of twisting in hydrogen bonding patterns. This modeling will help to understand

  6. INTERVIEW WITH MICHAEL WELKER

    African Journals Online (AJOL)

    basic level, you argued that at least two elements are necessary for an utterance to be ... Henco: In light of the question above, how would you describe what you ... books. A broad biblical orientation, the appreciation of the divine Law (with.

  7. Michael Bahl | NREL

    Science.gov (United States)

    theoretical mathematics, Western New England University, Springfield, MA B.S. in computer science, University Prior Work Experience Founder, Mobile Makes Sense Senior IT Specialist, IBM Graduate Teaching Assistant

  8. Michael's Inside Scoop: Genetics

    Science.gov (United States)

    ... Snow, the First Epidemiologist Microbe Multiplication Magic Scientific Poster Session Poisoned Picnic The Energy Equation Flu Season- ... pieces of advice: 1. Follow the basics of good health. You know ’em. Eat healthy , Get plenty ...

  9. Linnade klubi / Michael Bloomberg

    Index Scriptorium Estoniae

    Bloomberg, Michael

    2007-01-01

    New Yorgi linnapea räägib vajadusest suurendada linnadevahelist koostööd. Sündimas on uus globaalne urbanistlik kogukond, milles linnad teevad üksteisega koostööd ühesuguste probleemide kallal, võisteldes samal ajal omavahel globaalsel turul

  10. Michael Seibert | NREL

    Science.gov (United States)

    . Chair, Alcohol Sources and Uses Session, International Solar Energy Society Meeting, 1981. Member Apparatus for Rapid Biohydrogen Phenotypic Screening of Microorganisms Using a Chemochromic Sensor," Biohydrogen Phenotypic Screening of Microorganisms Using a Chemochromic Sensor," U.S. Patent # 6,448,068

  11. Michael York, Pagan Theology

    Directory of Open Access Journals (Sweden)

    Terry GIFFORD

    2004-10-01

    Full Text Available For Christian missionaries the word ‘pagan’ was a pejorative that implied ‘primitive’, either in the sense of devil worship or barren atheism. From this tradition the word has been associated with either the worship of the wrong gods immanent in the natural environment, or of a godless superstition relating to the spirits alive in nature. Of course, Christianity has been adept at incorporating a diversity of pagan beliefs, occasions and rituals into its colonising practice throughout the worl...

  12. Tiheduse kurvid / Michael Sorkin

    Index Scriptorium Estoniae

    Sorkin, Michael

    2007-01-01

    Autor toob välja linnade kasvu mõju maa ökoloogiale. Tema sõnul on demokraatliku linna jaoks kriitiline tihedus linlike vormide ning käitumisviiside tihke kogum ning just tiheduses on vastus jätkusuutlikuks edasi elamiseks meie planeedil

  13. Michael Resch | NREL

    Science.gov (United States)

    applications along with analytical chemistry expertise. From October 2016 to September 2017, Dr. Resch was on Stover Lignin," ACS Sustainable Chemistry and Engineering (2016) "Interrelationships Between ) "Lignin Depolymerization by Fungal Secretomes and a Microbial Sink," Green Chemistry (2016

  14. [Michael Servetus: symphony in ].

    Science.gov (United States)

    Gracia Guillén, Diego

    2004-01-01

    On October 27th 1553, the physician and religious reformer Miguel Servet was burnt at stake. The 450th anniversary of his death took place, therefore, a few months ago. This is a fact which deserves being taken into account, not only because of the importance of the individual, but also, and mainly, because during the last years some important historiographical advances have changed the traditional approach, giving place to a new and more accurate analysis to his life and work. The topic image of Servet spread by the Spanish historiography of the 19th and most of the 20th Centuries has been that of a scientific genius, discoverer of the pulmonary circulation of blood, but also that of a crazy theologian with absurd ideas about some basic Christian dogmas, specially the Holy Trinity. This image is now considered absolutely misleading. The historiography of the complex religious movements of the 16th Century has shown that Servet, far from being a crazy theologian absolutely disconnected of the religious movements of the Century, was instead one of the leaders of an important Christian movement which G. H. Williams called He consecrated all his life to this goal, which also was the reason of his death, always showing an absolute and admirable intellectual and human coherence. To these goals he subdued any other objective, as well as the study and the exercise of medicine. This gives the basis to correctly understand the fact, never explained convincingly until now, why his great scientific discovery, the pulmonary circulation of blood, appeared as a minimal part in the heart of a theological book.

  15. Tim Burton lavastab Batmani muusikali. Placido Domingo palkas "Star Warsi" võluri. MTV muusikaauhindade show'l narriti Michael Jacksonit. Hendrixi põlenud kitarr läheb müüki

    Index Scriptorium Estoniae

    2002-01-01

    Jim Steinman kirjutab muusikat Tim Burtoni 2005. aastal lavale tulevale Batmani muusikalile. Los Angelese ooperimaja juht Domingo palkas George Lucase Wagneri ooperi "Nibelungide sõrmus" eriefektide ettevalmistamiseks. Britney Spears nimetas Michael Jacksonit Millenniumi artistiks.

  16. Revisitando a Teoria da Guerra Justa: uma análise das propostas de Michael Walzer e Jeff McMahan

    OpenAIRE

    Cruz, Sara Vieira

    2015-01-01

    Dissertação de mestrado em Filosofia Política O propósito desta dissertação é fornecer uma compreensão panorâmica das principais questões morais suscitadas pela guerra, com uma ênfase especial na guerra moderna e no debate académico contemporâneo. Partindo da visão tradicional da Teoria da Guerra Justa defendida por Michael Walzer, focamo-nos essencialmente na tensão existente entre este teórico e o seu principal oponente, Jeff McMahan. Em causa está a sustentabilidade do pa...

  17. Mandibular angle augmentation with the use of distraction and homologous lyophilized cartilage in a case of morphing to Michael Jackson surgery.

    Science.gov (United States)

    Mommaerts, M Y; Abeloos, J S; Gropp, H

    2001-08-01

    Correction of an ill-defined mandibular angle is not an easy task, whether it is requested by the "congenital, orthognathic or cosmetic" patient. Deliberate over-correction has not been reported to our knowledge. This article presents a combination of distraction osteogenesis and lyophilized cartilage used to three-dimensionally over-augment the mandibular angle of a long-face prognathic patient who had the wish to be morphed to Michael Jackson or at least as far as current technique and his endogenic features allowed.

  18. Analysis of Media Stereotypes of the Russian Image in Media Studies in the Student Audience (example: the screen versions of Jules Verne's Novel “Michael Strogoff”

    Directory of Open Access Journals (Sweden)

    Alexander Fedorov

    2014-09-01

    Full Text Available As a result of the analysis students come to the conclusion that the screen adaptations of Jules Verne's novel ''Michael Strogoff'' create, though an oversimplified and adapted to western stereotypes of perception, but a positive image of Russia – as a stronghold of European values at the Asian frontiers, a country with a severe climate, boundless Siberian spacious areas, manly and patriotic warriors, a wise monarchy. At the same time, both Jules Verne's novel and its screen adaptations contain clear-cut western pragmatism – the confidence that if a man has a proper will he can rule his destiny.

  19. The economic role of the Emergency Department in the health care continuum: applying Michael Porter's five forces model to Emergency Medicine.

    Science.gov (United States)

    Pines, Jesse M

    2006-05-01

    Emergency Medicine plays a vital role in the health care continuum in the United States. Michael Porters' five forces model of industry analysis provides an insight into the economics of emergency care by showing how the forces of supplier power, buyer power, threat of substitution, barriers to entry, and internal rivalry affect Emergency Medicine. Illustrating these relationships provides a view into the complexities of the emergency care industry and offers opportunities for Emergency Departments, groups of physicians, and the individual emergency physician to maximize the relationship with other market players.

  20. Rezension von: Brigitte Aulenbacher, Michael Meuser, Birgit Riegraf: Soziologische Geschlechterforschung. Eine Einführung. Wiesbaden: VS Verlag für Sozialwissenschaften 2010.

    Directory of Open Access Journals (Sweden)

    Heike Kahlert

    2011-01-01

    Full Text Available Das Lehrbuch von Brigitte Aulenbacher, Birgit Riegraf und Michael Meuser zielt darauf, wichtige Entwicklungen und Etappen der soziologischen Geschlechterforschung zu rekonstruieren, Forschungsfelder zu beschreiben, Anschlüsse an angrenzende Bereiche aufzuzeigen und zukünftige Fragen zu skizzieren. Dieser hoch gesteckte Anspruch gelingt weitgehend, wobei notwendig Akzente gesetzt und zwangsläufig Leerstellen in Kauf genommen werden. Offen bleibt in der intendierten zeit- und wissenschaftsgeschichtlichen Orientierung der Darstellung aber leider, was genau das Soziologische an der Geschlechterforschung ist und wie sich die Geschlechterforschung in Bezug auf ihre Wurzeln in der Soziologie positionieren könnte und sollte.

  1. LOS DESAFÍOS DEL DISCURSO DE LA ESTRATEGIA EN LAS ORGANIZACIONES: UNA MIRADA SOBRE LA POSICIÓN DE LA ESTRATEGIA COMPETITIVA DE MICHAEL PORTER

    OpenAIRE

    Neyda Ibáñez; Ruben Castillo; Alfredo Núñez

    2010-01-01

    El propósito se centró en interpretar los desafíos del discurso de la estrategia en las organizaciones, tomando como principal exponente a la Estrategia competitiva de Michael Porter. Para ello, se abordó desde el paradigma interpretativo, con un enfoque cualitativo, usando el método hermenéutico en un contexto teórico enunciativo, documental. Se concluye que los desafíos del discurso de la estrategia en las organizaciones, dependerán de la creatividad, productividad y la capacidad de poder c...

  2. LOS DESAFÍOS DEL DISCURSO DE LA ESTRATEGIA EN LAS ORGANIZACIONES: UNA MIRADA SOBRE LA POSICIÓN DE LA ESTRATEGIA COMPETITIVA DE MICHAEL PORTER

    Directory of Open Access Journals (Sweden)

    Neyda Ibáñez

    2010-04-01

    Full Text Available El propósito se centró en interpretar los desafíos del discurso de la estrategia en las organizaciones, tomando como principal exponente a la Estrategia competitiva de Michael Porter. Para ello, se abordó desde el paradigma interpretativo, con un enfoque cualitativo, usando el método hermenéutico en un contexto teórico enunciativo, documental. Se concluye que los desafíos del discurso de la estrategia en las organizaciones, dependerán de la creatividad, productividad y la capacidad de poder crear conocimiento, ideas y manejar la información.

  3. Aza-peptidyl Michael acceptors. A new class of potent and selective inhibitors of asparaginyl endopeptidases (legumains) from evolutionarily diverse pathogens

    Czech Academy of Sciences Publication Activity Database

    Götz, M. G.; James, K. E.; Hansell, E.; Dvořák, J.; Seshaadri, A.; Sojka, Daniel; Kopáček, Petr; McKerrow, J. H.; Caffrey, C. R.; Powers, J. C.

    2008-01-01

    Roč. 51, č. 9 (2008), s. 2816-2832 ISSN 0022-2623 R&D Projects: GA MŠk(CZ) LC06009; GA ČR GA206/06/0865 Grant - others:The National Institute of Allergy and Infectious Diseases(US) AI053247; National Institute of General Medical Sciences(US) GM54404; National Institute of General Medical Sciences(US) GM61964 Institutional research plan: CEZ:AV0Z60220518 Keywords : legumain * IrAE * aza-peptide Michael acceptors Subject RIV: ED - Physiology Impact factor: 4.898, year: 2008

  4. Multicomponent Synthesis of Isoindolinone Frameworks via RhIII -Catalysed in situ Directing Group-Assisted Tandem Oxidative Olefination/Michael Addition.

    Science.gov (United States)

    Wang, Liang; Liu, Xi; Liu, Jian-Biao; Shen, Jun; Chen, Qun; He, Ming-Yang

    2018-04-04

    A Rh III -catalysed three-component synthesis of isoindolinone frameworks via direct assembly of benzoyl chlorides, o-aminophenols and activated alkenes has been developed. The process involves in situ generation of o-aminophenol (OAP)-based bidentate directing group (DG), Rh III -catalysed tandem ortho C-H olefination and subsequent cyclization via aza-Michael addition. This protocol exhibits good chemoselectivity and functional group tolerance. Computational studies showed that the presence of hydroxyl group on the N-aryl ring could enhance the chemoselectivity of the reaction. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Nano-organocatalyst: magnetically retrievable ferrite-anchored glutathione for microwave-assisted Paal–Knorr reaction, aza-Michael addition, and pyrazole synthesis

    KAUST Repository

    Polshettiwar, Vivek; Varma, Rajender S.

    2010-01-01

    Postsynthetic Surface modification of magnetic nanoparticles by glutathione imparts desirable chemical functionality and enables the generation of catalytic sites on the surfaces of ensuing organocatalysts. In this article, we discuss the developments, unique activity, and high selectivity of nano-organocatalysts for microwave-assisted Paal-Knorr reaction, aza-Michael addition, and pyrazole synthesis. Their insoluble character Coupled with paramagnetic nature enables easy separation of these nano-catalysts from the reaction mixture using external magnet, which eliminates the requirement of catalyst filtration. Published by Elsevier Ltd.

  6. Stereoselective synthesis of 5-alkoxycarbonyl-4 alkyl-2-anino-3-cyano-6-methyl-4H-pyranes 3 via asymmetric Michael addition to aceptors-gamma-stereogenics; Sintesis esteroselective de 5-alcoxicarbonil-4-alquil-2-amino-3-ciano-6-metil-4H-piranos via adicion Michael sobre aceptores-gama-esterogenicos

    Energy Technology Data Exchange (ETDEWEB)

    Martinez-Grau, A.; Jimenez, B.; Martin, N.; Seoane, C.; Marco, J.L. [Departamento de Quimica Organica, Facultad de Quimica, Universidad Complutense, Madrid (Spain)

    1994-12-31

    The stereoselective synthesis of 5-alkoxycarbonyl-4-alkyl-2-amino-3-cyano-6-methyl-4H-pyrans 3 via asymmetric Michael addition of malononitrile to gamma-stereogenic alpha-acetylacrylates 2 obtained by Knoevenagel reaction of acetylacetates to quiral alpha-hydroxyaldehydes 1 is described. The resulting 2-amino-4H-pyrans 3 have been obtained in moderate yield and good diastereoselectivity. 15 refs.

  7. 77 FR 44310 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2012-07-27

    ... JACINTA YEUNG CHEONG CHANG MICHAEL YIO-HOW CHENG NICOLAS VINCENT CHI TELLY TAI HSUAN CHINOY SAMIR MUSTAPHA... TONJA YVONNE SU JIN CHIN SU XIAOBO SARA SHAO SUEN SAMSON C. L. SY KEVIN NEIL TAN LAI HING THARALDSEN...

  8. Ergenlik Dönemi Okuma Tutumu Ölçeği’nin Türkçe’ye Uyarlanması The Adaptasyon Of Survey Of Adolescent Reading Attitudes (Sara Into Turkish

    Directory of Open Access Journals (Sweden)

    Muhammet BAŞTUĞ

    2013-07-01

    Full Text Available The aim of this study is to adapt the Survey of Adolescent Reading Attitudes SARA to Turkish, which was developed by McKenna, Conradi, Lawrance, Jang, and Meyer (2012, and to test it for validity and reliability. The rationale is that the scale involves one’s attitude towards digital reading. The sample was comprised of 702 sixth,seventh and eighth grade students in Konya- 343 of them being femaleand the remaining 359 being male. The original scale had 18 items infour sub-dimensions, namely academic reading in digital settings (AD,recreational reading in digital settings (RD, academic reading in printsettings (AP and recreational reading in print settings (RP. Theexploratory factor analysis and confirmatory factor analysis revealedthat the four original sub-dimensions were retained when two itemswere omitted. Cronbach’s alpha coefficients were 0.691, 0.802, 0.690,0.660 and 0.623 for the overall scale, RD, RP, AP and AD respectively.The results suggest that the adapted scale is reliable and valid. The 15-item finalized version is appropriate for the Turkish language and use inTurkey. In the development of reading environments and materials,identification of students’ attitudes toward reading in a multidimensionalway is expected to make great contributions to morequalified learning environments. Bu araştırmanın amacı, McKenna, Conradi, Lawrence, Jang ve Meyer (2012 tarafından geliştirilen Ergenlik Dönemi Okuma Tutumu Ölçeği’nin geçerlik ve güvenirliğinin yapılarak Türkçe’ye uyarlanmasıdır. Ölçeğin dijital okumaya karşı tutumu da kapsaması sebebiyle uyarlama çalışmasının uygun olacağı düşünülmüştür. Çalışma grubunu Konya ilinde yer alan ve 6,7 ve 8. Sınıflara devam eden 343’ü kız, 359’u erkek toplam 702 öğrenci oluşturmuştur. Ölçeğin orjinali 18 maddeden ve “Akademik Dijital, Serbest Dijital, Akademik Kağıt ve Serbest Kağıt” olmak üzere 4 alt boyuttan olu

  9. Hvordan gør vi tingene her? – et Michael Eraut-inspireret fokus på sygeplejestuderendes første kliniske undervisningsforløb

    DEFF Research Database (Denmark)

    Jensen, Carsten Juul

    2014-01-01

    socializing into the hierarchy of the clinic, toward the progression from being a novice to becoming an advanced beginner, overcoming overwhelming experiences. A socialization supported by newly educated nurses who can still express their practice, or supported by their private relations. When the new nursing......This paper is part of a longitudinal development project. We try to comprehend the learning experience of nursing students during their first clinical study course, aiming to identify how and what nursing students learn to qualify the support of clinical supervisors and educators. The methology...... of the project is qualitative, inspired by the thoughts of Michael Eraut on workplace learning. Seen from the workplace perspective, learning seems to be oriented toward the situations facing the students, rather than toward fabricated study methods. The learning of nursing students seems to be oriented toward...

  10. La théorie sémiotique littéraire de Michael Riffaterre : matrice, intertexte et interprétant

    Directory of Open Access Journals (Sweden)

    John Hopkins

    2005-04-01

    Full Text Available Cette communication présentée lors d’un séminaire du CNA, présente une vision de la théorie littéraire de Michael Riffaterre et propose d’en compléter la portée par un apport théorique nouveau. La dernière partie examine les rapports de la théorie riffaterrienne avec le roman. Sémiotique, poésie, matrice, structure bimatricielle, Riffaterre, Baudelaire. Puisque je parle aux confins du Centre de Narratologie Appliquée, où l’on s’intéresse principalement aux questions de la structure et de...

  11. IUTAM Symposium on Innovative Numerical Approaches for Materials and Structures in Multi-Field and Multi-Scale Problems : in Honor of Michael Ortiz's 60th Birthday

    CERN Document Server

    Pandolfi, Anna

    2016-01-01

    This book provides readers with a detailed insight into diverse and exciting recent developments in computational solid mechanics, documenting new perspectives and horizons. The topics addressed cover a wide range of current research, from computational materials modeling, including crystal plasticity, micro-structured materials, and biomaterials, to multi-scale simulations of multi-physics phenomena. Particular emphasis is placed on pioneering discretization methods for the solution of coupled non-linear problems at different length scales. The book, written by leading experts, reflects the remarkable advances that have been made in the field over the past decade and more, largely due to the development of a sound mathematical background and efficient computational strategies. The contents build upon the 2014 IUTAM symposium celebrating the 60th birthday of Professor Michael Ortiz, to whom this book is dedicated. His work has long been recognized as pioneering and is a continuing source of inspiration for ma...

  12. A representação discursiva do ator social Michael Jackson e de sua morte em gêneros da esfera jornalística

    Directory of Open Access Journals (Sweden)

    Maria Aparecida Resende Ottoni

    2014-05-01

    Full Text Available Neste artigo, investigamos como se dá a representação discursiva de um mesmo fato e do principal ator social nele envolvido, em diferentes gêneros distintos, a saber: reportagem; notícia; editorial; artigo de opinião; e carta do leitor. Nosso intuito é perquirir se há diferenças nas escolhas para representação de um mesmo fato e no modo como o ator social principal é representado nesses gêneros,bem como quais as razões e efeitos dessas diferenças. Nesse sentido, selecionamos textos que tratam da morte de Michael Jackson, os quais são analisados com base nos pressupostos da Análise de Discurso Crítica e na proposta de van Leeuwen (1997 para o estudo da representação de atores sociais. A análise revelou que, em todos os gêneros, a representação de modo ativo, pessoal e por classificação específica é dominante e que, nos gêneros que representam os núcleos jornalista e empresa predomina a nomeação e, nos que retratam os núcleos colaborador e leitor, a classificação. Prevalece, ainda, a classificação por valoração, o que colabora, sobremaneira, para a produção de uma mescla na representação do ator social Michael Jackson. Essa mescla também é marcada por meio da intertextualidade manifesta.

  13. Examination and comparative study of the Ascension of The Prophet of Islam In The View Of Michael Sells And Anne-mari e Shamil with Inter- Religious Attitude

    Directory of Open Access Journals (Sweden)

    Mahdi Azadi

    2015-09-01

    Full Text Available Michael Sells, American scholar of Quran,about the Ascension (Mi,raj of the prophet (PBUH focuses on three issues: First, the Mi,raj term is not used in the Quran and the ascension of the explanation is not enough. second, Mohammad is no different from the miracle of the Quran is the miracle of God,he is not anything else, Quran states. Third, Ascension of the prophet (PBUH has been in sleep and dream.According to him, the discussion about the layers of the subject is based mainly on the evidence of Quran.In this case, only limited information can be found in the Asra chapter (sooreh of the Quran.In addition, he has tried to make the Ascension event from Jewish traditions and the effects Bvdaysm.actually the orientalist`s goal is to prove the absence of ascension of the prophet(PBUH.  In contrast, Anne-marie Shamil stayes that prophet`s ascension derived from the first verse of Asra sura and believes that two processes(horizontal and verticalfor prophet happened.and unlike Michael,he knows mi,raj from the God miracles.Anne-Marie because her sufficient the Sunni sources is doubt with belief in the physical and spiritual ascension,in some of her votes,such as; visible or not visible in the ascension of God by the prophet.Despite the fundamental criticism that some elements of the theory of two Orientalists arrived,positive points are observed in their ideas.in this article we have tried to express the views of the Orientalists, then to review their ideas considered

  14. New 'Master of Science in Nuclear Engineering' study course launched. Interview with Professor Horst-Michael Prasser; Neuer Studiengang 'Master of Science in Nuclear Engineering' lanciert. Interview mit Professor Horst-Michael Prasser

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2008-02-15

    In the fall of 2008, the Zurich Technical University (ETH) and the Lausanne EPF will launch their joint master course of studies in Nuclear Engineering. Horst-Michael Prasser, Professor for Nuclear Energy Systems at Zurich ETH, is responsible for designing the course. In this interview he comments, among other things, on fundamental questions which may determine a future student's choice of a course of studies, and on the special opportunities offered by the new Nuclear Engineering course. Other subjects addressed include the renaissance of nuclear power and the future prospects of safety research and new reactor developments. (orig.)

  15. Beyond cyborg metapathography in Michael Chorost’s Rebuilt to World Wide Mind: Introducing “morphos” as a rhetorical concept in cyborgography

    Directory of Open Access Journals (Sweden)

    Kevin A. Thayer

    2013-08-01

    Full Text Available This essay introduces the rhetorical concept of “morphos”, a dimension of ethos, in the context of cyborg self-transformation and cyborg storytelling. Focusing on the cyborg storytelling of Michael Chorost, a cochlear implant user and futurist, this essay applies "morphos" to develop an argument about the changing capabilities and changing stories of living cyborg authors. Using rhetorical concepts to illuminate his self-transformation and narrative constructions, this essay analyzes Chorost’s two books: Rebuilt: How Becoming Part Computer Made Me More Human; and, World Wide Mind: The Coming Integration of Humanity, Machines, and the Internet. Chorost’s first book, Rebuilt, is an autobiographical account of his journey from deafness to cochlear implant hearing and his quest for community. He completes his journey of self-transformation using Haraway’s Cyborg Manifesto and Caidin’s Cyborg as narrative tools. Rebuilt can be defined as a cyborg metapathography, identifying rhetorical features of Chorost’s cyborg storytelling. Chorost’s second book, World Wide Mind, is both autobiographical and theoretical. This rhetorical shift in the context of his changing physical, perceptual, and cognitive capabilities, and his changing ethos, is significant because it opens the way for a new hybrid language combining the spoken/written and digital code.

  16. ¿Por qué existe el Estado y no más bien la anarquía? (El anarco-comunitarismo de Michael Taylor

    Directory of Open Access Journals (Sweden)

    Rivera, Juan Antonio

    1996-04-01

    Full Text Available Not available.

    Se expone la perspectiva anarco-comunitarísta de Michael Taylor, y se la distingue de la anarco-capitalista de autores como Murray Rothbard, David Friedman o, en menor medida, Robert Nozick. El anarco- comunitarismo de Taylor está sólidamente asentado en la teoría de juegos; concretamente, en los análisis dinámicos del Dilema del Prisionero. Sobre la base de estos análisis, a los que el propio autor ha hecho contribuciones sustanciales, se pone de relieve la inviabilidad práctica de una anarquía perfecta, sin controles sociales externos. Pero Taylor muestra que hay, con todo, lugar para un orden social sostenido en controles informales y ampliamente descentralizados, es decir, fundado en vínculos comunitarios, y que ésta ha sido la solución al problema del orden social durante la mayor parte de la historia de la especie. Se discuten luego las circunstancias que presumiblemente dieron lugar a la crisis y obsolescencia de la solución anarco-comunitarista y su sustitución por la respuesta institucional basada en la presencia del Estado. Se concluye el escrito ensalzando los méritos teóricos de Taylor pero poniendo en duda la validez de los presupuestos valorativos que animan sus modestas proposiciones de cambio social.

  17. CITRA PERUSAHAAN DALAM BERITA KRISIS PERUSAHAAN: Konstruksi Citra Perusahaan Daerah Taman Satwa (PDTS Kebun Binatang Surabaya dalam Teks Berita Kematian Michael di Harian Jawa Pos dan Sindo

    Directory of Open Access Journals (Sweden)

    Theresia Intan Putri Hartiana

    2014-12-01

    Full Text Available Penelitian ini dilakukan untuk melihat bagaimana Harian Jawa Pos dan Sindo membentuk citra Perusahaan Daerah Taman Satwa (PDTS Kebun Binatang Surabaya (KBS dikonstruksikan dalam berita krisis kematian Michael. Metode yang digunakan dalam penelitian ini adalah framing Entman dengan merujuk pada pemberian definisi, penelasan, evaluasi, dan rekomendasi acana untuk melihat penekanan pada kerangka berpikir terhadap peristiwa yang dicanangkan. Citra PDTS KBS dalam Harian Jawa Pos memperlihatkan adanya kondisi Kebun Binatang Surabaya sudah tidak layak bagi satwanya dan kesengajaan keterlibatan orang dalam menjadi penyebab kematian Singa KBS mati tergantung. Citra PDTS KBS oleh Koran Sindo ditampilkan sebagai pihak yang harus bertanggungjawab atas kelalaian dan kecerobohannya dalam memelihara satwa sehingga mengakibatkan terjadi kematian satwa yang tidak wajar. Hal tersebut terlihat dari analisis makrostruktur teks yang memaparkan bahwa kepolisian dilibatkan untuk menyelidiki singa yang mati tergantung akibat kelalaian PDTS KBS dalam pengelolaan satwa. Pemberitaan yang dimunculkan oleh media massa patut menjadi perhatian oleh praktisi Public Relations. Berita yang dikonstruksi negatif secara terus menerus dapat memberikan pengaruh negatif pula di dalam benak pembaca. Beberapa pernyataan negatif yang muncul dalam teks pemberitaan dapat dijadikan sebagai dasar perencanaan bagi humas PDTS KBS dalam penanganan krisis dan perbaikan citra setelah krisis.

  18. Building the "fable hospital"--the CEO's perspective: an interview with Michael H. Covert, president and chief executive officer, Palomar Pomerado Health. Interview by David A Tam.

    Science.gov (United States)

    Covert, Michael

    2012-01-01

    Hospital construction is a significant event in any health system. The financial implications are great, especially at a time of shrinking capital resources. Personnel are affected, as are the processes to perform their tasks. Often, new facilities are catalysts that change organizational culture; it has been clearly shown that new facilities have a positive impact on patient satisfaction scores. The members of the C-suite of a hospital/health system play important roles in construction projects. However, no one is more critical to the success of such major endeavors than the chief executive officer (CEO). The CEO sets the tone for the project, giving direction to the design and construction process that may have implications for the rest of the organization. Palomar Pomerado Health (PPH) is the largest public health district in California. In 2002, the PPH governing board authorized the creation of a new facility master plan for the district, which included the construction of a replacement facility for its tertiary care trauma center. The new Palomar Medical Center is slated to open in August 2012. HERD had the opportunity to speak with PPH CEO Michael H. Covert on the role of the CEO in the building of this "fable hospital".

  19. Molecular Characterization of Thiols in Fossil Fuels by Michael Addition Reaction Derivatization and Electrospray Ionization Fourier Transform Ion Cyclotron Resonance Mass Spectrometry.

    Science.gov (United States)

    Wang, Meng; Zhao, Suoqi; Liu, Xuxia; Shi, Quan

    2016-10-04

    Thiols widely occur in sediments and fossil fuels. However, the molecular composition of these compounds is unclear due to the lack of appropriate analytical methods. In this work, a characterization method for thiols in fossil fuels was developed on the basis of Michael addition reaction derivatization followed by electrospray ionization Fourier transform ion cyclotron resonance mass spectrometry (ESI FT-ICR MS). Model thiol compound studies showed that thiols were selectively reacted with phenylvinylsulfone and transformed to sulfones with greater than 98% conversions. This method was applied to a coker naphtha, light and heavy gas oils, and crude oils from various geological sources. The results showed that long alkyl chain thiols are readily present in petroleum, which have up to 30 carbon atoms. Large DBE dispersity of thiols indicates that naphthenic and aromatic thiols are also present in the petroleum. This method is capable of detecting thiol compounds in the part per million range by weight. This method allows characterization of thiols in a complex hydrocarbon matrix, which is complementary to the comprehensive analysis of sulfur compounds in fossil fuels.

  20. A strategy for the generation, characterization and distribution of animal models by The Michael J. Fox Foundation for Parkinson’s Research

    Directory of Open Access Journals (Sweden)

    Marco A. S. Baptista

    2013-11-01

    Full Text Available Progress in Parkinson’s disease (PD research and therapeutic development is hindered by many challenges, including a need for robust preclinical animal models. Limited availability of these tools is due to technical hurdles, patent issues, licensing restrictions and the high costs associated with generating and distributing these animal models. Furthermore, the lack of standardization of phenotypic characterization and use of varying methodologies has made it difficult to compare outcome measures across laboratories. In response, The Michael J. Fox Foundation for Parkinson’s Research (MJFF is directly sponsoring the generation, characterization and distribution of preclinical rodent models, enabling increased access to these crucial tools in order to accelerate PD research. To date, MJFF has initiated and funded the generation of 30 different models, which include transgenic or knockout models of PD-relevant genes such as Park1 (also known as Park4 and SNCA, Park8 (LRRK2, Park7 (DJ-1, Park6 (PINK1, Park2 (Parkin, VPS35, EiF4G1 and GBA. The phenotypic characterization of these animals is performed in a uniform and streamlined manner at independent contract research organizations. Finally, MJFF created a central repository at The Jackson Laboratory (JAX that houses both non-MJFF and MJFF-generated preclinical animal models. Funding from MJFF, which subsidizes the costs involved in transfer, rederivation and colony expansion, has directly resulted in over 2500 rodents being distributed to the PD community for research use.

  1. Michael Haneke. Nostalgia de redención en su “trilogía de la glaciación”

    Directory of Open Access Journals (Sweden)

    Juan Orellana Gutiérrez de Terán

    2015-05-01

    Full Text Available Michael Haneke es considerado como uno de los cineastas europeos más críticos con el desenlace de la sociedad capitalista. En sus tres primeras películas, conocidas como La trilogía de la glaciación, sienta las bases ideológicas de su posterior trayectoria. Detrás de su lectura crítica es posible descubrir una nostalgia de liberación, de redención antropológica y social de fondo. En este artículo se analizan las metáforas del lenguaje fílmico de las tres obras, entendiendo la trilogía como un marco semántico y epistemológico integrado y coherente. En este artículo se concluye que en ellas no sólo se constata el desorden moral y antropológico de la sociedad posmoderna, sino que se apuntan el deseo y la necesidad de una salida en clave reparadora.

  2. Stereoselective synthesis of diazaspiro[5.5]undecane derivatives via base promoted [5+1] double Michael addition of N,N-dimethylbarbituric acid to diaryliedene acetones

    Directory of Open Access Journals (Sweden)

    Mohammad Shahidul Islam

    2017-01-01

    Full Text Available The nitrogen containing spiro-heterocycle is one of the privileged synthetic motif that constitutes various naturally occurring molecules and displays a broad range of pharmaceutical and biological activities. A new methodology was developed for the synthesis of 2,4-diazaspiro[5.5]undecane-1,3,5,9-tetraones spiro-heterocyclic derivatives via cascade cyclization of [5+1] double Michael addition reaction of N,N-dimethylbarbituric acid with the derivatives of diaryldivinylketones in the presence of diethylamine at ambient temperature. The developed protocol is highly capable of furnishing diazaspiro[5.5]undecane derivatives 3a–m in excellent yields (up to 98%, from easily accessible symmetric and non-symmetric divinylketones 2a–m, containing aryl and heteroaryl substituents. The diazaspiro-heterocyclic structure was mainly elucidated by NMR and X-ray crystallographic techniques. The single-crystal X-ray studies revealed that, the cyclohexanone unit of spirocycles often prefers a chair conformation rather than twisted conformation. The intermolecular hydrogen bonding and CArH⋯π, π–π stacking interactions driving forces are mainly responsible for the crystal packing.

  3. Michael Faraday en die letterlike lesing van twee ‘boeke’ van God: 'n Gevallestudie oor verhouding tussen geloof en wetenskap1

    Directory of Open Access Journals (Sweden)

    M. Elaine Botha

    1993-03-01

    Full Text Available The cognitive historical approach to the history of science provides a methodological approach which makes it possible to take into account most of the factors which were constitutive in the formation of scientific meaning in scientific concept formation. In this article this approach is linked with a methodology of metaphorical hermeneutics in order to determine the role played by religious factors in the meaning of scientific concepts. Contrary to traditional approaches in which religious factors are primarily seen as confessional in nature, the term religious is utilized here to identify those absolute presuppositions which fulfil a controlling or regulative function in scientific concept formation and theorizing. 'This approach is applied to a case study of the relationship of faith and science in the work of the nineteenth century British physicist, Michael Faraday. This approach provides an analysis of the change in conceptual structure which the concept of force undergoes in a transition from a mechanistic to a dynamistic metaphysical framework. In this analysis attention is also given to the distinction between confessional religious factors, metaphysical frameworks, meta-scientific principles and theories.

  4. Commonalities and Differences Between Max Weber and Michael Foucault on the Theme of “Rationalization of the Body”(“Bedenin Ussallaşması” Teması Üzerinde Max Weber ve Michael Foucault Arasındaki Yakınsamalar ve Farklılıklar

    Directory of Open Access Journals (Sweden)

    Buğra ÖZER

    2010-01-01

    Full Text Available The main objective of this paper is to elucidate the very nature of ‘the rationalization of the body’ in regard to the convergence and divergences as envisioned in the works of Max Weber and Michael Foucault. While both of the thinkers may be deemed to be important critiques of the modernity process, their insights reveal certain commonalities as the came to deal with the rationalization of the body and individuation of the body along with differences that can be traced back to their roots in their critiques about the modernity project. In such respect, the study emphasizes that rationalization of the body has been a complex process and it italicizes that different dynamics came to redefine the body and individuate the individual along with the continuation of the process.

  5. Evolution of generic competitive strategies and the importance of Michael E. Porter La evolución de las estrategias genéricas de competición y la influencia de Michael E. Porter A evolução das estratégias genéricas de competição e a influência de Michael E. Porter

    Directory of Open Access Journals (Sweden)

    Wilson Weber

    2010-03-01

    Full Text Available Generic competitive strategies are considered almost as archetypes in Business Administration, sometimes leading to over simplification of their concepts as well as underestimation of their importance. Since publication in 1980, as part of Michael E. Porter's book Competitive Strategy, the generic strategies of Differentiation, Leadership in Total Cost and Focus have been used in whole or in part, in various approaches, accelerating dissemination of Porter's work and the subject itself. As a contribution to the development of knowledge about generic strategies, extensive research was carried out comparing the best known proposals such as such as the outpacing strategies (GILBERT; STREBEL, 1987, 1989, the value disciplines (TREACY; WIERSEMA, 1995, and the Delta Project (HAX; WILDE, 2001 among others, while adopting Porter's work (1980 as reference. It becomes evident that this work is not only versatile, as confirmed by use in proposals of other authors, but that it remains up to date, influential and can serve as a basis for conceptual advances of more recent complementary proposals and development of unique strategies by organizations.Las estrategias genéricas de competición son tratadas en Administración casi como arquetipos, lo que, a veces, puede llevar a una simplificación exagerada de sus conceptos y a la subvaloración de su relevancia. Desde su publicación en 1980, como parte del libro Compettitive Strategy, de Michael E. Porter, las estrategias genéricas de Diferenciación, Liderazgo en el Costo Total y Foco han sido utilizadas total o parcialmente en varios abordajes, acelerando la diseminación no sólo de ese trabajo de Porter, como del tema. Proponiéndose ofrecer una contribución para el desarrollo del conocimiento sobre estrategias genéricas, adoptamos el trabajo de Porter (1980 como referencia y realizamos una revisión bibliográfica profunda, comparándolo con las propuestas m

  6. 'Irish & Roman Catholic Which Upsets All the People Here': Michael McDonnell and British Colonial Justice in Mandatory Palestine, 1927-1936.

    Science.gov (United States)

    Davis, Simon

    2017-10-23

    In 1927 Michael McDonnell, a diasporic Irish Catholic, was appointed Mandatory Palestine's Chief Justice, being directed to institute firm British-style legal-judicial foundations for future self-governance. This entailed common, equal status for Arab and Jewish Palestinians, implicitly de-privileging the Jewish National Home. McDonnell was resisted in this by the British Mandate's Anglo-Jewish, pro-Zionist Attorney General, Norman Bentwich. McDonnell prevailed but only at the cost of being characterized lastingly as a pro-Arab, Catholic anti-Semite. McDonnell's continuing defence of a supreme, independent judiciary antagonized the Palestine Executive of High Commissioner Arthur Wauchope, who tried to co-opt rather than subordinate Zionist interests. Consequent frictions culminated in 1936 with McDonnell adjudicating against supra-legal British repression of Palestine's great Arab rebellion. For this he was dismissed and ostracized, subsequently publishing critiques of British policy in fringe right-wing organs. Yet McDonnell professed explicitly non-racist views, reflecting a liberal-minded, constitutional Irish nationalist equation of Palestine with Ireland, seeing comparable settler-colonial abuses and native distress as remediable only by transcendentally impartial justice. Britain reneging on these principles led McDonnell, like those Irish imperial servants noted in India, to identify with colonial subjects against colonialism. His case is one of empire as a system of domination being challenged from within, although his removal foreshadowed emerging imperial counter-insurgency's tendency not only to repress subject populations but deny civil-progressive alternatives for managing post-colonial transition. © The Author [2017]. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  7. Colonial Empires of the East and the Eest: Images of the Other, from Tacito to David Malouf, from Salman Rushdie to Michael Ondaatje

    Directory of Open Access Journals (Sweden)

    Elvira Gòdono

    2011-11-01

    Full Text Available Many centuries before Joseph Conrad’s Heart of Darkness (1902 and Rudyard Kipling’s Kim (1901 were published, the East and West were still divided, as in Tacito’s De Germania, by a limes also visible in David Malouf’s An Imaginary Life (1978, in which the poet Ovid exiled at Tomi, is friends with the savage Child, of animal nature in a human body, similar to the metamorphic migrants of Salman Rushdie’s The Satanic Verses (1988, which hides the magnificent and ancient East of Mahābhārata and Rāmāyana in many Western identities, lost in diabolic European cities. This chaotic antithesis in Michael Ondaatje’s pages lets Sri Lanka’s childish ghosts float amidst stories of peregrination and in search of a Promised Land. In the Skin of a Lion (1987 includes an epigraph from the ancient poem of Gilgamesh, an Eastern echo in a novel profoundly important for many Western studies that often focus on the theory of the canon or on postmodern literature. These categories are discussed with the prospect of broadening cultural and post-colonial studies, in order to merge theory of genres and thematic criticism with anthropology, mythology, and ethnology. Multiple citations expand the original object of research, adding the colonial prophecy present in North American myths, as demonstrated by Margaret Atwood, Margaret Laurence or Lévi-Strauss. Incessantly moving from one space to another, authors give voice to the native cry from multiple perspectives, narrating – like all colonial empires founded on human cruelty– the beast’s nature that has shown its worst aspect.

  8. Michael Polanyi's Philosophy of Science

    Indian Academy of Sciences (India)

    Positivism may be said to be the outcome of the changing contours of modern science that relies solely on observation, experimentation, and measurement. Experiments in modern science are designed solely to elicit 'yes' or 'no' for an answer. The resultant facts can be fitted into clusters, groups, manifolds, and sets.

  9. Michael Jackson: O artista perfeito

    OpenAIRE

    Abreu, Teresa

    2011-01-01

    No decorrer desta tese, abordam-se conhecimentos psicanalíticos aplicados à arte e aos artistas, mais especialmente em relação à área da música, mas que obviamente poderão ser estendidos a outras áreas artísticas. São expostas várias teorias psicanalíticas, oriundas de vários autores de renome e que nos ajudarão a compreender qual a função da arte e quais as qualidades ou características intrínsecas a um artista. Os termos arte e artista são abordados de forma exigente e em est...

  10. The Napoleon Graves / Michael Tarm

    Index Scriptorium Estoniae

    Tarm, Michael

    2002-01-01

    Vilniuse lähedal leiti 1812. a. Isamaasõjas hukkunud prantsuse sõdurite matmispaik. Säilmete antropoloogilised uuringud võimaldavad kindlaks määrata hukkunute vanuse, soo ja tõenäolise surma põhjuse

  11. The correspondance of Michael Faraday

    CERN Document Server

    1991-01-01

    The initial volume of the correspondence of Micahel Faraday (1791-1867), published in the year of the bicentenary of his birth, covers his early years up to his discovery of electromagnetic induction in 1831. Other scientific and technical topics covered include Faraday's discovery of electromagnetic rotations (in 1821), the liquefaction of gases (in 1823) and the long series of experiments in the latter part of the 1820s to improve optical glass.

  12. Tshelovek s britvoi / Michael Mayer

    Index Scriptorium Estoniae

    Mayer, Michael

    2006-01-01

    Venemaa president Vladimir Putini käitumist võib hinnata mitmeti, kriitikud süüdistavad teda demokraatia lämmatamises ning püüdes taastada nõukogude impeeriumi, kuid nad hindavad tema saavutusi. Hinnangud ja järeldused seoses Ukraina-Vene gaasitüliga, Kremli administratsiooni võim

  13. Dual-stream accounts bridge the gap between monkey audition and human language processing. Comment on "Towards a Computational Comparative Neuroprimatology: Framing the language-ready brain" by Michael Arbib

    Science.gov (United States)

    Garrod, Simon; Pickering, Martin J.

    2016-03-01

    Over the last few years there has been a resurgence of interest in dual-stream dorsal-ventral accounts of language processing [4]. This has led to recent attempts to bridge the gap between the neurobiology of primate audition and human language processing with the dorsal auditory stream assumed to underlie time-dependent (and syntactic) processing and the ventral to underlie some form of time-independent (and semantic) analysis of the auditory input [3,10]. Michael Arbib [1] considers these developments in relation to his earlier Mirror System Hypothesis about the origins of human language processing [11].

  14. Le Falstaff de Manfredo Maggioni et Michael Balfe : façonner un opéra italien pour le public anglais Adapting The Merry Wives of Windsor for the Italian Stage: Falstaff by Manfredo Maggioni and Michael Balfe

    Directory of Open Access Journals (Sweden)

    Céline Frigau

    2011-12-01

    Full Text Available Le Falstaff de Manfredo Maggioni et Michael Balfe constitue un cas à la fois exemplaire et unique de réécriture lyrique d’une œuvre de Shakespeare. Inspiré des Merry Wives of Windsor, l’opera buffa est écrit en 1838 pour le public de l’opéra italien de Londres, par un librettiste italien et un compositeur irlandais – une première dans un théâtre où l’on ne passe commande qu’auprès de maestri italiens. Des efforts de Maggioni et de Balfe résulte un véritable opéra italien qui respecte les codes structurels, les pratiques vocales et scéniques qui le rendent reconnaissable comme opera buffa sur la scène esthétique du temps. La question de la réécriture engage ici la réflexion sur les processus intimement liés de production et de réception précis, comme sur l’horizon d’attente du public londonien pour circonscrire les frontières d’une catégorie esthétique nommée « opéra italien » qui se définit aussi et peut-être avant tout loin de la péninsule, au contact de spectateurs non italophones, au fil d’échanges à l’échelle européenne.Based on Shakespeare’s Merry Wives of Windsor, Michael Balfe’s Falstaff, created in 1838 for London’s Italian opera audiences, was the work of an Italian librettist, Manfredo Maggioni, and an Irish composer, a first in a theatre where only Italian maestri were commissioned for new works. Balfe’s and Maggioni’s combined efforts resulted in a truly genuine Italian opera buffa. Not only is it sung in Italian but it also respects the structural codes, vocal and scenic practices which make it recognizable as an opera buffa on the aesthetic stage of the time, and above all on the English stage. The issue of rewriting implies here a reflection on the intimately linked processes of production and reception. Through the study of the libretto and score, its contextualization, as well as contemporary accounts, we will be concerned both with questioning the

  15. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    Directory of Open Access Journals (Sweden)

    Mihael Černetič

    2015-02-01

    Full Text Available The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is analysed from the perspective of mindfulness. Within the course of therapy, parallels were observed between the client's increased mindfulness, improved internal and external contact, strengthened Adult ego state, mastery of introjections, as well as diminished feelings of guilt, improved mood, self care and ability to engage in appropriate separation and individuation. These gains support the conclusion that Integrative Psychotherapy and mindfulness are inherently related and that explicit incorporation of mindfulness may enhance the therapeutic process of Integrative Psychotherapy.

  16. Discovery of carbon nanotubes. Sara ni carbon nanotube e

    Energy Technology Data Exchange (ETDEWEB)

    Iijima, S

    1994-01-20

    This paper describes the following matters on carbon nanotubes (CNt): CNt is discovered in carbon deposits generated in the tip of a negative electrode during DC arc discharge between carbon electrodes. CNt has a construction in which cylinders made of normally several layers are superposed, based on cylindrical crystals in a single layer with six-member rings of carbon atoms laid out. Spiral arrangement of carbon six-member rings has been discovered in the single-layered crystals. Five-member rings exist in a location where the CNt tip is closed, and seven-member rings in a location where the CNt presents a saddle-like curve, without exceptions. It is introduced theoretically that the electronic structure of the single-layered CNt depends on the cylinder diameter and spiral pitch. Replacing part of the carbon negative electrode with iron, and vaporizing iron and carbon simultaneously through arc discharge can result in a single-layered CNt with a diameter of 1 nm. Heating the CNt deposited with metallic lead in an oxygen atmosphere can form CNt containing lead compounds. 19 refs., 9 figs.

  17. AFSC/REFM: Alaska Stock Assessment Results Archive (SARA)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Each year over 50 Alaskan groundfish stock assessments report the condition of Alaskan fisheries resources in the U.S. Exclusive Economic Zone. Stock assessment...

  18. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    OpenAIRE

    Mihael Černetič

    2015-01-01

    The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is ana...

  19. Gene : CBRC-SARA-01-0604 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available and polyadenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82107.1| cleavage and poly...adenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82108.1| cleavage and polyadenylat...ion specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] 3e-16 77% MSTVPTVSCTS...TDRWGLVGTGRCYGSGRGGSMLASCGELSQAIALPKPVLSGHQAGSDPAGSSLYLVLPEGRCLPSVPAHVCPGTAEPAQHSQTPLQRELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVCPWAGVPRAGRPGPQAQPALSFRCMQWPPAPIRHAPASHA ...

  20. Wright meets Markowitz: How standard portfolio theory changes when assets are technologies following experience curves

    OpenAIRE

    Way, Rupert; Lafond, François; Farmer, J. Doyne; Lillo, Fabrizio; Panchenko, Valentyn

    2017-01-01

    This paper considers how to optimally allocate investments in a portfolio of competing technologies. We introduce a simple model representing the underlying trade-off - between investing enough effort in any one project to spur rapid progress, and diversifying effort over many projects simultaneously to hedge against failure. We use stochastic experience curves to model the idea that investing more in a technology reduces its unit costs, and we use a mean-variance objective function to unders...