WorldWideScience

Sample records for sara lee corporation

  1. Corporate social responsibility in the coffee sector: The dynamics of MNC responses and code development

    NARCIS (Netherlands)

    Kolk, A.

    2005-01-01

    Since the collapse of the international coffee agreement in 1989, attention has increasingly focused on the role of multinational corporations in this sector. As the main actors in the international coffee chain, companies such as Sara Lee/Douwe Egberts, Nestlé and Kraft have been pressurised to

  2. 77 FR 62562 - Self-Regulatory Organizations; ICE Clear Credit LLC; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2012-10-15

    ... two single names (The Hillshire Brands Company and DE US, Inc.). II. Self-Regulatory Organization's... the Sara Lee Corporation's successor companies, The Hillshire Brands Company and DE US, Inc. This... things, that the rules of a clearing agency be designed to promote the prompt and accurate clearance and...

  3. 2012 SARA Students Technical Report

    International Nuclear Information System (INIS)

    Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet

    2012-01-01

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of

  4. 2012 SARA Students Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

    2012-07-30

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the

  5. News developments at Sara

    International Nuclear Information System (INIS)

    Belmont, J.L.; Fruneau, M.; Martin, P.

    1989-05-01

    SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration

  6. Interpreting the SARA and RCRA training requirements

    International Nuclear Information System (INIS)

    Moreland, W.M.; Wells, S.M.

    1987-01-01

    The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements

  7. Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.

    Science.gov (United States)

    O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J

    2008-04-01

    Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.

  8. System Analysis and Risk Assessment system (SARA) Version 4.0

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1992-01-01

    This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis

  9. The relationship between SARA fractions and crude oil stability

    Directory of Open Access Journals (Sweden)

    Siavash Ashoori

    2017-03-01

    Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.

  10. Layering of life (Sara novel of Peter Sarić

    Directory of Open Access Journals (Sweden)

    Kostić Dragomir J.

    2015-01-01

    Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safe­guard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.

  11. The SARA REU Site Program

    Science.gov (United States)

    Wood, M. A.; Oswalt, T. D.; SARA Collaboration

    2000-12-01

    We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.

  12. Gene : CBRC-SARA-01-1996 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

  13. Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

    Directory of Open Access Journals (Sweden)

    Jessica N Snowden

    Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.

  14. Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

    Directory of Open Access Journals (Sweden)

    M. Sidi Ritau'din

    2017-06-01

    Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.

  15. What Lee Raymond actually said in Beijing [15th WPC

    International Nuclear Information System (INIS)

    Raymond, Lee.

    1997-01-01

    When Lee Raymond, Chairman and Chief Executive Officer, Exxon Corporation gave this keynote address at the recent World Petroleum Congress in Beijing, he drew attention to the way economic growth alleviates poverty and to the close linkage between economic growth and energy use. He also drew attention to the weakness of the scientific evidence for climate change being caused by fossil fuel burning and his doubts about the wisdom of setting targets for the reduction of CO 2 emissions. At a press conference after the presentation Lee Raymond assented to the suggestion that the European oil companies have been hijacked by the environmentalists. Petroleum Review has reproduced the full text of the speech so that readers can judge for themselves the merits of the arguments and their likely impact on the Kyoto conference. (UK)

  16. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...

  17. ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

    Directory of Open Access Journals (Sweden)

    Sulistyastuti Sutomo

    2015-01-01

    Full Text Available Not only does art   have   self-fullfillment, but  it also has axiological  benefits both socially, culturally, religiously, and economiclally.  So does Sara Douda dance.  Sara Douda aesthetics  is first contained  in its whole dance movements. In addition, it  can also be found in the whole dance equipments.  Moreover,  this dance aesthetics  may  also be contained in the verbal symbols in the speech forms  prior to the dance performance. However,  both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and  religious values in the Loli community about  their honoring their ancestors,  having social harmony, and  highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance.   Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda

  18. System Analysis and Risk Assessment System (SARA), Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.

    1992-02-01

    This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs

  19. Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural

    Directory of Open Access Journals (Sweden)

    Tiara Kharisma

    2017-12-01

    Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.

  20. System Analysis and Risk Assessment (SARA) system

    International Nuclear Information System (INIS)

    Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

    1986-01-01

    Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable

  1. Concurrent software system design supported by SARA at the age of one

    Energy Technology Data Exchange (ETDEWEB)

    Campos, I.M.; Estrin, G.

    A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.

  2. Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

    Science.gov (United States)

    Thomas, S. M.; Su, Y. C.; Hummel, P. R.

    2016-12-01

    Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance

  3. Use of Awamori-pressed Lees and Tofu Lees as Feed Ingredients for Growing Female Goats

    Directory of Open Access Journals (Sweden)

    Itsuki Nagamine

    2012-12-01

    Full Text Available Okinawan Awamori is produced by fermenting steamed indica rice with black mold, yeast, and water. Awamori-pressed lees is a by-product of the Awamori production process. Tofu lees is a by-product of the Tofu production process. This research consisted of two experiments conducted to elucidate whether or not dried Awamori-pressed lees and Tofu lees can be used as a mixed feed ingredient for raising female goats. In experiment 1, digestion trials were conducted to ascertain the nutritive values of dried Awamori-pressed lees and dried Tofu lees for goats. The digestible crude protein (DCP and total digestible nutrients (TDN contents of dried Awamori-pressed lees and Tofu lees were 22.5%, 22.5% (DCP, and 87.2%, 94.4% (TDN respectively. In experiment 2, 18 female goats (Japanese Saanen×Nubian, three months old, body weight 15.4±0.53 kg were divided into three groups of six animals (control feed group (CFG, Awamori-pressed lees mixed feed group (AMFG, Tofu lees mixed feed group (TMFG. The CFG control used feed containing 20% soybean meal as the main protein source, while the AMFG and TMFG treatments used feed mixed with 20% dried Awamori-pressed lees or dried Tofu lees. The groups were fed mixed feed (volume to provide 100 g/d increase in body weight twice a day (10:00, 16:00. The klein grass hay and water was given ad libitum. The hay intake was measured at 08:00 and 16:00. Body weight and size measurements were taken once a month. At the end of the experiment, a blood sample was drawn from the jugular vein of each animal. The DCP and TDN intakes in AMFG and TMFG showed no significant difference to the CFG. Cumulative measurements of growth in body weight, withers height, chest depth, chest girth, and hip width over the 10 mo period in the AMFG and TMFG were similar to the CFG. By contrast, cumulative growth in body length and hip height in the AMFG and TMFG tended to be larger than the CFG. Cumulative growth in chest width in the AMFG was

  4. SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS

    International Nuclear Information System (INIS)

    Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.

    2015-01-01

    SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index

  5. Mengukur Politisasi Agama dalam Ruang Publik: Komunikasi SARA dalam Perdebatan Rational Choice Theory

    Directory of Open Access Journals (Sweden)

    Mohammad Supriyadi

    2015-12-01

    Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

  18. Use of Awamori-pressed Lees and Tofu Lees as Feed Ingredients for Growing Male Goats

    Directory of Open Access Journals (Sweden)

    Itsuki Nagamine

    2013-09-01

    Full Text Available Awamori is produced by fermenting steamed indica rice. Awamori-pressed lees is a by-product of the Awamori production process. Tofu lees is a by-product of the Tofu production process. Research was conducted to test if dried Awamori-pressed lees and Tofu lees can be used as a mixed feed ingredient for raising male goats. Eighteen male kids were divided into three groups of six animals (control feed group (CFG, Awamori-pressed lees mixed feed group (AMFG, Tofu lees mixed feed group (TMFG. The CFG used feed containing 20% soybean meal as the main protein source, while the AMFG and TMFG used feed mixed with 20% dried Awamori-pressed lees or dried Tofu lees. The groups were fed mixed feed (volume to provide 100 g/d increase in body weight and alfalfa hay cubes (2.0 kg/d twice a day (10:00, 16:00. Klein grass hay and water was given ad libitum. Hay intake was measured at 10:00 and 16:00. Body weight and size measurements were taken once a month. At the end of the experiment, a blood sample was drawn from the jugular vein of each animal and the carcass characteristics, the physical and chemical characteristics of loin were analyzed. DCP and TDN intakes in AMFG and TMFG showed no significant difference to the CFG. Cumulative measurements of growth in body weight and size over the 10 mo period in the AMFG and TMFG were similar to the CFG. Blood parameter values were similar to those in normal goats. Dressing carcass weight and percentages, and total weight of meat in the AMFG were similar to that in the CFG, but smaller in the TMFG. The compressed meat juice ratio was higher in both the TMFG and AMFG than the CFG. While the fat in corn, Awamori-pressed lees, and Tofu lees contains more than 50% linoleic acid, the loin fat in both the AMFG and TMFG was very low in linoleic acid due to the increase in the content of oleic acid, stearic acid, and palmitic acid. This indicates that feeding on AMF and TMF does not inhibit hydrogenation by ruminal

  19. Identification of Differentially Expressed Proteins in Liver in Response to Subacute Ruminal Acidosis (SARA Induced by High-concentrate Diet

    Directory of Open Access Journals (Sweden)

    X. Y. Jiang

    2014-08-01

    Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...

  8. 75 FR 67770 - Sara Lee Corporation Including On-Site Leased Workers From EDS, Hewitt Packard, Sapphire...

    Science.gov (United States)

    2010-11-03

    ..., Deductions, Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial... this certification to include workers providing shared financial and information technology services at..., Deductions, Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  11. Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

    2009-07-01

    Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench

  12. Calculations for the design and modification of the 2 cyclotrons of S.A.R.A

    International Nuclear Information System (INIS)

    Albrand, P.S.; Belmont, J.L.; Ripouteau, F.

    1983-09-01

    S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron

  13. Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.

    Science.gov (United States)

    Zhao, Bryan M; Hoffmann, F Michael

    2006-09-01

    Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...

  15. Treatment of wine lees on an industrial scale. [wine lees processing

    Energy Technology Data Exchange (ETDEWEB)

    1978-04-24

    EtOH and tartaric acid are recovered from wine lees by compressing the lees into pellets, distillation with steam to remove alcohols followed by fractional distillation to recover EtOH, roasting and pulverization of the EtOH-free pellets to coagulate collids, and extraction of the suspension with water and mineral acid to recover tartaric acid. Mother liquors are recirculated through the tartaric acid recovery process and the residual material is dried to a protein product which is useful as fertilizer or as animal feed.

  16. Characterization of Phenolic Compounds in Wine Lees.

    Science.gov (United States)

    Zhijing, Ye; Shavandi, Amin; Harrison, Roland; Bekhit, Alaa El-Din A

    2018-03-25

    The effect of vinification techniques on phenolic compounds and antioxidant activity of wine lees are poorly understood. The present study investigated the antioxidant activity of white and red wine lees generated at early fermentation and during aging. In this study, the total phenol content (TPC), total tannin content (TTC), mean degree of polymerization (mDP), and antioxidant activities of five white and eight red wine lees samples from different vinification backgrounds were determined. The results showed that vinification techniques had a significant ( p tannin content of the samples. White wine lees had high mDP content compared with red ones. Catechin (50-62%) and epicatechin contents were the predominant terminal units of polymeric proanthocyanidin extracted from examined samples. Epigallocatechin was the predominant extension unit of white wine lees, whereas epicatechin was the predominant compound in red wine marc. The ORAC (oxygen radical absorbance capacity) assay was strongly correlated with the DPPH (α, α-diphenyl-β-picrylhydrazyl) assay, and the results showed the strong antioxidant activities associated with red wine lees (PN > 35 mg Trolox/g FDM) (PN: Pinot noir lees; FDM: Freeze-dried Material). This study indicates that tannin is one of the major phenolic compounds available in wine lees that can be useful in human and animal health applications.

  17. Characterization of Phenolic Compounds in Wine Lees

    Science.gov (United States)

    Zhijing, Ye; Shavandi, Amin; Harrison, Roland; Bekhit, Alaa El-Din A.

    2018-01-01

    The effect of vinification techniques on phenolic compounds and antioxidant activity of wine lees are poorly understood. The present study investigated the antioxidant activity of white and red wine lees generated at early fermentation and during aging. In this study, the total phenol content (TPC), total tannin content (TTC), mean degree of polymerization (mDP), and antioxidant activities of five white and eight red wine lees samples from different vinification backgrounds were determined. The results showed that vinification techniques had a significant (p wine lees had high mDP content compared with red ones. Catechin (50–62%) and epicatechin contents were the predominant terminal units of polymeric proanthocyanidin extracted from examined samples. Epigallocatechin was the predominant extension unit of white wine lees, whereas epicatechin was the predominant compound in red wine marc. The ORAC (oxygen radical absorbance capacity) assay was strongly correlated with the DPPH (α,α-diphenyl-β-picrylhydrazyl) assay, and the results showed the strong antioxidant activities associated with red wine lees (PN > 35 mg Trolox/g FDM) (PN: Pinot noir lees; FDM: Freeze-dried Material). This study indicates that tannin is one of the major phenolic compounds available in wine lees that can be useful in human and animal health applications. PMID:29587406

  18. The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

    Science.gov (United States)

    Wood, M. A.

    2003-12-01

    The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.

  19. SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

    DEFF Research Database (Denmark)

    Martin, Christer; Heinze, C.; Busch, M.

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...

  20. Characterization of Phenolic Compounds in Wine Lees

    Directory of Open Access Journals (Sweden)

    Ye Zhijing

    2018-03-01

    Full Text Available The effect of vinification techniques on phenolic compounds and antioxidant activity of wine lees are poorly understood. The present study investigated the antioxidant activity of white and red wine lees generated at early fermentation and during aging. In this study, the total phenol content (TPC, total tannin content (TTC, mean degree of polymerization (mDP, and antioxidant activities of five white and eight red wine lees samples from different vinification backgrounds were determined. The results showed that vinification techniques had a significant (p < 0.05 impact on total phenol and tannin content of the samples. White wine lees had high mDP content compared with red ones. Catechin (50–62% and epicatechin contents were the predominant terminal units of polymeric proanthocyanidin extracted from examined samples. Epigallocatechin was the predominant extension unit of white wine lees, whereas epicatechin was the predominant compound in red wine marc. The ORAC (oxygen radical absorbance capacity assay was strongly correlated with the DPPH (α, α-diphenyl-β-picrylhydrazyl assay, and the results showed the strong antioxidant activities associated with red wine lees (PN > 35 mg Trolox/g FDM (PN: Pinot noir lees; FDM: Freeze-dried Material. This study indicates that tannin is one of the major phenolic compounds available in wine lees that can be useful in human and animal health applications.

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

  5. On the linear programming bound for linear Lee codes.

    Science.gov (United States)

    Astola, Helena; Tabus, Ioan

    2016-01-01

    Based on an invariance-type property of the Lee-compositions of a linear Lee code, additional equality constraints can be introduced to the linear programming problem of linear Lee codes. In this paper, we formulate this property in terms of an action of the multiplicative group of the field [Formula: see text] on the set of Lee-compositions. We show some useful properties of certain sums of Lee-numbers, which are the eigenvalues of the Lee association scheme, appearing in the linear programming problem of linear Lee codes. Using the additional equality constraints, we formulate the linear programming problem of linear Lee codes in a very compact form, leading to a fast execution, which allows to efficiently compute the bounds for large parameter values of the linear codes.

  6. PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

    Directory of Open Access Journals (Sweden)

    Jorge A. Orrego-Ruiz

    2014-06-01

    Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...

  8. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    Science.gov (United States)

    Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

    2017-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.

  9. DETERMINACIÓN DE LAS FRACCIONES SARA DE ASFALTOS COLOMBIANOS ENVEJECIDOS AL MEDIO AMBIENTE EMPLEANDO CROMATOGRAFÍA LÍQUIDA EN COLUMNA DETERMINAÇÃO DAS FRAÇÕES SARA DE ASFALTOS COLOMBIANOS ENVELHECIDOS AO MÉDIO AMBIENTE EMPREGANDO CROMATOGRAFIA LÍQUIDA EM COLUNA DETERMINATION OF SARA FRACTIONS OF ENVIRONMENTALLY AGED COLOMBIAN ASPHALTS USING LIQUID CHROMATOGRAPHY COLUMN

    Directory of Open Access Journals (Sweden)

    Fredy Alberto Reyes

    2012-06-01

    Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p

  10. Tim Berners-Lee during the WSIS

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    Tim Berners-Lee stands in front of the first web server at the Geneva Palexpo during the World Summit on the Information Society (WSIS) in 2003. Tim Berners-Lee developed the first network and server system that lead to the World Wide Web.

  11. Hemolytic disease of the fetus and newborn caused by an antibody to a low-prevalence antigen, anti-SARA.

    Science.gov (United States)

    Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy

    2011-09-01

    The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.

  12. Staphylococcus aureus Quorum Regulator SarA Targeted Compound, 2-[(Methylaminomethyl]phenol Inhibits Biofilm and Down-Regulates Virulence Genes

    Directory of Open Access Journals (Sweden)

    P. Balamurugan

    2017-07-01

    Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.

  13. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...

  14. 76 FR 30947 - Stephen Lee Seldon: Debarment Order

    Science.gov (United States)

    2011-05-27

    ...] Stephen Lee Seldon: Debarment Order AGENCY: Food and Drug Administration, HHS. ACTION: Notice. SUMMARY... Act (the FD&C Act) permanently debarring Stephen Lee Seldon, M.D. from providing services in any... authority delegated to the Director (Staff Manual Guide 1410.35), finds that Stephen Lee Seldon has been...

  15. Transferring generic SARA/OSHA training to US Department of Energy facilities

    International Nuclear Information System (INIS)

    White, A.; McKinley, T.

    1989-01-01

    The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...

  17. Interactions between yeast lees and wine polyphenols during simulation of wine aging. II. Analysis of desorbed polyphenol compounds from yeast lees.

    Science.gov (United States)

    Mazauric, Jean-Paul; Salmon, Jean-Michel

    2006-05-31

    In the first part of this work, the analysis of the polyphenolic compounds remaining in the wine after different contact times with yeast lees during simulation of red wine aging was undertaken. To achieve a more precise view of the wine polyphenols adsorbed on lees during red wine aging and to establish a clear balance between adsorbed and remnant polyphenol compounds, the specific analysis of the chemical composition of the adsorbed polyphenolic compounds (condensed tannins and anthocyanins) after their partial desorbtion from yeast lees by denaturation treatments was realized in the second part of the study. The total recovery of polyphenol compounds from yeast lees was not complete, since a rather important part of the initial wine colored polyphenols, especially those with a dominant blue color component, remained strongly adsorbed on yeast lees, as monitored by color tristimulus and reflectance spectra measurements. All anthocyanins were recovered at a rather high percentage (about 62%), and it was demonstrated that they were not adsorbed in relation with their sole polarity. Very few monomeric phenolic compounds were extracted from yeast lees. With the use of drastic denaturing treatments, the total recovery of condensed tannins reached 83%. Such tannins extracted from yeast lees exhibited very high polymeric size and a rather high percentage of galloylated residues by comparison with initial wine tannins, indicating that nonpolar tannins were preferentially desorbed from yeast lees by the extraction treatments.

  18. SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-05-01

    Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.

  19. Higher-derivative Lee-Wick unification

    International Nuclear Information System (INIS)

    Carone, Christopher D.

    2009-01-01

    We consider gauge coupling unification in Lee-Wick extensions of the Standard Model that include higher-derivative quadratic terms beyond the minimally required set. We determine how the beta functions are modified when some Standard Model particles have two Lee-Wick partners. We show that gauge coupling unification can be achieved in such models without requiring the introduction of additional fields in the higher-derivative theory and we comment on possible ultraviolet completions.

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  1. Constraints on the Lee-Wick Higgs sector

    International Nuclear Information System (INIS)

    Carone, Christopher D.; Primulando, Reinard

    2009-01-01

    Lee-Wick partners to the standard model Higgs doublet may appear at a mass scale that is significantly lower than that of the remaining Lee-Wick partner states. The relevant effective theory is a two-Higgs doublet model in which one doublet has wrong-sign kinetic and mass terms. We determine bounds on this effective theory, including those from neutral B-meson mixing, b→X s γ, and Z→bb. The results differ from those of conventional two-Higgs doublet models and lead to meaningful constraints on the Lee-Wick Higgs sector.

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w

  3. The Earl Lee Street Art Campaign

    Science.gov (United States)

    Bubba

    2013-01-01

    This article describes a catchy phrase with more to its meaning than first view. A slogan "All the girls love Earl Lee," appears in street art around the world. Earl Lee is a lovable, handsome man who owns the fictitious Earl Lube industries. Originally intended to bring a smile to people's faces at a time when there wasn't much to smile…

  4. Tim Berners-Lee receives the Millennium Technology Prize

    CERN Multimedia

    2004-01-01

    On 15 April, for his invention of the Web, Tim Berners-Lee was awarded the first ever Millennium Technology Prize by the Finnish Technology Award Foundation, which recognises technological innovations of lasting benefit to society. "Tim Berners-Lee's invention perfectly encapsulates the spirit of the Prize. The Web is encouraging new types of social networks, contributing to transparency and democracy, and opening up new avenues for information management and business development," underlined Pekka Tarjanne, chairman of the jury and former Secretary-General of the International Telecommunication Union (ITU). Tim Berners-Lee is congratulated by Jukka Valtasaari, Finland's Ambassador to the United States. Tim Berners-Lee created the first server, browser and editor, the HTML code, the URL address and the HTTP transmission protocol at CERN in 1990. CERN released the Web into the public domain in 1993. Tim Berners-Lee is currently head of the World Wide Web Consortium, managed by ERCIM (Europe...

  5. Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge

    DEFF Research Database (Denmark)

    Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette

    2017-01-01

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...

  6. Radiation bounce from the Lee-Wick construction?

    International Nuclear Information System (INIS)

    Karouby, Johanna; Brandenberger, Robert

    2010-01-01

    It was recently realized that matter modeled by the scalar field sector of the Lee-Wick standard model yields, in the context of a homogeneous and isotropic cosmological background, a bouncing cosmology. However, bouncing cosmologies induced by pressureless matter are in general unstable to the addition of relativistic matter (i.e. radiation). Here we study the possibility of obtaining a bouncing cosmology if we add not only radiation, but also its Lee-Wick partner, to the matter sector. We find that, in general, no bounce occurs. The only way to obtain a bounce is to choose initial conditions with very special phases of the radiation field and its Lee-Wick partner.

  7. Web Inventor Berners-Lee starts a Blog

    CERN Multimedia

    Olson, Parmy

    2005-01-01

    Berners-Lee created what is known today as the World Wide Web. Now, just in time for the Web's 15th anniversary and after taking his proverbial stroll around the global dwelling of cyberspace, Berners-Lee is chatting with the rest of us about what he thinks with a blog

  8. Sara John: Ethnisierte Arbeit. Eine feministische Perspektive. Marburg: Tectum Wissenschaftsverlag 2009.

    Directory of Open Access Journals (Sweden)

    Grit Grigoleit

    2011-03-01

    Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.

  9. Complete synchronization of two Chen-Lee systems

    International Nuclear Information System (INIS)

    Sheu, L-J; Chen, J-H; Chen, H-K; Tam, L-M; Lao, S-K; Chen, W-C; Lin, K-T

    2008-01-01

    This study demonstrates that complete synchronization of two Chen-Lee chaotic systems can be easily achieved. The upper bound of the Chen-Lee chaotic system is estimated numerically. A controller is designed to synchronize two chaotic systems. Sufficient conditions for synchronization are obtained using Lyapunov's direct method. Two numerical examples are presented to verify the proposed synchronization approach

  10. Layering of life (Sara novel of Peter Sarić)

    OpenAIRE

    Kostić, Dragomir J.

    2015-01-01

    Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

  12. Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

    Directory of Open Access Journals (Sweden)

    Tirshem Kumar Kaushik

    2015-05-01

    Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.

  13. One-loop renormalization of Lee-Wick gauge theory

    International Nuclear Information System (INIS)

    Grinstein, Benjamin; O'Connell, Donal

    2008-01-01

    We examine the renormalization of Lee-Wick gauge theory to one-loop order. We show that only knowledge of the wave function renormalization is necessary to determine the running couplings, anomalous dimensions, and vector boson masses. In particular, the logarithmic running of the Lee-Wick vector boson mass is exactly related to the running of the coupling. In the case of an asymptotically free theory, the vector boson mass runs to infinity in the ultraviolet. Thus, the UV fixed point of the pure gauge theory is an ordinary quantum field theory. We find that the coupling runs more quickly in Lee-Wick gauge theory than in ordinary gauge theory, so the Lee-Wick standard model does not naturally unify at any scale. Finally, we present results on the beta function of more general theories containing dimension six operators which differ from previous results in the literature.

  14. Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010

    OpenAIRE

    Beaulé, Sophie

    2014-01-01

    With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...

  15. Wrong vertex displacements due to Lee-Wick resonances at LHC

    International Nuclear Information System (INIS)

    Alvarez, E.; Schat, C.; Rold, L. da; Szynkman, A.

    2009-01-01

    We show how a resonance from the recently proposed Lee-Wick Standard Model could lead to wrong vertex displacements at LHCb. We study which could be the possible 'longest lived' Lee-Wick particle that could be created at LHC, and we study its possible decays and detections. We conclude that there is a region in the parameter space which would give wrong vertex displacements as a unique signature of the Lee-Wick Standard Model at LHCb. Further numerical simulation shows that LHC era could explore these wrong vertex displacements through Lee-Wick leptons below 500 GeV. (author)

  16. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    Directory of Open Access Journals (Sweden)

    Abdullah K. Shehabat

    2016-09-01

    Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.

  17. The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...

  18. Retrospective: Ivy Lee and the German Dye Trust.

    Science.gov (United States)

    Hainsworth, Brad E.

    1987-01-01

    Examines the relationship between public relations trailblazer Ivy Lee and the German Dye Trust, which became an agent for the policies of Adolf Hitler. Discusses how Lee's efforts to use this relationship to persuade his contacts to influence the Nazi leadership failed because of his formal connection with this group. (JD)

  19. A simple blowdown code for SUPER-SARA loop conditions

    International Nuclear Information System (INIS)

    Fritz, G.

    1981-01-01

    The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic

  2. Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.

    1995-01-01

    Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs

  3. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0. Volume 5, Systems Analysis and Risk Assessment (SARA) tutorial manual

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities

  4. NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

  7. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    Science.gov (United States)

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…

  8. Baikov-Lee representations of cut Feynman integrals

    International Nuclear Information System (INIS)

    Harley, Mark; Moriello, Francesco; Schabinger, Robert M.

    2017-01-01

    We develop a general framework for the evaluation of d-dimensional cut Feynman integrals based on the Baikov-Lee representation of purely-virtual Feynman integrals. We implement the generalized Cutkosky cutting rule using Cauchy’s residue theorem and identify a set of constraints which determine the integration domain. The method applies equally well to Feynman integrals with a unitarity cut in a single kinematic channel and to maximally-cut Feynman integrals. Our cut Baikov-Lee representation reproduces the expected relation between cuts and discontinuities in a given kinematic channel and furthermore makes the dependence on the kinematic variables manifest from the beginning. By combining the Baikov-Lee representation of maximally-cut Feynman integrals and the properties of periods of algebraic curves, we are able to obtain complete solution sets for the homogeneous differential equations satisfied by Feynman integrals which go beyond multiple polylogarithms. We apply our formalism to the direct evaluation of a number of interesting cut Feynman integrals.

  9. Eczema (Atopic Dermatitis)Treatment

    Science.gov (United States)

    ... Lubricate or moisturize the skin two to three times a day using ointments such as petroleum jelly. Moisturizers should be ... Freeman Peter Hubbard Sara Jones Tony Lee Lara R. ... Kinyoun Lecture Series 2016 Kinyoun Lecture 2015 Kinyoun Lecture 2014 Kinyoun ...

  10. Thomas George Lee - Implantation and early development of North American rodents

    DEFF Research Database (Denmark)

    Carter, Anthony Michael

    2011-01-01

    A century ago Thomas G. Lee amassed an unparalleled collection of developmental series of North American rodents such as the thirteen-lined ground squirrel, the Plains pocket gopher and Merriam's kangaroo rat. He was the first to describe the initial attachment of the squirrel blastocyst to the a......A century ago Thomas G. Lee amassed an unparalleled collection of developmental series of North American rodents such as the thirteen-lined ground squirrel, the Plains pocket gopher and Merriam's kangaroo rat. He was the first to describe the initial attachment of the squirrel blastocyst...... to the antimesometrial side of the uterus. The full potential of Lee's material was not realized until after his death, when it came into the possession of Mossman. The latter relied heavily on Lee's collection when writing his seminal monograph on the comparative morphogenesis of fetal membranes and much of Lee...

  11. Tim Berners-Lee and Kofi Annan during the WSIS

    CERN Multimedia

    Patrice Loïez

    2003-01-01

    During the 2003 World Summit on the Information Society (WSIS) at Geneva Palexpo, Tim Berners-Lee W3C's director (World Wide Web consortium) was introduced to Kofi Annan, Secretary General of the United Nations. Tim Berners-Lee developed the first network and server system that lead to the World Wide Web.

  12. Tim Berners-Lee and Kofi Annan during the WSIS

    CERN Multimedia

    Patrice Loïez

    2003-01-01

    During the 2003 World Summit on the Information Society (WSIS) at Geneva Palexpo, Tim Berners-Lee, W3C's director (World Wide Web consortium) was introduced to Kofi Annan, Secretary General of the United Nations. Tim Berners-Lee developed the first network and server system that lead to the World Wide Web.

  13. Towards a sustainable coffee market: paradoxes faced by a multinational company

    NARCIS (Netherlands)

    Kolk, A.

    2012-01-01

    This paper examines the case of sustainable coffee as faced by Sara Lee's International Coffee and Tea Division (SL), asking which strategic direction the company should take considering its regulatory, competitive, and societal contexts. More than a decade after sustainable coffee became a

  14. Deterministic and stochastic trends in the Lee-Carter mortality model

    DEFF Research Database (Denmark)

    Callot, Laurent; Haldrup, Niels; Kallestrup-Lamb, Malene

    The Lee and Carter (1992) model assumes that the deterministic and stochastic time series dynamics loads with identical weights when describing the development of age specific mortality rates. Effectively this means that the main characteristics of the model simplifies to a random walk model...... that characterizes mortality data. We find empirical evidence that this feature of the Lee-Carter model overly restricts the system dynamics and we suggest to separate the deterministic and stochastic time series components at the benefit of improved fit and forecasting performance. In fact, we find...... that the classical Lee-Carter model will otherwise over estimate the reduction of mortality for the younger age groups and will under estimate the reduction of mortality for the older age groups. In practice, our recommendation means that the Lee-Carter model instead of a one-factor model should be formulated...

  15. Lee de Forest King of Radio, Television, and Film

    CERN Document Server

    Adams, Mike

    2012-01-01

    Lee de Forest, Yale doctorate and Oscar winner, gave voice to the radio and the motion picture. Yet by the 1930s, after the radio and the Talkies were regular features of American life, Lee de Forest had seemingly lost everything. Why? Why didn’t he receive the recognition and acclaim he sought his entire life until years later in 1959, when he was awarded an Oscar? A lifelong innovator, Lee de Forest invented the three-element vacuum tube which he developed between 1906 and 1916 as a detector, amplifier, and oscillator of radio waves. As early as 1907, he was broadcasting music programming. In 1918, he began to develop a system for recording and playing back sound by using light patterns on motion picture film. In order to promote and demonstrate his process he made hundreds of short sound films, found theatres for their showing, and issued publicity to gain audiences for his invention. While he received many patents for this technology, he was ignored by the film industry. Lee de Forest, King of Radio, Te...

  16. Lepidoptera, Nymphalidae, Heliconiinae, Heliconius sara apseudes (Hübner, 1813: Distribution extension

    Directory of Open Access Journals (Sweden)

    Iserhard, C. A.

    2010-01-01

    Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.

  17. Proposed plan for the United Nuclear Corporation Disposal Site at the Oak Ridge Y-12 Plant, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1991-03-01

    The US Department of Energy (DOE) in compliance with Section 117(a) of the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) of 1980, as amended by the Superfund Amendments and Reauthorization Act (SARA) of 1986, is releasing the proposed plan for remedial action at the United Nuclear Corporation (UNC) Disposal Site located at the DOE Oak Ridge Operations (ORO) Y-12 Plant, Oak Ridge, Tennessee. The purpose of this document is to present and solicit for comment to the public and all interested parties the ''preferred plan'' to remediate the UNC Disposal Site. However, comments on all alternatives are invited

  18. Virginia Lee Burton's "Little House" in Popular Consciousness

    DEFF Research Database (Denmark)

    Goddard, Joseph

    2011-01-01

    This article considers the significance of Victoria Lee Burton’s authorship, specifically The Little House, for lifestyle preferences and the development of environmental consciousness in the postwar period. The article argues that Burton deliberately designed her work to evoke country-friendly s......This article considers the significance of Victoria Lee Burton’s authorship, specifically The Little House, for lifestyle preferences and the development of environmental consciousness in the postwar period. The article argues that Burton deliberately designed her work to evoke country...

  19. Delphine Letort, The Spike Lee Brand: A Study of Documentary Filmmaking

    OpenAIRE

    Lipson, David

    2017-01-01

    Spike Lee is known the world over for films like She’s Gotta Have It (1986), School Daze (1988), Do the Right Thing (1989), etc. This association with fiction films is so strong that one could mistakenly think that Delphine Letort’s book The Spike Lee Brand: A Study of Documentary Filmmaking would explore the connection between these fiction films and the documentary genre. However, the first pages of the book clearly indicate that it will focus on Spike Lee the documentary filmmaker. Making ...

  20. To belong to the living

    DEFF Research Database (Denmark)

    Petersen, Michael Nebeling

    2013-01-01

    Med udgangspunkt i Lee Edelmans polemiske argumentation imod reproduktiv futurisme og Sara Ahmeds fokus på queer attachments analyserer og diskuterer artiklen queer slægtskab, som det fremstilles i den amerikanske spillefilm The Kids Are All Right. Der argumenteres for, at børnenes heteronormative...

  1. The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

    Directory of Open Access Journals (Sweden)

    John M Morrison

    2012-03-01

    Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.

  2. Intravenous immunoglobulin in the management of a rare cause of hemolytic disease of the newborn: Anti-SARA antibodies.

    Science.gov (United States)

    Venkataraman, Rohini; Yusuf, Kamran

    2017-01-01

    Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.

  3. [The medical theory of Lee Je-ma and its character].

    Science.gov (United States)

    Lee, Kyung-Lock

    2005-12-01

    Lee Je-ma 1837-1900) was a prominent scholar as well as an Korean physician. classified every people into four distinctive types: greater yang [tai yang] person, lesser yin [shao yin] person, greater yin [tai yin] person, lesser yin [shao yin] person. This theory would dictate proper treatment for each type in accordance with individual differences of physical and temperament features. Using these four types he created The Medical Science of Four Types. This article is intended to look into the connection between Lee Je-Ma's 'The Medical Science of Four Types' and 'The Modern' with organizing his ideas about the human body and the human being. Through The Modern, the theory of human being underwent a complete change. Human being in The Premodern, which was determined by sex, age and social status has been changed to the individual human being, which is featured by equality. Lee Je-Ma's medical theory of The Medical Science of Four Types would be analyzed as follow. His concept of human body is oriented toward observable objectivity. But on the other hand, it still remains transcendent status of medical science, which is subordinated by philosophy. According to Lee Je-Ma's theory of human being, human is an equal individual in a modern way of thinking, not as a part of hierarchical group. But on the other hand, it still remains incomplete from getting rid of morality aspect that includes virtue and vice in the concept of human body. The common factors in Lee Je-Ma's ideas about the human body and the human being is 'Dualism of mind and body that means all kinds of status and results depends on each individual. As is stated above, Lee Je-Ma's medical theory has many aspects of The Modern and it proves that Korean traditional medicine could be modernized by itself.

  4. Severe accident recriticality analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H

    2001-11-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated

  5. Severe accident recriticality analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.

    2001-01-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady

  6. Optimization of biohydrogen production from beer lees using anaerobic mixed bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Maojin; Yuan, Zhuliang; Zhi, Xiaohua; Shen, Jianquan [Beijing National Laboratory for Molecular Sciences (BNLMS), Laboratory of New Materials, Institute of Chemistry, Chinese Academy of Sciences, Zhongguancun North First Street 2, Beijing 100190 (China)

    2009-10-15

    Beer lees are the main by-product of the brewing industry. Biohydrogen production from beer lees using anaerobic mixed bacteria was investigated in this study, and the effects of acidic pretreatment, initial pH value and ferrous iron concentration on hydrogen production were studied at 35 C in batch experiments. The hydrogen yield was significantly enhanced by optimizing environmental factors such as hydrochloric acid (HCl) pretreatment of substrate, initial pH value and ferrous iron concentration. The optimal environmental factors of substrate pretreated with 2% HCl, pH = 7.0 and 113.67 mg/l Fe{sup 2+} were observed. A maximum cumulative hydrogen yield of 53.03 ml/g-dry beer lees was achieved, which was approximately 17-fold greater than that in raw beer lees. In addition, the degradation efficiency of the total reducing sugar, and the contents of hemicellulose, cellulose, lignin and metabolites are presented, which showed a strong dependence on the environmental factors. (author)

  7. Awards: New Year Knighthood for Tim Berners-Lee

    CERN Multimedia

    2004-01-01

    Tim Berners-Lee has been awarded his country's highest honour - a knighthood - in the UK's New Year Honours list for his work while at CERN on the World Wide Web. In the same honours list, Roger Cashmore has been made a Companion of the Order of St Michael and St George (CMG) "for his services to international co-operation in particle physics". Cashmore was CERN's Director for Collider Programmes from 1999-2003, and is now Principal of Brasenose College, Oxford. Tim Berners-Lee stands in front of the first web server at Palexpo during the World Summit on the Information Society.

  8. Lee-Nauenberg theorem and Coulomb scattering

    Energy Technology Data Exchange (ETDEWEB)

    Fleming, H; Frenkel, J [Sao Paulo Univ. (Brazil). Instituto de Fisica

    1975-08-01

    Lee-Nauenberg analysis is extended to the case of Coulomb scattering, where the diagonal elements of the Hamiltonian interaction are singular functions. It is shown, using a simple argument, that the leading infrared singularities in the cross-section are mutually canceled out.

  9. Grain-size sorting in grainflows at the lee side of deltas

    NARCIS (Netherlands)

    Kleinhans, M.G.

    2005-01-01

    The sorting of sediment mixtures at the lee slope of deltas (at the angle of repose) is studied with experiments in a narrow, deep flume with subaqueous Gilbert-type deltas using varied flow conditions and different sediment mixtures. Sediment deposition and sorting on the lee slope of the delta

  10. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    OpenAIRE

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...

  11. 76 FR 67209 - United States v. Grupo Bimbo S.A.B. de C.V., et al.; Proposed Final Judgment and Competitive...

    Science.gov (United States)

    2011-10-31

    ... substitute other bakery or food products for sliced bread for these and other uses. Therefore, a hypothetical... BBU and Sara Lee branded sliced-bread products as their first and second choices in sliced-bread... would be profitable after the acquisition. The same profit motive would apply to an increase in the...

  12. The medical theory of Lee Je-ma and its character

    Directory of Open Access Journals (Sweden)

    LEE Kyung-Lock

    2005-12-01

    Full Text Available Lee Je-ma(李濟馬, 1837-1900 was a prominent scholar as well as an Korean physician He classified every people into four distinctive types: greater yang[tai yang] person, lesser yin[shao yin] person greater yin[tai yin] person, lesser yin[shao yin] person. This theory would dictate proper treatment for each type in accordance with individual differences of physical and temperament features Using these four types he created The Medical Science of Four Types(四象體質論.This article is intended to look into the connection between Lee Je-Ma's 'The Medical Science of Four Types' and 'The Modern' with organizing his ideas about the human body and the human being. Through The Modern, the theory of human being(人間觀 underwent a complete change. Human being in The Premodern, which was determined by sex, age and social status has been changed to the individual human being, which is featured by equality. Lee Je-Ma's medical theory of The Medical Science of Four Types would be analyzed as follow. His concept of human body(人體論 is oriented toward observable objectivity. But on the other hand, it still remains transcendent status of medical science, which is subordinated by philosophy According to Lee Je-Ma's theory of human being human is an equal individual in a modern way of thinking not as a part of hierarchical group. But on the other hand, it still remains incomplete from getting rid of morality aspect that includes virtue and vice in the concept of human body.The common factors in Lee Je-Ma's ideas about the human body and the human being is 'Dualism of mind and body(心身二元論' that means all kinds of status and results depends on each individual. As is stated above, Lee Je-Ma's medical theory has many aspects of The Modern and it proves that Korean traditional medicine could be modernized by itself.

  13. Tim Berners-Lee at the RSIS conference from 8-9 December 2003.

    CERN Multimedia

    Patrice Loiez

    2003-01-01

    Tim Berners-Lee participated in the Role of Science in the Information Society conference held at CERN from 8-9 December 2003. Tim Berners-Lee developed the first network and server system that lead to the World Wide Web.

  14. Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

    Science.gov (United States)

    Goldrick-Rab, Sara; Kelly, Andrew P.

    2016-01-01

    In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…

  15. Subordinations In “To Kill A Mockingbird” By Harper Lee

    OpenAIRE

    Siregar, Rut Sri Novitawaty

    2011-01-01

    Salah satu yang dipelajari mahasiswa adalah tulis menulis. Secara ilmiah tulis menulis adalah penyampaian informasi dalam bentuk tulisan serta bagaimana informasi itu disampaikan. Judul kertas karya ini adalah Kalimat Subordinat yang ditemukan dalam novel To Kill a Mockingbird karya Harper Lee: SUBORDINATION IN TO KILL A MOCKINGBIRD BY HARPER LEE. Penulis mengangkat hal ini karena penulis tertarik dengan bentuk–bentuk serta fungsi-fungsi kalimat subordinat yang terdapat dalam tulisan-tulisan ...

  16. Instability of the Lee-Wick bounce

    International Nuclear Information System (INIS)

    Karouby, Johanna; Brandenberger, Robert; Qiu, Taotao

    2011-01-01

    It was recently realized [Y. F. Cai, T. t. Qiu, R. Brandenberger, and X. m. Zhang, Phys. Rev. D 80, 023511 (2009).] that a model constructed from a Lee-Wick type scalar field theory yields, at the level of homogeneous and isotropic background cosmology, a bouncing cosmology. However, bouncing cosmologies induced by pressureless matter are in general unstable to the addition of relativistic matter (i.e. radiation). Here we study the possibility of obtaining a bouncing cosmology if we add radiation coupled to the Lee-Wick scalar field. This coupling in principle would allow the energy to flow from radiation to matter, thus providing a drain for the radiation energy. However, we find that it takes an extremely unlikely fine-tuning of the initial phases of the field configurations for a sufficient amount of radiative energy to flow into matter. For general initial conditions, the evolution leads to a singularity rather than a smooth bounce.

  17. Severe Accident Recriticality Analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  18. Severe Accident Recriticality Analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  19. Lee waves, benign and malignant

    Science.gov (United States)

    Wurtele, M. G.; Datta, A.

    1992-01-01

    The flow of an incompressible, stratified fluid over an obstacle will produce an oscillation in which buoyancy is the restoring force, called a gravity wave. For disturbances of this scale, the atmosphere may be treated as incompressible; and even the linear approximation will explain many of the phenomena observed in the lee of mountains. However, nonlinearities arise in two ways: (1) through the large (scaled) size of the mountain, and (2) from dynamically singular levels in the fluid field. These produce a complicated array of phenomena that present hazards to aircraft and to lee surface areas. If there is no dynamic barrier, these waves can penetrate vertically into the middle atmosphere (30-100 km attitude), where recent observations show them to be of a length scale that must involve the Coriolis force in any modeling. At these altitudes, the amplitude of the waves is very large, and the waves are studied with a view to their potential impact on the projected National Aerospace Plane. This paper presents the results of analyses and state-of-the-art numerical simulations, validated where possible by observational data.

  20. The Workplace Literacy System Project (WLS). Final Performance Report.

    Science.gov (United States)

    Poulton, Bruce R.

    The Workplace Literacy System Project (WLS) prepared interactive CD-ROM discs containing about 50 hours of instruction and drill in basic skills presented within the context of the textile/apparel manufacturing industry. The project was conducted at a Sara Lee knit products plant in North Carolina. During the project, literacy task analyses were…

  1. The Statecraft of Singapore's Lee Kuan Yew

    National Research Council Canada - National Science Library

    Toh, K

    1996-01-01

    .... The ejection of Singapore from the Federation led Lee to focus on two strategic goals: the survival of Singapore as an independent state while simultaneously pursuing nation-building under the threats of communism and internal ethnic conflicts...

  2. Triniti daripada Perspektif Taoisme: Analisis Pemikiran Jung Young Lee

    Directory of Open Access Journals (Sweden)

    ZURAIZA HUSIN

    2016-06-01

    Full Text Available Jung Young Lee is a Korean-born theologian who employs creatively the doctrine of the Trinity from an Asian worldview. This article aims to analyze Lee’s approaches of the Trinity with the Yin-Yang symbolism. The main reference is based on the book written by him entitled ‘The Trinity in Asian Perspective (1996’. Lee has turned his attention to the topic of Trinity through the lens of the culture and thought patterns of his own milieu. One of the leading point in presenting Yin-Yang principle as Trinitarian thinking, Lee examines the interpretation of the term “in” in the Bible, "Believe me that I am in the Father and the Father is in me" (John 14:11. The statement leads to the point that Yin and Yang cannot exist without each other because relationality is given priority than individuality. The idea is based on the terminology of ‘both/and’. So, ‘and’ indicates a Trinitarian statement, there is interdependence and unification. With reference to Trinity, the Father and the Son are One because of ‘and’. In addition, the same concept implements to the Holy Spirit. Lee views ‘and’ is not only a linking principle in both-and thinking but also the principle that is ‘between’ two. When ‘two’ exists, the third also exist between them. Based on the idea of ‘middle’, represents the connecting element between two, which contributes for the existence of the Third. Accordingly, the Spirit is the third element in the Trinity relationship.

  3. Comparative genomics and stx phage characterization of LEE-negative Shiga toxin-producing Escherichia coli

    Directory of Open Access Journals (Sweden)

    Susan Renee Steyert

    2012-11-01

    Full Text Available Infection by Escherichia coli and Shigella species are among the leading causes of death due to diarrheal disease in the world. Shiga toxin producing Escherichia coli (STEC that do not encode the locus of enterocyte effacement (LEE-negative STEC often possess Shiga toxin gene variants and have been isolated from humans and a variety of animal sources. In this study, we compare the genomes of nine LEE-negative STEC harboring various stx alleles with four complete reference LEE-positive STEC isolates. Compared to a representative collection of prototype E. coli and Shigella isolates representing each of the pathotypes, the whole genome phylogeny demonstrated that these isolates are diverse. Whole genome comparative analysis of the 13 genomes revealed that in addition to the absence of the LEE pathogenicity island, phage encoded genes including non-LEE encoded effectors, were absent from all nine LEE-negative STEC genomes. Several plasmid-encoded virulence factors reportedly identified in LEE-negative STEC isolates were identified in only a subset of the nine LEE-negative isolates further confirming the diversity of this group. In combination with whole genome analysis, we characterized the lambdoid phages harboring the various stx alleles and determined their genomic insertion sites. Although the integrase gene sequence corresponded with genomic location, it was not correlated with stx variant, further highlighting the mosaic nature of these phages. The transcription of these phages in different genomic backgrounds was examined. Expression of the Shiga toxin genes, stx1 and/or stx2, as well as the Q genes, were examined with quantitative reverse transcriptase polymerase chain reaction (qRT-PCR assays. A wide range of basal and induced toxin induction was observed. Overall, this is a first significant foray into the genome space of this unexplored group of emerging and divergent pathogens.

  4. Practical Improvements to the Lee-More Conductivity Near the Metal-Insulator Transition

    International Nuclear Information System (INIS)

    Desjarlais, Michael P.

    2000-01-01

    The wide-range conductivity model of Lee and More is modified to allow better agreement with recent experimental data and theories for dense plasmas in the metal-insulator transition regime. Modifications primarily include a new ionization equilibrium model, consisting of a smooth blend between single ionization Saha (with a pressure ionization correction) and the generic Thomas-Fermi ionization equilibrium, a more accurate treatment of electron-neutral collisions using a polarization potential, and an empirical modification to the minimum allowed collision time. These simple modifications to the Lee-More algorithm permit a more accurate modeling of the physics near the metal-insulator transition, while preserving the generic Lee-More results elsewhere

  5. Practical improvements to the Lee-More conductivity near the metal-insulator transition

    International Nuclear Information System (INIS)

    Desjarlais, M.P.

    2001-01-01

    The wide-range conductivity model of Lee and More is modified to allow better agreement with recent experimental data and theories for dense plasmas in the metal-insulator transition regime. Modifications primarily include a new ionization equilibrium model, consisting of a smooth blend between single ionization Saha (with a pressure ionization correction) and the generic Thomas-Fermi ionization equilibrium, a more accurate treatment of electron-neutral collisions using a polarization potential, and an empirical modification to the minimum allowed collision time. These simple modifications to the Lee-More algorithm permit a more accurate modeling of the physics near the metal-insulator transition, while preserving the generic Lee-More results elsewhere. (orig.)

  6. Tim Berners-Lee, World Wide Web inventor

    CERN Multimedia

    1998-01-01

    The "Internet, Web, What's next?" conference on 26 June 1998 at CERN: Tim Berners-Lee, inventor of the World Wide Web and Director of the W3C, explains how the Web came to be and gave his views on the future.

  7. Alternative implementation of the chaotic Chen-Lee system

    International Nuclear Information System (INIS)

    Sheu, L.-J.; Tam, L.-M.; Chen, H.-K.; Lao, S.-K.

    2009-01-01

    The chaotic Chen-Lee system was developed with a formalism based on the Euler equations for the motion of a rigid body. It was proved that this system is the governing set of equations for gyro motion with feedback control. Recently, studies were conducted to explore the dynamic behavior of this system, including fractional order behavior, the generation of hyperchaos and perturbation analysis, control and anti-control of chaos, synchronization, etc. In this study, we further explore (1) the stability of the equilibrium points and (2) the implementation of an electronic circuit using the Chen-Lee system. It is shown that not only is this system related to gyro motion but can also be applied to electronic circuits for encryption purposes.

  8. Courtland Lee: A Global Advocate for Counseling

    Science.gov (United States)

    Gladding, Samuel T.

    2011-01-01

    Courtland Lee is exemplary in his accomplishments nationally and internationally. His academic achievements are notable in multicultural counseling and social justice. His leadership in counseling has been outstanding with his having served as president of the American Counseling Association, the Association for Multicultural Counseling and…

  9. Sara, a patient with borderline personality structure: A "crisis" management

    Directory of Open Access Journals (Sweden)

    Paola Marinelli

    2015-05-01

    Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma. 

  10. A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

    Science.gov (United States)

    Worthen, Helena Harlow

    2012-01-01

    The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…

  11. Nooruslikud juubilarid: fotokelder Lee 20 ja fotomuuseum 30 / Mall Parmas, Betty Ester-Väljaots

    Index Scriptorium Estoniae

    Parmas, Mall

    2013-01-01

    Peeter Toominga algatusel 1992. aastal asutatud Lee fotokeldrist. Loetletud fotomuuseumis oma töid eksponeerinud fotograafid. Ülevaatenäitus "Lee fotokelder 20" 17. jaanuarist 20. märtsini, koostaja Betty Ester-Väljaots

  12. Synchronization and anti-synchronization coexist in Chen-Lee chaotic systems

    International Nuclear Information System (INIS)

    Chen, J.-H.; Chen, H.-K.; Lin, Y.-K.

    2009-01-01

    This study demonstrates that synchronization and anti-synchronization can coexist in Chen-Lee chaotic systems by direct linear coupling. Based on Lyapunov's direct method, a linear controller was designed to assure that two different types of synchronization can simultaneously be achieved. Further, the hybrid projective synchronization of Chen-Lee chaotic systems was studied using a nonlinear control scheme. The nonlinear controller was designed according to the Lyapunov stability theory to guarantee the hybrid projective synchronization, including synchronization, anti-synchronization, and projective synchronization. Finally, numerical examples are presented in order to illustrate the proposed synchronization approach.

  13. Economist Innovation Award for Tim Berners-Lee

    CERN Multimedia

    2003-01-01

    In September, Tim Berners-Lee, who invented the World Wide Web at CERN and is now Director of the W3C World Wide Web Consortium, received the 2nd Economist Annual Innovation Award in Computing. With the award The Economist, a British weekly newspaper, recognises individuals responsible for breakthroughs in Bioscience, Computing, Energy and the Environment, and Telecommunications that have a profound impact on industry. A fifth award is given in a special "No Boundaries" category, observing innovation that transcends industries. Candidates for the awards are proposed by The Economist readers and writers, and by a group of judges. Tim Berners-Lee received the Computing award for his global hypertext project, to be known as the World Wide Web, which "forever altered the way information is shared" and is a huge contribution to the efficiency of the scientific community. Based on a programme for storing information using random associations called "Enquire", it...

  14. [Lee Jungsook, a Korean independence activist and a nurse during the Japanese colonial period].

    Science.gov (United States)

    Kim, Sook Young

    2015-04-01

    This article examines the life of Lee Jungsook, a Korean nurse, as a independence activist during the Japanese colonial period. Lee Jungsook(1896-1950) was born in Bukchung in Hamnam province. She studied at Chungshin girl's high school and worked at Severance hospital. The characteristics and culture of her educational background and work place were very important factors which influenced greatly the life of Lee Jungsook. She learned independent spirit and nationalism from Chungshin girls' high school and worked as nurse at the Severance hospital which were full of intense aspiration for Korea's independence. Many of doctors, professors and medical students were participated in the 3.1 Independence Movement. Lee Jungsook was a founding member of Hyulsungdan who tried to help the independence activists in prison and their families and worked as a main member of Korean Women's Association for Korean Independece and Kyungsung branch of the Korean Red Cross. She was sent to jail by the Japanese government for her independence activism. After being released after serving two years confinement, she worked for the Union for Women's Liberation as a founding member. Lee Joungsook was a great independence activist who had a nursing care spirit as a nurse.

  15. Test procedure for the Master-Lee and the modified Champion four inch hydraulic cutters

    International Nuclear Information System (INIS)

    Crystal, J.B.

    1995-01-01

    The Master-Lee and the modified Champion 4 Inch hydraulic cutters are being retested to gather and document information related to the following: determine if the Master-Lee cutters will cut the trunnions of an Aluminum fuel canister and a Stainless Steel fuel canister; determine if the Master-Lee cutters will cut 1 1/2 inch diameter fire hose; determine if the modified Champion 4 inch blade will cut sections of piping; and determine the effectiveness of the centering device for the Champion 4 Inch cutters. Determining the limitations of the hydraulic cutter will aid in the process of debris removal in the K-Basin. Based on a previous test, the cutters were returned to the manufacturer for modifications. The modifications to the Champion 4 Inch Cutter and further testing of the Master-Lee Cutter are the subjects of these feature tests

  16. Parametric study of the fractional-order Chen-Lee system

    International Nuclear Information System (INIS)

    Tam, L.M.; Tou, W.M.S.

    2008-01-01

    The dynamics of fractional-order systems have attracted a great deal of attention in recent years. In this paper, the effects of parameter changes on the dynamics of the fractional-order Chen-Lee system were studied numerically. The parameter ranges used were relatively broad. The order used for the system was fixed at 2.7 (q 1 = q 2 = q 3 = 0.9). The system displays rich dynamic behaviors, such as a fixed point, periodic motion (including period-3 motion), chaotic motion, and transient chaos. The chaotic motion identified was validated by the confirmation of a positive Lyapunov exponent. Period-doubling routes to chaos in the fractional-order Chen-Lee system were also found

  17. Lee Acculturation Dream Scale for Korean-American college students.

    Science.gov (United States)

    Lee, Sang Bok

    2005-04-01

    This study examined acculturation as represented in dream narratives of 165 Korean immigrant college students living in the USA. A total of 165 dreams were collected and evaluated using the Lee Acculturation Dream Scale, for which locations of dream contents were coded. 39% of the dreams took place in South Korea, while 38% were in the USA. Also, 16% of the dreams included both locations, whereas 7% had no specific dream location. The dreams contained overlapping dream messages, images, scenes, and interactions in both South Korea and the USA. A two-sample t test on the mean scores of the Lee Acculturation Dream Scale indicated no significant difference between men and women.

  18. Parametric study of the fractional-order Chen-Lee system

    Energy Technology Data Exchange (ETDEWEB)

    Tam, L.M. [Department of Electromechanical Engineering, Faculty of Science and Technology, University of Macau, Av. Padre Tomas Pereira S.J., Taipa, Macau (China)], E-mail: fstlmt@umac.mo; Tou, W.M.S. [Department of Electromechanical Engineering, Faculty of Science and Technology, University of Macau, Av. Padre Tomas Pereira S.J., Taipa, Macau (China)

    2008-08-15

    The dynamics of fractional-order systems have attracted a great deal of attention in recent years. In this paper, the effects of parameter changes on the dynamics of the fractional-order Chen-Lee system were studied numerically. The parameter ranges used were relatively broad. The order used for the system was fixed at 2.7 (q{sub 1} = q{sub 2} = q{sub 3} = 0.9). The system displays rich dynamic behaviors, such as a fixed point, periodic motion (including period-3 motion), chaotic motion, and transient chaos. The chaotic motion identified was validated by the confirmation of a positive Lyapunov exponent. Period-doubling routes to chaos in the fractional-order Chen-Lee system were also found.

  19. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Diego O Andrey

    Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  20. Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia

    Directory of Open Access Journals (Sweden)

    Tjitske F. Lawerman

    2017-12-01

    Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced

  1. Development of an ion guide coupled to an on-line isotope separation system on Sara. Identification and study of isospin exotic nuclei at Isolde and Sara

    International Nuclear Information System (INIS)

    Bouldjedri, A.

    1992-06-01

    This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements

  2. Pear distillates from pear juice concentrate: effect of lees in the aromatic composition.

    Science.gov (United States)

    García-Llobodanin, L; Achaerandio, I; Ferrando, M; Güell, C; López, F

    2007-05-02

    Pear juice obtained from pear concentrate was fermented at room temperature using Saccharomyces cerevisiae (BDX, ENOFERM, France) as the fermentation microorganism. During the fermentation process, total sugars were measured. High performance liquid chromatography analyses were used to monitor the fermentation process and to characterize the pear wine. The pear wine obtained was distilled with its lees using three different equipments: a glass alembic (a glass pot still coupled to a glass column), a copper alembic, and a glass alembic with the addition of 5 g/L of copper shavings to the pot still. The same distillations were repeated with the wine without its lees (separated by decanting). Several distillation fractions were collected, up to a total of 500 mL of distillate. Gas chromatography was used to identify and quantify the volatile compounds in each fraction, and the methanol and ethanol contents. Based on these results, the heart fraction was defined. ANOVA tests were performed on the heart fractions to determine quantitative differences between some volatile compounds depending on the equipment used and the presence or absence of the wine lees. From this series of ANOVA tests, it can be concluded that the concentrations of the compounds that are considered to have a negative effect on the quality of the distillates (methanol, ethyl acetate, furfural) decrease or do not change when they are distilled in the presence of lees and in the copper alembic. In addition, the concentrations of the positive compounds (ethyl decanoate and ethyl-2-trans-4-cis-decadienoate) increase in the presence of lees for all of the equipment tested. So, it can be assumed that the distillation of pear wine with its lees in copper alembic leads to a better quality product.

  3. SAPHIRE technical reference manual: IRRAS/SARA Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.

    1993-01-01

    This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix

  4. Berners-Lee wins inaugural Millennium Technology prize

    CERN Document Server

    2004-01-01

    "World Wide Web inventor Tim Berners-Lee today was named recipient of the first-ever Millennium Technology Prize. The honor, which is accompanied by one million euros, is bestowed by the Finnish Technology Award Foundation as an international acknowledgement of outstanding technological innovation aimed at promoting quality of life and sustainable economic and societal development" (1 page)

  5. SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-04-01

    The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

  6. Escribiendo el silencio: la contemplación poética de Sara Pujol

    Directory of Open Access Journals (Sweden)

    Gala, Candelas

    2005-06-01

    Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.

  7. Dan Gilmor Column [Berners-Lee and the WWW

    CERN Multimedia

    Gillmore, D

    2002-01-01

    In the keynote speech at the 11th Annual World Wide Web Conference, Tim Berner's Lee said that in the early days of the web, people were worrying about the same thing as today - one company dominating the market and controlling standards (2 pages).

  8. The Statecraft of Lee Kuan Yew, Visionary and Opportunist

    National Research Council Canada - National Science Library

    Thomas, David

    1996-01-01

    ...." "Not so," replied the passenger, Lee Kuan Yew, "Singapore intends to continue to ride along as part of the federation created with Malaysia, Sarawak, and Sabah -- we have no plans for getting off...

  9. General Robert E. Lee -- Brightest Star in the South

    National Research Council Canada - National Science Library

    Dalton, Kent B

    2006-01-01

    .... Lee's distinctive application of operational art and leadership as the commander of the Army of Northern Virginia, we can discern many lessons which are still pertinent to our commanders at the operational level today...

  10. Observation of Mountain Lee Waves with MODIS NIR Column Water Vapor

    Science.gov (United States)

    Lyapustin, A.; Alexander, M. J.; Ott, L.; Molod, A.; Holben, B.; Susskind, J.; Wang, Y.

    2014-01-01

    Mountain lee waves have been previously observed in data from the Moderate Resolution Imaging Spectroradiometer (MODIS) "water vapor" 6.7 micrometers channel which has a typical peak sensitivity at 550 hPa in the free troposphere. This paper reports the first observation of mountain waves generated by the Appalachian Mountains in the MODIS total column water vapor (CWV) product derived from near-infrared (NIR) (0.94 micrometers) measurements, which indicate perturbations very close to the surface. The CWV waves are usually observed during spring and late fall or some summer days with low to moderate CWV (below is approx. 2 cm). The observed lee waves display wavelengths from3-4 to 15kmwith an amplitude of variation often comparable to is approx. 50-70% of the total CWV. Since the bulk of atmospheric water vapor is confined to the boundary layer, this indicates that the impact of thesewaves extends deep into the boundary layer, and these may be the lowest level signatures of mountain lee waves presently detected by remote sensing over the land.

  11. Potential of lees from wine, beer and cider manufacturing as a source of economic nutrients: An overview.

    Science.gov (United States)

    Pérez-Bibbins, B; Torrado-Agrasar, A; Salgado, J M; Oliveira, R Pinheiro de Souza; Domínguez, J M

    2015-06-01

    Lees are the wastes generated during the fermentation and aging processes of different industrial activities concerning alcoholic drinks such as wine, cider and beer. They must be conveniently treated to avoid uncontrolled dumping which causes environmental problems due to their high content of phenols, pesticides, heavy metals, and considerable concentrations of nitrogen, phosphate and potassium as well as high organic content. The companies involved must seek alternative environmental and economic physicochemical and biological treatments for their revalorization consisting in the recovery or transformation of the components of the lees into high value-added compounds. After describing the composition of lees and market of wine, beer and cider industries in Spain, this work aims to review the recent applications of wine, beer and cider lees reported in literature, with special attention to the use of lees as an endless sustainable source of nutrients and the production of yeast extract by autolysis or cell disruption. Lees and/or yeast extract can be used as nutritional supplements with potential exploitation in the biotechnological industry for the production of natural compounds such as xylitol, organic acids, and biosurfactants, among others. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Corporate governance in Balkan financial institution, case of Albania

    Directory of Open Access Journals (Sweden)

    Rezart Dibra

    2013-06-01

    this paper is to make such connections and ground the policy debate on scientific evidence. The Corporate Governance in banks is one of the most important discussions overall the world, being reinforced especially after the crises period. It is related with the sensitive situation and the stage of developments of the local economy and moreover with the impact of the crises that is still ongoing. As an answer, during late 2008 and beginning 2009, it has been noticed a fast reaction and total focus from all banks on building (if missing and improving their structures of Corporate Governance. The liquidity problems suddenly affecting the banking sector constrained Banks to enlarge their activities / operations and forced them in better evaluating their investments. The importance of a strong financial sector in impacting the country’s economy growth through both level of banking development and stock market liquidity (Levine and Sara Zervos 1996, 1998 is quite evident even in the developing countries. Moreover, Peter Rousseau and Watchel (2000 findings’ confirm the positive impact of the stock market activity and the banking development. For this reason the governments in the developing countries are insisting in increasing credits of banks towards the private firms. The banking system in Bulgaria, Romania, Serbia and Albania has certain similarities in terms of development stage, related with the economic growth rate as well. The banking system, there is operating for more than 100 years instead of 15-20 years of development in the remaining countries.

  13. Os suínos da raça Bísara – oportunidades e desafios

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...

  14. Quantization of the Lee static model by the Bogolyubov transformation method

    International Nuclear Information System (INIS)

    Bornyakov, V.G.

    1984-01-01

    The Lee static strong-coupling model is studied. The model permits to find an exact solution for the state vector of the system and for the scattering matrix in the first permanent order of expansion in the inverse value of the coupling constant. The Bogolyubov method has been applied to quantize the Lee model with a hamiltonian, provided a high classical constituent of a boson field exists. Ground state of the system and scattering matrix from the obtained bound state are found. The way to avoid additional zero modes arising at Bogolyubov transformation for creation and annihilation operators is shown

  15. Co-ordinate single-cell expression of LEE4- and LEE5-encoded proteins of Escherichia coli O157:H7.

    Science.gov (United States)

    Roe, Andrew J; Naylor, Stuart W; Spears, Kevin J; Yull, Helen M; Dransfield, Tracy A; Oxford, Matthew; McKendrick, Iain J; Porter, Megan; Woodward, Martin J; Smith, David G E; Gally, David L

    2004-10-01

    Escherichia coli O157:H7 is a zoonotic pathogen that can express a type III secretion system (TTSS) considered important for colonization and persistence in ruminants. E. coli O157:H7 strains have been shown to vary markedly in levels of protein secreted using the TTSS and this study has confirmed that a high secretion phenotype is more prevalent among isolates associated with human disease than isolates shed by healthy cattle. The variation in secretion levels is a consequence of heterogeneous expression, being dependent on the proportion of bacteria in a population that are actively engaged in protein secretion. This was demonstrated by indirect immunofluorescence and eGFP fusions that examined the expression of locus of enterocyte effacement (LEE)-encoded factors in individual bacteria. In liquid media, the expression of EspA, tir::egfp, intimin, but not map::egfp were co-ordinated in a subpopulation of bacteria. In contrast to E. coli O157:H7, expression of tir::egfp in EPEC E2348/69 was equivalent in all bacteria although the same fusion exhibited variable expression when transformed into an E. coli O157:H7 background. An E. coli O157:H7 strain deleted for the LEE demonstrated weak but variable expression of tir::egfp indicating that the elements controlling the heterogeneous expression lie outside the LEE. The research also demonstrated the rapid induction of tir::egfp and map::egfp on contact with bovine epithelial cells. This control in E. coli O157:H7 may be required to limit exposure of key surface antigens, EspA, Tir and intimin during colonization of cattle but allow their rapid production on contact with bovine gastrointestinal epithelium at the terminal rectum.

  16. The Garrett Lee Smith Memorial Suicide Prevention Program

    Science.gov (United States)

    Goldston, David B.; Walrath, Christine M.; McKeon, Richard; Puddy, Richard W.; Lubell, Keri M.; Potter, Lloyd B.; Rodi, Michael S.

    2010-01-01

    In response to calls for greater efforts to reduce youth suicide, the Garrett Lee Smith (GLS) Memorial Act has provided funding for 68 state, territory, and tribal community grants, and 74 college campus grants for suicide prevention efforts. Suicide prevention activities supported by GLS grantees have included education, training programs…

  17. INCA Modelling of the Lee System: strategies for the reduction of nitrogen loads

    Directory of Open Access Journals (Sweden)

    N. J. Flynn

    2002-01-01

    Full Text Available The Integrated Nitrogen Catchment model (INCA was applied successfully to simulate nitrogen concentrations in the River Lee, a northern tributary of the River Thames for 1995-1999. Leaching from urban and agricultural areas was found to control nitrogen dynamics in reaches unaffected by effluent discharges and abstractions; the occurrence of minimal flows resulted in an upward trend in nitrate concentration. Sewage treatment works (STW discharging into the River Lee raised nitrate concentrations substantially, a problem which was compounded by abstractions in the Lower Lee. The average concentration of nitrate (NO3 for the simulation period 1995-96 was 7.87 mg N l-1. Ammonium (NH4 concentrations were simulated less successfully. However, concentrations of ammonium rarely rose to levels which would be of environmental concern. Scenarios were run through INCA to assess strategies for the reduction of nitrate concentrations in the catchment. The conversion of arable land to ungrazed vegetation or to woodland would reduce nitrate concentrations substantially, whilst inclusion of riparian buffer strips would be unsuccessful in reducing nitrate loading. A 50% reduction in nitrate loading from Luton STW would result in a fall of up to 5 mg N l-1 in the reach directly affected (concentrations fell from maxima of 13 to 8 mg N l-1 , nearly a 40 % reduction, whilst a 20% reduction in abstractions would reduce maximum peaks in concentration in the lower Lee by up to 4 mg l-1 (from 17 to 13 mg N l-1, nearly a 25 % reduction,. Keywords: modelling, water quality, nitrogen, nitrate, ammonium, INCA, River Lee, River Thames, land-use.

  18. Tim Berners-Lee: inventor de la World Wide Web

    OpenAIRE

    Universidad de Granada. Biblioteca

    2015-01-01

    El presente Cat??logo contiene la exposici??n organizada por la Biblioteca de la ETSIIT de la Universidad de Granada durante los meses de noviembre-diciembre de 2015 y titulada: "Tim Berners-Lee: inventor de la World Wide Web"

  19. Forecasting selected specific age mortality rate of Malaysia by using Lee-Carter model

    Science.gov (United States)

    Shukri Kamaruddin, Halim; Ismail, Noriszura

    2018-03-01

    Observing mortality pattern and trend is an important subject for any country to maintain a good social-economy in the next projection years. The declining in mortality trend gives a good impression of what a government has done towards macro citizen in one nation. Selecting a particular mortality model can be a tricky based on the approached method adapting. Lee-Carter model is adapted because of its simplicity and reliability of the outcome results with approach of regression. Implementation of Lee-Carter in finding a fitted model and hence its projection has been used worldwide in most of mortality research in developed countries. This paper studies the mortality pattern of Malaysia in the past by using original model of Lee-Carter (1992) and hence its cross-sectional observation for a single age. The data is indexed by age of death and year of death from 1984 to 2012, in which are supplied by Department of Statistics Malaysia. The results are modelled by using RStudio and the keen analysis will focus on the trend and projection of mortality rate and age specific mortality rate in the future. This paper can be extended to different variants extensions of Lee-Carter or any stochastic mortality tool by using Malaysia mortality experience as a centre of the main issue.

  20. Corporate Branding and Corporate Reputation

    DEFF Research Database (Denmark)

    Karmark, Esben

    2013-01-01

    Corporate branding has been seen as developing in “waves”. This chapter explores the links between corporate branding and corporate reputation as they emerge in the context of three waves of corporate branding. It highlights the way in which the two constructs have related to each other through o...... for corporate brands and corporate communication.......Corporate branding has been seen as developing in “waves”. This chapter explores the links between corporate branding and corporate reputation as they emerge in the context of three waves of corporate branding. It highlights the way in which the two constructs have related to each other through...... organizational culture and identity, and how, although characterized by parallel developments, new ideas and models from a “third” wave of corporate branding challenge prevailing assumptions of corporate reputation particularly in terms of the assumptions that reputations emerge from authentic and transparent...

  1. Relation between the Lee-Wick and Nambu-Jona-Lasinio models of chiral symmetry breaking

    International Nuclear Information System (INIS)

    Klevansky, S.P.; Lemmer, R.H.

    1990-01-01

    The connection between the sigma model of Lee and Wick and the Nambu-Jona-Lasinio (NJL) model is discussed. It is shown that the sigma field potential of the linear Lee-Wick model is identical in form with the variation of the vacuum energy of the NJL system with the baryonic scalar density n s . The sigma field is proportional to n s . Furthermore, the coupling constant and mass of this σ field are fully determined by the NJL model version of the Goldberger-Treiman relation. It is shown further that the restoration of chiral symmetry with increasing baryonic density always occurs via a second order transition in the NJL model, while it is necessarily of first order in the associated linear Lee-Wick model. (orig.)

  2. Persistence of the longnose darter (P. nasuta) in Lee Creek, Oklahoma

    Science.gov (United States)

    Gatlin, Michael R.; Long, James M.

    2011-01-01

    The longnose darter Percina nasuta (Bailey) is one of Oklahoma’s rarest fish species (1) and is listed by the state as endangered. Throughout the rest of its range, which includes Missouri, Arkansas and the far eastern portion of Oklahoma, the longnose darter is classified as “rare” or “threatened” (2, 3, 4, 5, 6, 1). This species inhabits both slow- and fast-water habitats with cobble and gravel substrates in medium to large streams (7, 8, 1). Oklahoma populations of longnose darter are known to occur only in the Poteau River and Lee Creek drainages in Le Flore and Sequoyah counties, respectively (9, 10). Cross and Moore (9) collected longnose darters from the Poteau River in 1947. The species was not collected in a subsequent survey of the Poteau River in 1974 (11), possibly because of the effects from the Wister Dam, which was completed in 1949. Darters are especially susceptible to flow alterations from dams (2, 12). This, together with the 1992 completion of Lee Creek Reservoir in Arkansas, has raised concern for the Lee Creek population of longnose darters (13).

  3. W3C head Berners-Lee to be knighted

    CERN Multimedia

    Gross, G

    2004-01-01

    "Tim Berners-Lee, credited with inventing the World Wide Web and now director of the World Wide Web Consortium, will be named a knight commander, Order of the British Empire, by Queen Elizabeth II, the W3C announced Wednesday" (1 page)

  4. Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.

    1994-11-01

    The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)

  5. T.D Lee and Lisa Randall visit ATLAS

    CERN Multimedia

    Pauline Gagnon

    Professor Tsung-Dao Lee, who received the Nobel Prize for Physics in 1957 for postulating that parity is not conserved in weak interactions, visited the ATLAS detector this month. He is seen here in the company of Peter Jenni, spokesperson for ATLAS. T.D. Lee is still very active at over 80, pursuing his theory work to this day. Professor Lisa Randall from Harvard University, the well-known theorist behind the Randall-Sundrum theory for extra dimensions, was also part of the group visiting the ATLAS detector. She is seen here with Fabiola Gianotti, deputy spokesperson for ATLAS. Lisa Randall's two initial papers have been quoted both more than 2500 times, making her the most cited theoretical physicist in the world in the last five years as of last autumn - a total of about 10,000 citations! One wonders here if Peter is pointing to a CP-violating graviton spotted in the ATLAS cavern... From left to right: Fabiola Gianotti, Gustaaf Brooijmans, convener of the ATLAS Exotics physics gro...

  6. Yang-Lee zeros for a Potts model of helix-coil transition with nontrivial topology

    International Nuclear Information System (INIS)

    Ananikian, N.; Ananikyan, L.; Artuso, R.; Sargsyan, K.

    2007-07-01

    The Yang-Lee partition function zeros of the Q-state Potts model on a zigzag ladder are studied by a transfer-matrix approach. This Q-state model has a non-trivial topology induced by three-site interactions on a zigzag ladder and is proposed as a description of helix-coil transition in homo-polymers. The Yang-Lee zeros are associated to complex values of the solvent-related coupling constant K (magnetic field) and they are exactly derived for arbitrary values of the system parameters: Q, J (coupling constant of hydrogen binding) and temperature. It is shown that there is only a quasi-phase transition for all temperatures. The densities of the Yang-Lee zeros are singular at the edge singularity points and the critical exponent σ = -1/2. (author)

  7. Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

    Science.gov (United States)

    Godwin, Allison; Potvin, Geoff

    2017-01-01

    This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…

  8. Lee waves: Benign and malignant

    Science.gov (United States)

    Wurtele, M. G.; Datta, A.; Sharman, R. D.

    1993-01-01

    The flow of an incompressible fluid over an obstacle will produce an oscillation in which buoyancy is the restoring force, called a gravity wave. For disturbances of this scale, the atmosphere may be treated as dynamically incompressible, even though there exists a mean static upward density gradient. Even in the linear approximation - i.e., for small disturbances - this model explains a great many of the flow phenomena observed in the lee of mountains. However, nonlinearities do arise importantly, in three ways: (1) through amplification due to the decrease of mean density with height; (2) through the large (scaled) size of the obstacle, such as a mountain range; and (3) from dynamically singular levels in the fluid field. These effects produce a complicated array of phenomena - large departure of the streamlines from their equilibrium levels, high winds, generation of small scales, turbulence, etc. - that present hazards to aircraft and to lee surface areas. The nonlinear disturbances also interact with the larger-scale flow in such a manner as to impact global weather forecasts and the climatological momentum balance. If there is no dynamic barrier, these waves can penetrate vertically into the middle atmosphere (30-100 km), where recent observations show them to be of a length scale that must involve the coriolis force in any modeling. At these altitudes, the amplitude of the waves is very large, and the phenomena associated with these wave dynamics are being studied with a view to their potential impact on high performance aircraft, including the projected National Aerospace Plane (NASP). The presentation shows the results of analysis and of state-of-the-art numerical simulations, validated where possible by observational data, and illustrated with photographs from nature.

  9. Polyphenols from Wine Lees as a Novel Functional Bioactive Compound in the Protection Against Oxidative Stress and Hyperlipidaemia

    Directory of Open Access Journals (Sweden)

    Irena Landeka Jurčević

    2017-01-01

    Full Text Available The study examines the potential of wine industry by-product, the lees, as a rich mixture of natural polyphenols, and its physiological potential to reduce postprandial metabolic and oxidative stress caused by a cholesterol-rich diet in in vivo model. Chemical analysis of wine lees showed that their total solid content was 94.2 %. Wine lees contained total phenols, total nonflavonoids and total flavonoids expressed in mg of gallic acid equivalents per 100 g of dry mass: 2316.6±37.9, 1332.5±51.1 and 984.1±28.2, respectively. The content of total anthocyanins expressed in mg of cyanidin-3-glucoside equivalents per 100 g of dry mass was 383.1±21.6. Antioxidant capacity of wine lees determined by the DPPH and FRAP methods and expressed in mM of Trolox equivalents per 100 g was 259.8±1.8 and 45.7±1.05, respectively. The experiment lasted 60 days using C57BL/6 mice divided in four groups: group 1 was fed normal diet and used as control, group 2 was fed normal diet with added wine lees, group 3 was fed high-cholesterol diet (HCD, i.e. normal diet with the addition of sunflower oil, and group 4 was fed HCD with wine lees. HCD increased serum total cholesterol (TC by 2.3-fold, triacylglycerol (TAG by 1.5-fold, low-density lipoprotein (LDL by 3.5-fold and liver malondialdehyde (MDA by 50 %, and reduced liver superoxide dismutase (SOD by 50 %, catalase (CAT by 30 % and glutathione (GSH by 17.5 % compared to control. Conversely, treatment with HCD and wine lees reduced TC and LDL up to 1.4 times more than with HCD only, with depletion of lipid peroxidation (MDA and restoration of SOD and CAT activities in liver, approximating values of the control. HDL levels were unaffected in any group. Serum transaminase activity showed no hepatotoxic properties in the treatment with lees alone. In the proposed model, wine lees as a rich polyphenol source could be a basis for functional food products without alcohol.

  10. Dynamical fragmentation of flux tubes in the Friedberg-Lee model

    International Nuclear Information System (INIS)

    Loh, S.; Greiner, C.; Mosel, U.; Thoma, M.H.

    1997-01-01

    We present two novel dynamical features of flux tubes in the Friedberg-Lee model. First the fusion of two (anti-)parallel flux tubes, where we extract a string-string interaction potential which has a qualitative similarity to the nucleon-nucleon potential in the Friedberg-Lee model obtained by Koepf et al. Furthermore we show the dynamical breakup of flux tubes via qq-particle production and the disintegration into mesons. We find, as a shortcoming of the present realization of the model, that the full dynamical transport approach presented in a previous publication fails to provide the disintegration mechanism in the semiclassical limit. Therefore, in addition, we present here a molecular dynamical approach for the motion of the quarks and show, as a first application, the space-time development of the quarks and their mean-fields for Lund-type string fragmentation processes. (orig.)

  11. Intermittency and dynamical Lee-Yang zeros of open quantum systems.

    Science.gov (United States)

    Hickey, James M; Flindt, Christian; Garrahan, Juan P

    2014-12-01

    We use high-order cumulants to investigate the Lee-Yang zeros of generating functions of dynamical observables in open quantum systems. At long times the generating functions take on a large-deviation form with singularities of the associated cumulant generating functions-or dynamical free energies-signifying phase transitions in the ensemble of dynamical trajectories. We consider a driven three-level system as well as the dissipative Ising model. Both systems exhibit dynamical intermittency in the statistics of quantum jumps. From the short-time behavior of the dynamical Lee-Yang zeros, we identify critical values of the counting field which we attribute to the observed intermittency and dynamical phase coexistence. Furthermore, for the dissipative Ising model we construct a trajectory phase diagram and estimate the value of the transverse field where the stationary state changes from being ferromagnetic (inactive) to paramagnetic (active).

  12. Tim Berners-Lee, World Wide Web inventor

    CERN Multimedia

    1994-01-01

    Former physicist, Tim Berners-Lee invented the World Wide Web as an essential tool for high energy physics at CERN from 1989 to 1994. Together with a small team he conceived HTML, http, URLs, and put up the first server and the first 'what you see is what you get' browser and html editor. Tim is now Director of the Web Consortium W3C, the International Web standards body based at INRIA, MIT and Keio University.

  13. Fundamental solution of bond pricing in the Ho-Lee stochastic interest rate model under the invariant criteria

    Directory of Open Access Journals (Sweden)

    Burhaneddin İzgi

    2017-03-01

    under the invariant criteria. We obtain transformations between Ho-Lee model with the corresponding linear (1 + 1 partial differential equation and the first Lie canonical form which is identical to the classical heat equation. These transformations help us to generate the fundamental solution for the Ho-Lee model with respect to the fundamental solution of the classical heat equation sense. Moreover, as a financial application of the Ho-Lee model, we choose the drift term from power functions and perform simulations via Milstein method. Furthermore, we obtain important results for the parameter calibration of the corresponding drift term by using the simulation results.

  14. Reading Sara Pujol Russell’s Poetry of Contemplation and Connection

    Directory of Open Access Journals (Sweden)

    Anita M. Hart

    2012-06-01

    Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.

  15. Duke Power's William Lee says INPO's purpose is solving industry problems, not educating the public

    International Nuclear Information System (INIS)

    Anon.

    1984-01-01

    Former Institute of Nuclear Power Operations (INPO) head, William Lee thinks that nuclear critics could misuse institute reports on investigations of nuclear plant construction and operation. If so, that would outweigh any public relations benefits of using the reports to inform and educate the public. Lee thinks the best way to gain public confidence is for the industry to perform well. The four-year-old institute was originally formed to improve operations, but recent problems with unfinished plants led to a system of construction audits. By offering guidance to companies building nuclear plants, INPO is meeting competition from utilities such as Duke Power, which is now marketing its expertise in designing and building plants. Lee emphasizes the importance of asking the right questions that will lead to quality control

  16. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    OpenAIRE

    Abdullah K. Shehabat

    2016-01-01

    This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...

  17. Deterministic and stochastic trends in the Lee-Carter mortality model

    DEFF Research Database (Denmark)

    Callot, Laurent; Haldrup, Niels; Kallestrup-Lamb, Malene

    2015-01-01

    The Lee and Carter (1992) model assumes that the deterministic and stochastic time series dynamics load with identical weights when describing the development of age-specific mortality rates. Effectively this means that the main characteristics of the model simplify to a random walk model with age...... mortality data. We find empirical evidence that this feature of the Lee–Carter model overly restricts the system dynamics and we suggest to separate the deterministic and stochastic time series components at the benefit of improved fit and forecasting performance. In fact, we find that the classical Lee......–Carter model will otherwise overestimate the reduction of mortality for the younger age groups and will underestimate the reduction of mortality for the older age groups. In practice, our recommendation means that the Lee–Carter model instead of a one-factor model should be formulated as a two- (or several...

  18. Hubungan Corporate Governance, Corporate Social Responsibilities dan Corporate Financial Performance Dalam Satu Continuum

    Directory of Open Access Journals (Sweden)

    Etty Murwaningsari

    2009-01-01

    Full Text Available This research aims to identify the influence of Good Corporate Governance, represented by institutional ownership and managerial ownership, on Corporate Social Responsibility and Corporate Financial Performance, and also to observe the possible influence of Corporate Social Responsibility on Corporate Financial Performance. This research examines 126 manufacturing companies which are listed in Indonesian Stock Exchange (ISX and have issued an audited financial statement for 2006. The statistical method used to test the hypothesis is Path Analysis. The result suggests that Good Corporate Governance influences both the disclosure of Corporate Social Responsibility and Corporate Financial Performance and that Corporate Social Responsibility significantly influences Corporate Financial Performance. The result also suggests that CEO Tenure, the controlling variable, holds a significant influence on the disclosure of Corporate Social Responsibility. Yet, there is no strong evidence to support the type of industries as an influencing factor of Corporate Social Responsibility. Furthermore, we found that the latter condition would also apply when we analyze the influence of Corporate Secretary and Nomination and Remuneration Committee on Corporate Financial Performance. Abstract in Bahasa Indonesia: Penelitian ini bertujuan untuk mengidentifikasi pengaruh antara struktur Coorporate Governance yang diproksikan sebagai kepemilikan institusional, kepemilikan manajerial terhadap corporate social responsibility dan corporate social responsibility terhadap corporate financial performance. Penelitian menggunakan data sekunder dari laporan tahunan 2006 perusahaan publik yang terdapat di Pusat Referensi Pasar Modal (PRPM Bursa Efek Indonesia (BEI. Sampel dalam penelitian ini sebanyak 126 perusahaan. Melalui pendekatan analisa jalur (path analysis menunjukkan Good Corporate Governance yaitu kepemilikan managerial dan institusional mempunyai pengaruh terhadap

  19. INCA Modelling of the Lee System: strategies for the reduction of nitrogen loads

    Science.gov (United States)

    Flynn, N. J.; Paddison, T.; Whitehead, P. G.

    The Integrated Nitrogen Catchment model (INCA) was applied successfully to simulate nitrogen concentrations in the River Lee, a northern tributary of the River Thames for 1995-1999. Leaching from urban and agricultural areas was found to control nitrogen dynamics in reaches unaffected by effluent discharges and abstractions; the occurrence of minimal flows resulted in an upward trend in nitrate concentration. Sewage treatment works (STW) discharging into the River Lee raised nitrate concentrations substantially, a problem which was compounded by abstractions in the Lower Lee. The average concentration of nitrate (NO3) for the simulation period 1995-96 was 7.87 mg N l-1. Ammonium (NH4) concentrations were simulated less successfully. However, concentrations of ammonium rarely rose to levels which would be of environmental concern. Scenarios were run through INCA to assess strategies for the reduction of nitrate concentrations in the catchment. The conversion of arable land to ungrazed vegetation or to woodland would reduce nitrate concentrations substantially, whilst inclusion of riparian buffer strips would be unsuccessful in reducing nitrate loading. A 50% reduction in nitrate loading from Luton STW would result in a fall of up to 5 mg N l-1 in the reach directly affected (concentrations fell from maxima of 13 to 8 mg N l-1 , nearly a 40 % reduction), whilst a 20% reduction in abstractions would reduce maximum peaks in concentration in the lower Lee by up to 4 mg l-1 (from 17 to 13 mg N l-1, nearly a 25 % reduction),.

  20. Corporate Law and Corporate Governance

    OpenAIRE

    Roberta Romano

    1998-01-01

    We have seen a revival in interest in corporate law and corporate governance since the 1980s, as researchers applied the tools of the new institutional economics and modern corporate finance to analyze the new transactions emerging in the 1980s takeover wave. This article focuses on three mechanisms of corporate governance to illustrate the analytical usefulness of transaction cost economics for corporate law. They are the board of directors; relational investing, a form of block ownership in...

  1. A critique of the Lees-Marshment market-oriented party model

    DEFF Research Database (Denmark)

    Ormrod, Robert P.

    2006-01-01

    This article presents conceptual and empirical criticisms of the Lees-Marshment market-oriented party model. Conceptual criticisms are the short-term approach, the narrow focus on voters, the nature of the relationship to competitors, a tendency towards centralisation and the lack of a distinction...

  2. Interactions between yeast lees and wine polyphenols during simulation of wine aging: I. Analysis of remnant polyphenolic compounds in the resulting wines.

    Science.gov (United States)

    Mazauric, Jean-Paul; Salmon, Jean-Michel

    2005-07-13

    Wine aging on yeast lees is a traditional enological practice used during the manufacture of wines. This technique has increased in popularity in recent years for the aging of red wines. Although wine polyphenols interact with yeast lees to a limited extent, such interactions have a large effect on the reactivity toward oxygen of wine polyphenolic compounds and yeast lees. Various domains of the yeast cell wall are protected by wine polyphenols from the action of extracellular hydrolytic enzymatic activities. Polysaccharides released during autolysis are thought to exert a significant effect on the sensory qualities of wine. We studied the chemical composition of polyphenolic compounds remaining in solution or adsorbed on yeast lees after various contact times during the simulation of wine aging. The analysis of the remnant polyphenols in the wine indicated that wine polyphenols adsorption on yeast lees follows biphasic kinetics. An initial and rapid fixation is followed by a slow, constant, and saturating fixation that reaches its maximum after about 1 week. Only very few monomeric phenolic compounds remained adsorbed on yeast lees, and no preferential adsorption of low or high polymeric size tannins occurred. The remnant condensed tannins in the wine contained fewer epigallocatechin units than the initial tannins, indicating that polar condensed tannins were preferentially adsorbed on yeast lees. Conversely, the efficiency of anthocyanin adsorption on yeast lees was unrelated to its polarity.

  3. Managing Corporate Reputation Through Corporate Branding

    DEFF Research Database (Denmark)

    Schultz, Majken; Hatch, Mary Jo; Adams, Nick

    2012-01-01

    This article, which concentrates on symbolic management by explaining the role of corporate branding in managing corporate reputation, using Novo Nordisk as a case study, presents three perspectives on corporate branding: the marketing perspective, the organisational perspective and the co...... is a way to influence corporate reputation. The Novo Nordisk management believes the data indicate that corporate branding influenced reputation more than the other way around. Formal brand management practices may work considerably better when they complement rather than try to control existing forces......-creation perspective. The three perspectives reviewed show the possibility of developing a multidisciplinary conceptualisation of corporate branding. They all offer insights important to managing organisations as corporate brands in a multi-stakeholder context and thus to the likelihood that corporate branding...

  4. The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

    International Nuclear Information System (INIS)

    Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan

    2013-01-01

    Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques

  5. Outlining the influence of non-conventional yeasts in wine ageing over lees.

    Science.gov (United States)

    Belda, Ignacio; Navascués, Eva; Marquina, Domingo; Santos, Antonio; Calderón, Fernando; Benito, Santiago

    2016-07-01

    During the last decade, the use of innovative yeast cultures of both Saccharomyces cerevisiae and non-Saccharomyces yeasts as alternative tools to manage the winemaking process have turned the oenology industry. Although the contribution of different yeast species to wine quality during fermentation is increasingly understood, information about their role in wine ageing over lees is really scarce. This work aims to analyse the incidence of three non-Saccharomyces yeast species of oenological interest (Torulaspora delbrueckii, Lachancea thermotolerans and Metschnikowia pulcherrima) and of a commercial mannoprotein-overproducer S. cerevisiae strain compared with a conventional industrial yeast strain during wine ageing over lees. To evaluate their incidence in mouthfeel properties of wine after 4 months of ageing, the mannoprotein content of wines was evaluated, together with other wine analytic parameters, such as colour and aroma, biogenic amines and amino acids profile. Some differences among the studied parameters were observed during the study, especially regarding the mannoprotein concentration of wines. Our results suggest that the use of T. delbrueckii lees in wine ageing is a useful tool for the improvement of overall wine quality by notably increasing mannoproteins, reaching values higher than obtained using a S. cerevisiae overproducer strain. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  6. Selective Migration among Southern Blacks: A Reinterpretation of Lee (1951).

    Science.gov (United States)

    Wolff, JosePh L.

    1979-01-01

    Explanations of differences in IQs of Northern and Southern Blacks focus on selective migration (hereditarians) or environmental causes such as education, discrimination and cultural deprivation. In this paper the environmentalist position is questioned and certain neglected features of Lee's data are construed as providing strong evidence for…

  7. Lee Miller à travers la Roumanie, l’appareil photo à la main (1946

    Directory of Open Access Journals (Sweden)

    Adrian-Silvan Ionescu

    2012-01-01

    Full Text Available A former model and fashion photographer turned war photographer, Lee Miller visited Romania twice, in 1938 and 1946 respectively. After her second visit she published her impressions and pictures, under the title of Roumania, in Vogue magazine. Besides the published material there are her manuscripts from The Lee Miller Achives at Farley Farm House, East Sussex, England, on which this paper is based. She crossed the border coming from Hungary in early February 1946. Heading for Sibiu her car, a Chevrolet Sedan, slipping on the ice-covered road, stopped on a snowbank far off in the ditch. While looking for help in the nearby village she and her companions left the car unguarded to discover it plundered of everything, wheels included.On a Sunday afternoon she had the privilege of being received by King Mihai I and Queen Mother Elena with whom she talked exstensively. She also took magnificent pictures with the Royal Family in the imposing Peleş Castle. At Sinaia, „the summer capital of Roumania” she had also the opportunity to portray Dinu Brătianu and Iuliu Maniu, the two elderly statesmen. Maniu was surrounded by friends and party members, among whom was young Corneliu Coposu, his private secretary.Moving to Bucharest, she met old friends such as Harri Brauner and his wife, Lena Constante, with whom she wandered through the country eight years ago. Lena and Elena Pătrășcanu, wife of Lucrețiu Pătrășcanu, Minister of Justice, have started a successful marionette theatre where Lee took nice pictures. Other were taken on the streets, with peasants, street vendors and their customers. Harri took her to a bistro where they met Maria Lătărețu, the celebrating folk singer whom Brauner recorded many times. They enjoyed her songs. Suffering from fibrositis, Lee Miller undertook a peculiar treatment in a gypsy village where the inhabitants were dancing bears trainers. She was massaged by a bear weighing about 300 pounds while Brauner took

  8. A State-Space Estimation of the Lee-Carter Mortality Model and Implications for Annuity Pricing

    OpenAIRE

    Man Chung Fung; Gareth W. Peters; Pavel V. Shevchenko

    2015-01-01

    In this article we investigate a state-space representation of the Lee-Carter model which is a benchmark stochastic mortality model for forecasting age-specific death rates. Existing relevant literature focuses mainly on mortality forecasting or pricing of longevity derivatives, while the full implications and methods of using the state-space representation of the Lee-Carter model in pricing retirement income products is yet to be examined. The main contribution of this article is twofold. Fi...

  9. sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

    DEFF Research Database (Denmark)

    Christner, Martin; Heinze, Constanze; Busch, Michael

    2012-01-01

    to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...

  10. Brassia campestris L. ssp. chinensis L.var. utilis Tsen et Lee

    African Journals Online (AJOL)

    omodibo

    2012-12-31

    Dec 31, 2012 ... On the basis of morphological and cultural features, the pathogen ... Alternaria isolate from Purple-Caitai showed 99% identity with other ITS sequences of .... Cho KH, Park SH, Kim KT, Kim S, Kim JS, Park BS, Woo JG, Lee HJ.

  11. Numerical Simulation of a Lee Wave Case over Three-Dimensional Mountainous Terrain under Strong Wind Condition

    Directory of Open Access Journals (Sweden)

    Lei Li

    2013-01-01

    Full Text Available This study of a lee wave event over three-dimensional (3D mountainous terrain in Lantau Island, Hong Kong, using a simulation combining mesoscale model and computational fluid dynamics (CFD model has shown that (1 3D steep mountainous terrain can trigger small scale lee waves under strong wind condition, and the horizontal extent of the wave structure is in a dimension of few kilometers and corresponds to the dimension of the horizontal cross-section of the mountain; (2 the life cycle of the lee wave is short, and the wave structures will continuously form roughly in the same location, then gradually move downstream, and dissipate over time; (3 the lee wave triggered by the mountainous terrain in this case can be categorized into “nonsymmetric vortex shedding” or “turbulent wake,” as defined before based on water tank experiments; (4 the magnitude of the wave is related to strength of wind shear. This study also shows that a simulation combining mesoscale model and CFD can capture complex wave structure in the boundary layer over realistic 3D steep terrain, and have a potential value for operational jobs on air traffic warning, wind energy utilization, and atmospheric environmental assessment.

  12. Corporate against corporate management

    OpenAIRE

    Runcev, Nikolce; Krstev, Boris; Golomeova, Mirjana

    2010-01-01

    In contemporary economic performance, corporate governance is considered an essential prerequisite in building a successful system for creating an attractive investment climate, which is characterized by competing companies oriented and efficient financial markets. Good corporate governance is based on principles of transparency, bias, efficiency, timeliness, completeness and accuracy of information at all levels of management. Companies with good corporate governance and afford easier acc...

  13. TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

    Energy Technology Data Exchange (ETDEWEB)

    1989-03-01

    This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.

  14. Social humanoid robot SARA: development of the wrist mechanism

    Science.gov (United States)

    Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.

    2018-01-01

    This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.

  15. Markkinointisuunnitelma digitaaliseen markkinointiin Case Baan Lee Beach Resort & Sauna

    OpenAIRE

    Lähteenmäki, Essi

    2017-01-01

    Tämän opinnäytetyön tavoitteena on kehittää Baan Lee Beach Resort & Saunan digitaalista markkinointia markkinointisuunnitelman avulla. Yritys on aloittamassa liiketoimintaansa erittäin kilpailulla alalla, jossa digitaalinen markkinointi on tärkeä osa kilpailussa menestymistä ja se on otettava huomioon yrityksen markkinointistrategian tärkeänä osana. Markkinointisuunnitelmalla pyritään takaamaan markkinointistrategian mukainen toiminta. Markkinointisuunnitelmassa kuvataan yrityksen nykyti...

  16. Servicing the first web server - Tim Berners-Lee's NeXT

    CERN Multimedia

    unknown, Association aBCM

    2009-01-01

    In August 2009 a team from the Association aBCM in Lausanne came to CERN to give the world's first web server a health check under the watchful eye of web pioneer Robert Cailliau. They took an image of the hard drive at this time, copies of which were given to Robert Cailliau and Tim Berners-Lee.

  17. Hubungan Corporate Governance, Corporate Social Responsibilities dan Corporate Financial Performance Dalam Satu Continuum

    OpenAIRE

    Etty Murwaningsari

    2009-01-01

    This research aims to identify the influence of Good Corporate Governance, represented by institutional ownership and managerial ownership, on Corporate Social Responsibility and Corporate Financial Performance, and also to observe the possible influence of Corporate Social Responsibility on Corporate Financial Performance. This research examines 126 manufacturing companies which are listed in Indonesian Stock Exchange (ISX) and have issued an audited financial statement for 2006. The statist...

  18. A relation between deformed superspace and Lee-Wick higher-derivative theories

    Science.gov (United States)

    Dias, M.; Ferrari, A. F.; Palechor, C. A.; Senise, C. R., Jr.

    2015-07-01

    We propose a non-anticommutative superspace that relates to the Lee-Wick type of higher-derivative theories, which are known for their interesting properties and have led to proposals of phenomenologically viable higher-derivative extensions of the Standard Model. The deformation of superspace we consider does not preserve supersymmetry or associativity in general, but, we show that a non-anticommutative version of the Wess-Zumino model can be properly defined. In fact, the definition of chiral and antichiral superfields turns out to be simpler in our case than in the well known N=1/2 supersymmetric case. We show that when the theory is truncated at the first nontrivial order in the deformation parameter, supersymmetry is restored, and we end up with a well-known Lee-Wick type of higher-derivative extension of the Wess-Zumino model. Thus, we show how non-anticommutativity could provide an alternative mechanism for generating these higher-derivative theories.

  19. Corporate Responsibility

    DEFF Research Database (Denmark)

    Waddock, Sandra; Rasche, Andreas

    2015-01-01

    We define and discuss the concept of corporate responsibility. We suggest that corporate responsibility has some unique characteristics, which makes it different from earlier conceptions of corporate social responsibility. Our discussion further shows commonalities and differences between corporate...... responsibility and related concepts, such as corporate citizenship and business ethics. We also outline some ways in which corporations have implemented corporate responsibility in practice....

  20. Forecasting the mortality rates using Lee-Carter model and Heligman-Pollard model

    Science.gov (United States)

    Ibrahim, R. I.; Ngataman, N.; Abrisam, W. N. A. Wan Mohd

    2017-09-01

    Improvement in life expectancies has driven further declines in mortality. The sustained reduction in mortality rates and its systematic underestimation has been attracting the significant interest of researchers in recent years because of its potential impact on population size and structure, social security systems, and (from an actuarial perspective) the life insurance and pensions industry worldwide. Among all forecasting methods, the Lee-Carter model has been widely accepted by the actuarial community and Heligman-Pollard model has been widely used by researchers in modelling and forecasting future mortality. Therefore, this paper only focuses on Lee-Carter model and Heligman-Pollard model. The main objective of this paper is to investigate how accurately these two models will perform using Malaysian data. Since these models involves nonlinear equations that are explicitly difficult to solve, the Matrix Laboratory Version 8.0 (MATLAB 8.0) software will be used to estimate the parameters of the models. Autoregressive Integrated Moving Average (ARIMA) procedure is applied to acquire the forecasted parameters for both models as the forecasted mortality rates are obtained by using all the values of forecasted parameters. To investigate the accuracy of the estimation, the forecasted results will be compared against actual data of mortality rates. The results indicate that both models provide better results for male population. However, for the elderly female population, Heligman-Pollard model seems to underestimate to the mortality rates while Lee-Carter model seems to overestimate to the mortality rates.

  1. 25 CFR 226.8 - Corporation and corporate information.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Corporation and corporate information. 226.8 Section 226... RESERVATION LANDS FOR OIL AND GAS MINING Leasing Procedure, Rental and Royalty § 226.8 Corporation and corporate information. (a) If the applicant for a lease is a corporation, it shall file evidence of...

  2. Optimization Evaluation: Lee Chemical Superfund Site, City Of Liberty, Clay County, Missouri

    Science.gov (United States)

    The Lee Chemical Superfund Site (site) is located along Missouri Highway 210 in Liberty, Missouri, approximately 15 miles east of Kansas City, Missouri. Currently, the site is a vacant lot of approximately2.5 acres in a flat alluvial plain.

  3. Komisjon plaanib ökotoodete eelistamist liidu hangetel / Merike Lees

    Index Scriptorium Estoniae

    Lees, Merike, 1976-

    2004-01-01

    Euroopa Komisjon kavatseb luua reeglid, mis annavad hangetel eelise lisaks keskkonnajuhtimisstandardeid rakendanud ettevõtetele ka ühenduse ökomärgist omavatele toodetele. Ettevõtete juhtide kommentaarid ökomärgise kasutamise kohta. Lisad: Ökotoode peab vastama ligi paarikümnele kriteeriumile; Ökomärgise litsentsi eeltöö tehakse Eestis. Vt. samas: Ökomärgise litsentsi väljastav pädev asutus tuleb Eestisse. Kommenteerivad Merike Lees ja Anu-Maaja Pallok

  4. Tentative identification of polar and mid-polar compounds in extracts from wine lees by liquid chromatography-tandem mass spectrometry in high-resolution mode.

    Science.gov (United States)

    Delgado de la Torre, M P; Priego-Capote, F; Luque de Castro, M D

    2015-06-01

    Sustainable agriculture has a pending goal in the revalorization of agrofood residues. Wine lees are an abundant residue in the oenological industry. This residue, so far, has been used to obtain tartaric acid or pigments but not for being qualitatively characterized as a source of polar and mid-polar compounds such as flavonoids, phenols and essential amino acids. Lees extracts from 11 Spanish wineries have been analyzed by liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS) in high resolution mode. The high-resolution power of LC-MS/MS has led to the tentative identification of the most representative compounds present in wine lees, comprising primary amino acids, anthocyans, flavanols, flavonols, flavones and non-flavonoid phenolic compounds, among others. Attending to the profile and content of polar and mid-polar compounds in wine lees, this study underlines the potential of wine lees as an exploitable source to isolate interesting compounds. Copyright © 2015 John Wiley & Sons, Ltd.

  5. The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters

    International Nuclear Information System (INIS)

    Iazzourene, F.

    1982-01-01

    The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr

  6. Instructional materials for SARA/OSHA training. Volume 1, General site working training

    Energy Technology Data Exchange (ETDEWEB)

    Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)

    1988-04-01

    This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.

  7. HISTORY EDUCATION - SOME THOUGHTS FROM THE UK: interviews Peter J. Lee

    Directory of Open Access Journals (Sweden)

    Cristiani Bereta da Silva

    2014-05-01

    Peter Lee was, until he very recently retired, a senior lecturer in the History Education Unit at the Institute of Education at the University of London. Having taught History in primary and secondary schools, Professor Lee has coordinated several research projects related to History Teaching and Learning, including CHATA (Concepts of History and Teaching Approaches a project well-known in Brazil. Several of his publications investigate the ideas that children and teenagers have over History in several books, chapters, and articles – many of these with Rosalyn Ashby as co-author.  Some of his articles have been translated to Portuguese, circulating among researchers concerned with understanding how children learn History. The questions in this interview have been elaborated so that Peter Lee’s reflections may collaborate with the development of History Teaching and History Education research in Brazil. All contact has been made via e-mail, a rather useful tool that has shortened the distance between Florianópolis and London for a few long moments between July and October 2012.

  8. ' "Life is Movement": Vernon Lee and Sculpture'

    DEFF Research Database (Denmark)

    Østermark-Johansen, Lene

    2018-01-01

    How do living, breathing human bodies respond to the inert bodies of sculpture? This article examines some of the art-theoretical and psychological writings of Violet Paget (‘Vernon Lee’) and Clementina Anstruther-Thomson of the 1880s and 1890s in an attempt to map the evolution of their formalist...... art criticism. Engaging with the eighteenth-century ghosts of Johann Joachim Winckelmann and Gotthold Ephraim Lessing, Lee and Anstruther-Thomson created their very own exploration of art forms evolving in space and in time. Questioning how our reading of literature affects our reading of sculpture...... from Lee’s early essays in Belcaro: Being Essays on Sundry Aesthetical Questions (1881) to the late collaborative volume Art and Man (1924)....

  9. Looking for Asian butch-dykes: exploring filmic representations of East Asian butch-dykes in Donna Lee's Enter the Mullet.

    Science.gov (United States)

    Lin, Hui-Ling

    2009-01-01

    Asian butch-dykes have been overlooked in analyses of Chinese cinema, studies that often concentrate on "feminized" transgender roles. This article examines cinematic representations of Asian butch-dykes through film analysis of Enter the Mullet (2004), a five-minute short, and in-depth interviews with the filmmaker, Donna Lee, a Chinese-Canadian in Vancouver. Lee's film is inspired by Enter the Dragon (1973), starring Bruce Lee, the most recognized icon of Asian masculinity. Combining with the mullet hairstyle, which is often associated with White working-class, the filmmaker introduces viewers to the hybrid masculinity of Asian butch-dykes. The article argues that Asian female masculinity can be a strategic means of destabilizing the hegemony of White-male-middle-class masculinity.

  10. Vertical structure and microphysical characteristics of precipitation on the high terrain and lee side of the Olympic Mountains

    Science.gov (United States)

    Zagrodnik, J. P.; McMurdie, L. A.; Houze, R.

    2017-12-01

    As mid-latitude cyclones pass over coastal mountain ranges, the processes producing their clouds and precipitation are modified when they encounter complex terrain, leading to a maximum in precipitation fallout on the windward slopes and a minimum on the lee side. The precipitation that does reach the high terrain and lee side of a mountain range can be theoretically determined by a complex interaction between the dynamics of air lifting over the terrain, the thermodynamics of moist air, and the microphysical time required to grow particles large enough to fall out. To date, there have been few observational studies that have focused on the nonlinear microphysical processes contributing to the variability of precipitation that is received on the lee side slopes of a mountain range such as the Olympic Mountains. The 2015-16 Olympic Mountains Experiment (OLYMPEX) collected unprecedented observations on the high terrain and lee side of the Olympic Mountains including frequent soundings on Vancouver Island, dual-polarization Doppler radar, multi-frequency airborne radar, and ground-based particle size and crystal habit observations at the higher elevation Hurricane Ridge site. We utilize these observations to examine the evolution of the vertical structure and microphysical precipitation characteristics over the high terrain and leeside within the context of large-scale dynamic and thermodynamic conditions that evolve during the passage of cold season mid-latitude cyclones. The primary goal is to determine the degree to which the observed variability in lee side precipitation amount and microphysical properties are controlled by variations in temperature, flow speed and direction, shear, and stability associated with characteristic synoptic storm sectors and frontal passages.

  11. The Relationship of Corporate Governance, Corporate Social Responsibilities and Corporate Financial Performance in One Continuum

    OpenAIRE

    Murwaningsari, Etty

    2010-01-01

    This study aims to identify the impact of Good Corporate Governance, represented by institutional ownership and managerial ownership, on Corporate Social Responsibility and Corporate Financial Performance.It examines 126 manufacturing companies listed at the Indonesian Stock Exchange (IDX) and have issued audited financial statements for 2006. The statistical method used to test the hypothesis is Path Analysis. The main results suggest that Good Corporate Governance has effects on both Corpor...

  12. On the Seventh Day, He Rested: Lee Kuan Yew and the Creation of Singapore

    National Research Council Canada - National Science Library

    Neary, Patrick C

    1997-01-01

    ...-oriented domestic policies in pursuit of national goals. Lee's paternal authoritarianism proved to be highly successful, but this success sowed the seeds of discontent now producing weeds in his island paradise.

  13. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  14. Phenolic characterization of aging wine lees: Correlation with antioxidant activities.

    Science.gov (United States)

    Romero-Díez, R; Rodríguez-Rojo, S; Cocero, M J; Duarte, C M M; Matias, A A; Bronze, M R

    2018-09-01

    Aging wine lees are water-wastes produced during the wine aging inside wood barrels that can be considered as alternative sources of bioactive compounds. Phenolic characterization and antioxidant activity (AA) measurements of wines lees solid-liquid extracts have been undertaken on a dry extract (DE) basis. Solvents with different polarities (water, methanol, ethanol, two hydroalcoholic mixtures and acetone) were used. Total phenolic (TPC) and total flavonoid contents (TFC) were determined. The mixture of 75:25(v/v) EtOH:H 2 O showed the highest values with 254 mg GAE /g DE and 146 mg CATE /g DE respectively. HORAC, HOSC and FRAP were used to determine the AA of the extracts being also highest for the mixture of 75:25(v/v) EtOH:H 2 O (4690 µmol CAE /g DE , 4527 µmol TE /g DE and 2197 µmol TE /g DE , respectively). For ORAC method, methanol extract showed the best value with 2771 µmol TE /g DE . Correlations between TPC, TFC, phenolic compounds and AA were determined. Most relevant compounds contributing to AA were identified using data from mass spectrometry, being mainly anthocyanins. Copyright © 2018 Elsevier Ltd. All rights reserved.

  15. Symposium on Molecular Spectroscopy (40th) Held at Columbus, Ohio on 17-21 June 1985.

    Science.gov (United States)

    1985-06-21

    INFRARED-MICROWAVE SIDEBAND LASER SPECTROSCOPY OF THE v, AND 2v,*v, BANDS OF 1𔃽CHF’ SANG LEE, R. H. SCHWENDEMAN, AND GOTTFRIED MAGERL Approximately...University, Mississippi State, Mississippi 39762 FA6. (9:4 FORCE CONSTANTS FOR THE CYCLOPROPENYL CATION NORMAN C. CRAIG, JULIANTO PRANATA, SARA JAMIE...WHJO RA14 MAESSEN, B.--RFl4, RF15 HEAVEN, M. C. --MG7, MG8, MG9, KENNY,’ J. E.--MF9, M[FlO, M_7l1 MAGERL, GOTTFRIED --RF5 Presiding over Session MG

  16. Lee-side flow structures of very low aspect ratio cruciform wing–body configurations

    CSIR Research Space (South Africa)

    Tuling, S

    2013-12-01

    Full Text Available A numerical and experimental investigation was performed to study the dominant flow structures in the lee side of a cruciform wing–body configuration at supersonic speeds in the + orientation. The wings or strakes are of very low aspect ratio...

  17. Näitleja Tommy Lee Jonesi meditatsioon režissööritoolis / Andris Feldmanis

    Index Scriptorium Estoniae

    Feldmanis, Andris, 1982-

    2007-01-01

    Vestern "Melquiades Estrada kolm matust" ("The Three Burials of Melquiades Estrada") : stsenarist Guillermo Arriaga : režissöör ja osatäitja Tommy Lee Jones : operaator Chris Menges : Ameerika Ühendriigid, 2005

  18. Corporate Brand Trust as a Mediator in the Relationship between Consumer Perception of CSR, Corporate Hypocrisy, and Corporate Reputation

    Directory of Open Access Journals (Sweden)

    Hanna Kim

    2015-03-01

    Full Text Available The aim of this research is to investigate the relationship between consumer perception of Corporate Social Responsibility (CSR, corporate brand trust, corporate hypocrisy, and corporate reputation. Based on the one-to-one interview method using a structured questionnaire of 560 consumers in South Korea, the proposed model was estimated by structural equation modeling analysis. The model suggests that consumer perception of CSR influences consumer attitudes toward a corporation (i.e., perceived corporate hypocrisy and corporate reputation by developing corporate brand trust. This in turn further enhances corporate reputation while decreasing corporate hypocrisy. The findings of our study demonstrate that consumer perception of CSR is an antecedent to corporate brand trust, which fully mediates the relationship between consumer perception of CSR and corporate reputation. In addition, corporate brand trust has the role of partial mediator in the relationship between consumer perception of CSR and corporate hypocrisy. These results imply that to better understand the relationship between consumer perception of CSR and consumer attitudes toward a corporation, it is necessary to consider corporate brand trust as an important mediating variable. The theoretical and practical implications of this study are discussed, together with its limitations and potential for future research.

  19. Corporate finance

    OpenAIRE

    P. Quiry; Y. Le Fur; A. Salvi; M. Dallocchio; P. Vernimmen

    2011-01-01

    Corporate Finance: Theory and Practice, 3rd Edition, the website www.vernimmen.com and the Vernimmen.com newsletter are all written and created by an author team who are both investment bankers/corporate financiers and academics. This book covers the theory and practice of Corporate Finance from a truly European perspective. It shows how to use financial theory to solve practical problems and is written for students of corporate finance and financial analysis and practising corporate financie...

  20. Comparison of a new digital KM screen test with conventional Hess and Lees screen tests in the mapping of ocular deviations.

    Science.gov (United States)

    Thorisdottir, Rannveig Linda; Sundgren, Johanna; Sheikh, Rafi; Blohmé, Jonas; Hammar, Björn; Kjellström, Sten; Malmsjö, Malin

    2018-05-28

    To evaluate the digital KM screen computerized ocular motility test and to compare it with conventional nondigital techniques using the Hess and Lees screens. Patients with known ocular deviations and a visual acuity of at least 20/100 underwent testing using the digital KM screen and the Hess and Lees screen tests. The examination duration, the subjectively perceived difficulty, and the patient's method of choice were compared for the three tests. The accuracy of test results was compared using Bland-Altman plots between testing methods. A total of 19 patients were included. Examination with the digital KM screen test was less time-consuming than tests with the Hess and Lees screens (P digital KM screen). Patients found the test with the digital KM screen easier to perform than the Lees screen test (P = 0.009) but of similar difficulty to the Hess screen test (P = 0.203). The majority of the patients (83%) preferred the digital KM screen test to both of the other screen methods (P = 0.008). Bland-Altman plots showed that the results obtained with all three tests were similar. The digital KM screen is accurate and time saving and provides similar results to Lees and Hess screen testing. It also has the advantage of a digital data analysis and registration. Copyright © 2018 American Association for Pediatric Ophthalmology and Strabismus. Published by Elsevier Inc. All rights reserved.

  1. Corporate Social Responsibility of Multinational Oil Corporations to ...

    African Journals Online (AJOL)

    Corporate Social Responsibility of Multinational Oil Corporations to Host ... Exxon Mobil and Elf oil Nigeria Limited within their corporate-community relations strategy in the ... The paper concludes by exploring the implications for partnerships' ...

  2. Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

    Directory of Open Access Journals (Sweden)

    Helena López

    2013-07-01

    Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.

  3. How Corporate Governance Affects Strategy of Corporations : - Lessons from Enron Corporation -

    OpenAIRE

    Ahmed, Hameed; Najam, Ali

    2006-01-01

    Corporate governance is a subject of academic and professional debate. It has and it will continue to be a topic under scrutiny for subsequent deliberations since there are many different research dimensions and contexts associated with it. However, it has been observed that the linkage between corporate governance and strategy of a corporation remains as an untapped area with considerable avenues of research. This paper tends to explore this linkage, using Enron scandal as backdrop. In the a...

  4. The Pitzer-Lee-Kesler-Teja (PLKT) Strategy and Its Implementation by Meta-Computing Software

    Czech Academy of Sciences Publication Activity Database

    Smith, W. R.; Lísal, Martin; Missen, R. W.

    2001-01-01

    Roč. 35, č. 1 (2001), s. 68-73 ISSN 0009-2479 Institutional research plan: CEZ:AV0Z4072921 Keywords : The Pitzer -Lee-Kesler-Teja (PLKT) strategy * implementation Subject RIV: CF - Physical ; Theoretical Chemistry

  5. Corporate identity as a factor of corporate security

    OpenAIRE

    Perelygina, Elena

    2011-01-01

    Forming-up of the corporate identity is based on cognitive, affective and conative elements of corporate culture. The group as an entity choosing goals and values ensures a certain response to standards and values of corporate culture within the parameters of its social responsibility. Corporate security as security of community and cooperation acts as a form of organizational and ethical approach to developing socially responsible attitude of government and business.

  6. Ocean PHILLS Data Collection and Processing: May 2000 Deployment, Lee Stocking Island, Bahamas

    National Research Council Canada - National Science Library

    Leathers, Robert

    2002-01-01

    .... It was deployed in a region near Lee Stocking Island (LSI), Bahamas in May 2000. This document describes the LSI 2000 PHILLS data set and the manner in which it was processed to obtain remote-sensing reflectance images for use by the scientific community...

  7. A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta

    OpenAIRE

    Carvalho, Marieta

    2014-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...

  8. Comparison of Benedict-Webb-Rubin, Starling and Lee-Kesler equations of state for use in P-V-T calculations

    International Nuclear Information System (INIS)

    McFee, D.G.; Mueller, K.H.; Lielmezs, J.

    1982-01-01

    By means of the available experimental gas compressibility data, the predictive accuracy of the Benedict-Webb-Rubin, Starling and Lee-Kesler equations was tested over wide temperature and pressure ranges for the following commonly used industrial gases: CH 4 , C 2 H 6 , C 3 H 8 , CO 2 , Ar, He, H 2 and N 2 . The root mean square (RMS) percent errors calculated over the T-P range investigated for all compounds, showed a degree of superiority and ease of use of the Lee-Kesler equation over the Benedict-Webb-Rubin and Starling equations. In order to treat quantal fluids H 2 and He, the Benedict-Webb-Rubin equation was modified by making constant B 0 temperature dependent, while the Starling and Lee-Kesler equations were rewritten through inclusion of quantum effect corrected pseudo-critical state parameters. (orig.)

  9. 77 FR 18852 - Lee Metcalf National Wildlife Refuge, Stevensville, MT; Draft Comprehensive Conservation Plan and...

    Science.gov (United States)

    2012-03-28

    ... business hours at the Lee Metcalf National Wildlife Refuge headquarters located at 4567 Wildfowl Lane... habitats and has created and modified wetlands. Riverfront forest includes early succession tree species...

  10. Corporate Identity as a Factor of Corporate Security

    Directory of Open Access Journals (Sweden)

    Elena B. Perelygina

    2011-01-01

    Full Text Available Forming-upof the corporate identity is based on cognitive, affective and conative elements of corporate culture. The group as an entity choosing goals and values ensures a certain response to standards and values of corporate culture within the parameters of its social responsibility. Corporate security as security of community and cooperation acts as a form of organizational and ethical approach to developing socially responsible attitude of government and business.

  11. Tuning of Lee Path Loss Model based on recent RF measurements in 400 MHZ conducted in Riyadh City, Saudi Arabia

    International Nuclear Information System (INIS)

    Alotaibi, Faihan D.; Ali, Adel A.

    2008-01-01

    In mobile radio systems, path loss models are necessary for proper planning, interference estimations, frequently assignments and cell parameters which are basic for network planning process as well as Location Based Services (LBS) techniques that are not based on GPS system. Empirical models are the most adjustable models that can be suited to different types of environments. In this paper, the Lee path loss model has been tuned using Least Square (LS) algorithm to fit measured data for TETRA system operating 400 MHz in Riyadh urban and suburbs. Consequently, Lee model's parameter (L0, y) are obtained for the targeted areas. The performance of the tuned Lee model is then compared to the three most widely used empirical path loss models: Hat, ITU-R and Cost 231 Walfisch-Ikegami non line-of-sight (CWI-NLOS) path loss models. The performance criterion selected for the comparison of various empirical path loss models are the Root Mean Square Error (RMSE) and goodness of fit (R2). The RMSE and R2between the actual and predicted data are calculated for various path loss models. It turned that the tuned Lee model outperforms the other empirical models. (author)

  12. Lee as Critical Thinker: The Example of the Gettysburg Campaign

    Science.gov (United States)

    2012-05-04

    importance were “ Hannibal , Frederick the Great, and especially Napoleon, all of whom were models for Lee as he led the Army of Northern Virginia in battle...Cannae, Leuthen, and Austerlitz. The Battle of Cannae culminated in a double envelopment by Hannibal against the Romans and “is important…because...it shows how Hannibal was able to completely surround a much larger force Roman force (40,000 versus 70,000, as compared with Lee’s 74,000 facing

  13. SUPLEMENTAÇÃO COM AMÊNDOA DE BACURI NA COMPOSIÇÃO CORPORAL DE RATOS SUBMETIDOS AO EXERCÍCIO

    Directory of Open Access Journals (Sweden)

    Marília de Lima Mendes Ramos

    Full Text Available RESUMO Introdução: A proteína da amêndoa do bacuri (Attalea phalerata Mart. Ex Spreng e da whey protein (WP têm quantidades relevantes de aminoácidos essenciais e são de boa digestibilidade, características que têm sido buscadas por atletas para auxílio para melhorar a composição corporal, particularmente quando associadas a exercícios. Objetivo: Avaliar o efeito de dietas com teor proteico vegetal e animal sobre a composição corporal de ratos Wistar submetidos ao exercício resistido em escada. Métodos: Quarenta ratos machos recém-desmamados foram submetidos a um período de adaptação com dieta comercial (4 semanas e treinamento resistido durante oito semanas (três vezes por semana, recebendo dietas com farinha de bacuri e whey protein. Foram distribuídos randomicamente em seis grupos: G1 (bacuri sedentário, G2 (bacuri exercitado, G3 (WP sedentário, G4 (WP exercitado, G5 (controle sedentário e G6 (controle exercitado. Avaliou-se consumo da dieta, peso corporal, comprimento, circunferências torácica e abdominal para calcular o índice de Lee e o índice de massa corporal; os sítios com gordura foram retirados após eutanásia. A análise estatística foi realizada por ANOVA e Teste de Tukey, considerando 5% de significância. Resultados: O peso final do G3 (372 ± 8,86 g foi superior ao do G2 (326,83 ± 15,03 g e do G6 (316,75 ± 5,90 g; os grupos que receberam dieta com farinha de bacuri consumiram quantidade superior de dieta, porém, tiveram menor peso final; não diferiram no índice de Lee e no IMC, sítios com gordura e índice de adiposidade com relação aos grupos tratados com WP, apresentando valores inferiores das circunferências torácica e abdominal. Com relação às gorduras e índice de adiposidade, não houve diferença entre os grupos sedentários e exercitados. Conclusão: A proteína da amêndoa de bacuri mostrou-se de boa qualidade quando comparada com a whey protein, havendo possibilidade de

  14. Análise SWOT global da exploração dos suínos da raça Bísara

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...

  15. Rand Corporation

    Science.gov (United States)

    ... Jobs at RAND Media Resources Congressional Resources Doing Business with RAND Supporting RAND Educational Opportunities Alumni Association Follow RAND Corporation on Facebook RAND Corporation on Twitter RAND Corporation on LinkedIn ...

  16. Corporate Sustainable Development Assessment Base on the Corporate Social Responsibility

    OpenAIRE

    Sun Mei; Nagata Katsuya; Onoda Hiroshi

    2011-01-01

    With the resource exhaustion, bad affections of human activities and the awakening of the human rights, the corporate social responsibility became popular corporate strategy achieving sustainable development of both corporation and society. The issue of Guideline of Chinese Corporate Social Responsibility Report promotes greatly corporation to take social responsibility. This paper built the index system according to this guideline and takes the textile industry as an exa...

  17. 78 FR 51053 - Airworthiness Directives; Beechcraft Corporation and Hawker Beechcraft Corporation

    Science.gov (United States)

    2013-08-20

    ... Airworthiness Directives; Beechcraft Corporation and Hawker Beechcraft Corporation AGENCY: Federal Aviation... certain Beechcraft Corporation (type certificate previously held by Hawker Beechcraft Corporation) Models 58, 95-C55, E55, and 56TC airplanes; and Hawker Beechcraft Corporation Models 58P and 58TC airplanes...

  18. 78 FR 52982 - Experian, Experian US Headquarters: Corporate Departments (Finance, HRMD, Contracts, Corporate...

    Science.gov (United States)

    2013-08-27

    ...,506R] Experian, Experian US Headquarters: Corporate Departments (Finance, HRMD, Contracts, Corporate... Headquarters: Corporate Departments (finance, HRMD, Contracts, Corporate Marketing, Global Corporate Systems... (finance, HRMD, Contracts, Corporate Marketing, Global Corporate Systems, Legal & Regulatory, Risk...

  19. Corporate Taxation and Corporate Governance

    DEFF Research Database (Denmark)

    Köthenbürger, Marko; Stimmelmayr, Michael

    2009-01-01

    if the corporate tax system exempts the normal return on investment from taxation. The optimal system may well use the full return on investment as a tax base. Hence, tax systems such as an Allowance for Corporate Equity (ACE) or a Cash-flow tax do not have the familiar efficiency-enhancing effects in the presence...

  20. La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli

    Directory of Open Access Journals (Sweden)

    Umberto Fortis

    2014-04-01

    Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.

  1. Corporate Social Responsibility and Corporate Financial Performance: Evidence from Korea

    OpenAIRE

    Choi, Jong-Seo; Kwak, Young-Min; Choe, Chongwoo

    2010-01-01

    This paper studies the empirical relation between corporate social responsibility (CSR) and corporate financial performance in Korea using a sample of 1122 firm-years during 2002-2008. We measure corporate social responsibility by both an equal-weighted CSR index and a stakeholder-weighted CSR index suggested by Akpinar et al. (2008). Corporate financial performance is measured by ROE, ROA and Tobin’s Q. We find a positive and significant relation between corporate financial performance and t...

  2. Corporate Foundations

    DEFF Research Database (Denmark)

    Herlin, Heidi; Thusgaard Pedersen, Janni

    2013-01-01

    action between business and NGOs through convening, translation, collaboration, and mediation. Our study provides valuable insights into the tri-part relationship of company foundation NGO by discussing the implications of corporate foundations taking an active role in the realm of corporate social...... responsibility (CSR). The paper hence illuminates the fascinating and overlooked role of corporate foundations as potential bridges between business and civil society. It also informs theory on boundary organizations by clarifying challenges and limits of such institutions.......This paper aims to explore the potential of Danish corporate foundations as boundary organizations facilitating relationships between their founding companies and non-governmental organizations (NGOs). Hitherto, research has been silent about the role of corporate foundations in relation to cross...

  3. The Russia Corporate Governance Manual : Part I. Corporate Governance Introduced

    OpenAIRE

    International Finance Corporation; U.S. Department of Commerce

    2004-01-01

    The Russia corporate governance manual has been divided into and is published in six parts: (i) corporate governance introduced; (ii) good board practices; (iii) shareholder rights; (iv) information disclosure and transparency; (v) special focus section; and (vi) annexes model corporate governance documents. The first four parts contain chapters that focus on core corporate governance issu...

  4. Pengungkapan Corporate Social Responsibility, Struktur Corporate Governance dan Nilai Perusahaan

    Directory of Open Access Journals (Sweden)

    Salmah Pattisahusiwa

    2017-06-01

    Full Text Available The concept of the corporate social responsibility has a significant interest in Indonesia because believed to increase corporate’s value for shareholders. This study aims to find the effect of corporate social responsibility disclosure and corporate governance structure on corporate value. The data were taken from annual report of mining companies listed in Indonesian Stock Exchange for period of 2014-2015. The sample collection has been done by using purposive sampling with the certain criteria so that 18 companies which meet criteria have been obtained as samples. Multiple Regression analysis was employed to analyze data. The result of this research show that corporate social responsibility disclosure and corporate governance structure have significant effect to thecorporate value.

  5. Corporate Entrepreneurship

    DEFF Research Database (Denmark)

    Lassen, Astrid Heidemann

    Corporate entrepreneurship is often highlighted as being more relevant than ever, as a viable means for existing organizations to pursue creative new solutions to the complex challenges facing firms today. This includes continuously exploring and exploiting previously unexploited opportunities......, and thereby moving the organization to a new state of being. In spite of a general consensus on a strong interlinkage between the concepts of innovation and corporate entrepreneurship, the nature of this linkage is rarely addressed directly. This has made further research in the two areas problematic, mainly...... nature of corporate entrepreneurship and innovation by exploring the role played by innovation in corporate entrepreneurship. - Develop a framework of corporate entrepreneurial innovation which facilitates an understanding of challenges related hereto and practices applied to overcome these challenges...

  6. Outsourcing of Corporate Information Services: Implications for Redesigning Corporate Library Services.

    Science.gov (United States)

    Agada, John

    1996-01-01

    Examines the trend in outsourcing information services and suggests it threatens the survival of corporate libraries. Topics include changes in the competitive corporate environment; characteristics of outsourceable services; managing change; redesigning the corporate librarian's role; and implications for redesigning corporate information…

  7. Grey relational analysis for evaluating the effects of different rates of wine lees-derived biochar application on a plant-soil system with multi-metal contamination.

    Science.gov (United States)

    Xu, Min; Zhu, Qihong; Wu, Jun; He, Yan; Yang, Gang; Zhang, Xiaohong; Li, Li; Yu, Xiaoyu; Peng, Hong; Wang, Lilin

    2018-03-01

    In this study, grey relational analysis (GRA) was used to investigate the effects of different application rates of wine lees-derived biochar on a plant-soil system with multi-metal contamination. A pot experiment was conducted to determine rice growth in multi-metal-contaminated soil amended with samples of wine lees-derived biochar, and 47 indicators (including soil properties, microbial activity, and plant physiology) were selected as evaluation indexes to assess the plant-soil system. The results indicated that higher wine lees-derived biochar application rates (2% W/W) were favorable for soil fertility, the bioconcentration factor (BF), and the mobility factor (MF, %) (with the exception of Cr, Zn, and Hg), but an application of 1% produced the highest plant growth, enzymatic activities, and bacterial diversity. The richness of the bacterial communities was reduced in the soil amended with the wine lees-derived biochar. According to the GRA assessment, the 1% application rate of wine lees-derived biochar was more suitable for restoring the holistic plant-soil system than were the application rates of 0, 0.5, and 2% (W/W). Furthermore, this study shows that GRA is a useful method for evaluating plant-soil systems.

  8. Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests

    International Nuclear Information System (INIS)

    Eifler, W.; Shepherd, I.M.

    1983-01-01

    Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix

  9. Corporate branding with the help of corporate real estate

    NARCIS (Netherlands)

    Appel - Meulenbroek, H.A.J.A.; Havermans, D.W.Q.; Kempen, van A.J.M.; Lundstrom, S.

    2009-01-01

    Nowadays, many companies try to attract customers by bundling all marketing efforts under a common corpo-rate brand to reflect the organization’s identity. The principle of corporate branding suggests that the corporate brand ought to be thoroughly embedded throughout the entire company in order to

  10. Corporate environmental responsibility – a key determinant of corporate reputation

    Directory of Open Access Journals (Sweden)

    Cristina GĂNESCU

    2014-06-01

    Full Text Available This paper aims to determine the trend of the relationship between corporate environmental responsibility and corporate reputation by focusing on a study of the European automotive sector. The starting point of our research is content analysis of the sustainability or social responsibility reports published in 2010, 2011, and 2012 by 13 businesses operating in the European automotive industry. Content analysis was carried out in order to identify the indicators used to assess corporate environmental responsibility. The methodology aimed to produce an evaluation model for corporate environmental responsibility based on the following variables reported by companies: carbon dioxide emissions, water consumption, energy consumption, and amount of waste. Corporate reputation of sampled organizations was assessed based on content analysis of the 2010, 2011, and 2012 reports of the Reputation Institute. We applied the correlation of panel data and emphasised the fact that high levels of corporate environmental responsibility sustain high levels of corporate reputation. The study highlights the theoretical considerations that support this relationship. As companies become increasingly accountable, the methodology described in our study can be developed in further research by using other variables to measure corporate environmental responsibility.

  11. Nobelist TD LEE Scientist Cooperation Network and Scientist Innovation Ability Model

    OpenAIRE

    Fang, Jin-Qing; Liu, Qiang

    2013-01-01

    Nobelist TD Lee scientist cooperation network (TDLSCN) and their innovation ability are studied. It is found that the TDLSCN not only has the common topological properties both of scale-free and small-world for a general scientist cooperation networks, but also appears the creation multiple-peak phenomenon for number of published paper with year evolution, which become Nobelist TD Lee’s significant mark distinguished from other scientists. This new phenomenon has not been revealed in the scie...

  12. Berners-Lee and the IPEN reality

    International Nuclear Information System (INIS)

    Sacramento, Jose Miguel Noronha; Rogero, Jose Roberto

    2010-01-01

    This article discusses a study held with researchers from IPEN and organizations that operate or could act as IPEN partners or clients on research projects and consumption of its products and services. The survey had its origin in the perception of the difficulties in alignment of IPEN with the demands of society, taking as a point of attention processes used in the disclosure and dissemination of scientific knowledge to the public other than the academic communities or specialists in the areas of IPEN usually operates. Were mapped communication flows between the researchers of IPEN and between companies and the IPEN so as to identify the necessary conditions to improve communication between different universes such as academic and business. The comparison of the conditions currently found in the IPEN with the 1991 initial proposal of Tim Berners-Lee when creating the World Wide Web to CERN and with web portals of organizations similar to IPEN provided valuable grants for the planning of next steps of IPEN organization in terms of its relationship with potential partners and, ultimately, the society. (author)

  13. Corporate social responsibility, corporate reputation and employee engagement

    OpenAIRE

    Ali, Imran; Ali, Jawaria Fatima

    2011-01-01

    Corporate social responsibility (CSR) has been outlined as voluntarily additional legal duties of organization to serve environment and community. This voluntarily actions of corporate help them to develop reputation which can shape favorable attitude of employees towards work. Employee engagement is an attitude of commitment and involvement of employee towards their work and organization. Researchers have proved that engaged employees are more productive, more likely to achieve corporate go...

  14. Using corporate stories to build the corporate brand:an impression management perspective

    OpenAIRE

    Spear, Sara; Roper, Stuart

    2013-01-01

    Purpose – A recent area of academic interest within corporate branding and reputation is the use of storytelling in order to differentiate the corporate brand, however there is little empirical research exploring the contents of corporate stories, and how they are used by organisations to build the corporate brand. This paper aims to utilise impression management theory to bring insight into the potential role of corporate stories in shaping the corporate brand. Design/methodology/approach – ...

  15. Corporate governance, corporate finance and stock markets in emerging countries

    OpenAIRE

    Singh, Ajit

    2003-01-01

    This paper focuses on the inter-relationship between corporate governance, financing of corporate growth and stock market development in emerging countries. It explores both theoretically and empirically the nature of the inter-relationships between these phenomena, as well their implications for economic policy. It concentrates on how corporate growth is financed, an area where the literature has identified important anomalies in relation to corporate behaviour and governance. The paper prov...

  16. Identification of new proton-rich rare earth nuclei by means of the coupled system helium jet-isotope separator of SARA

    International Nuclear Information System (INIS)

    Ollivier, T.

    1986-01-01

    In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr

  17. Corporate Governance as a Crucial Factor in Achieving Sustainable Corporate Performance

    Directory of Open Access Journals (Sweden)

    Julija Bistrova

    2014-06-01

    Full Text Available In the developed stock markets the corporate governance aspect is crucial in the stock portfolio selection process for investor seeking to achieve shareholder value sustainability. In the emerging markets the importance of the corporate governance role just starts to be realized by the investors and by the corporate managers. The present research, looking at the stock performance leaders and laggards, analyzes whether the corporate governance system matters to achieve long-term shareholder value within the Central and Eastern European stock markets universe. Corporate governance quality was assessed and compared among the out- and underperformers. The financial results plausibility and the ownership structure were considered as well. Additionally, the authors analyzed whether the quality of corporate governance influences the economic performance of the company. The obtained results provide the proof that the corporate governance does matter as the market outperformers have above average corporate governance quality and provide trustworthy financial results more often than the underperforming companies. Besides, well-governed companies are also able to deliver more attractive financial results.

  18. Measuring Corporate Sustainability and Environmental, Social, and Corporate Governance Value Added

    Directory of Open Access Journals (Sweden)

    Alena Kocmanová

    2016-09-01

    Full Text Available The aim of the paper is to propose a model for measuring sustainable value which would complexly assess environmental, social, and corporate governance contribution to value creation. In the paper the concept of the Sustainable Environmental, Social and Corporate Governance Value Added is presented. The Sustainable Environmental, Social and Corporate Governance Value Added is based on the Sustainable Value Added model and combines weighted environmental, social, and corporate governance indicators with their benchmarks determined by Data Envelopment Analysis. Benchmark values of indicators were set for each company separately and determine the optimal combination of environmental, social, and corporate governance inputs to economic outcomes. The Sustainable Environmental, Social and Corporate Governance Value Added methodology is applied on real-life corporate data and presented through a case study. The value added of most of the selected companies was negative, even though economic indicators of all of them are positive. The Sustainable Environmental, Social and Corporate Governance Value Added is intended to help owners, investors, and other stakeholders in their decision-making and sustainability assessment. The use of environmental, social, and corporate governance factors helps identify the company’s strengths and weaknesses, and provides a more sophisticated insight into it than the one-dimensional methods based on economic performance alone.

  19. The integration of corporate governance in corporate social responsibility disclosures

    NARCIS (Netherlands)

    Kolk, A.; Pinkse, J.

    2010-01-01

    In recent years, not only has attention to corporate governance increased but also the notion has broadened considerably, and started to cover some aspects traditionally seen as being part of corporate social responsibility (CSR). CSR, corporate governance and their interlink seem particularly

  20. Corporate political activities, religiosity and corporate decision making

    OpenAIRE

    Low, Yik Pui

    2017-01-01

    Motivated by the recent increase in corporate political spending and the Supreme Court’s decision in allowing firms to freely use their treasury funds for political purposes (Citizens United v Federal Election Commission, 2010), this study examines the impact of corporate political activity (CPA) on its decision making. CPA is defined as the firm’s total annual lobbying expenses arising from the engagement of internal and external lobbyists while corporate decision making is measured in terms...

  1. The Friedberg-Lee symmetry and minimal seesaw model

    International Nuclear Information System (INIS)

    He Xiaogang; Liao Wei

    2009-01-01

    The Friedberg-Lee (FL) symmetry is generated by a transformation of a fermionic field q to q+ξz. This symmetry puts very restrictive constraints on allowed terms in a Lagrangian. Applying this symmetry to N fermionic fields, we find that the number of independent fields is reduced to N-1 if the fields have gauge interaction or the transformation is a local one. Using this property, we find that a seesaw model originally with three generations of left- and right-handed neutrinos, with the left-handed neutrinos unaffected but the right-handed neutrinos transformed under the local FL translation, is reduced to an effective theory of minimal seesaw which has only two right-handed neutrinos. The symmetry predicts that one of the light neutrino masses must be zero.

  2. Corporate Bonds in Denmark

    DEFF Research Database (Denmark)

    Tell, Michael

    2015-01-01

    Corporate financing is the choice between capital generated by the corporation and capital from external investors. However, since the financial crisis shook the markets in 2007–2008, financing opportunities through the classical means of financing have decreased. As a result, corporations have...... to think in alternative ways such as issuing corporate bonds. A market for corporate bonds exists in countries such as Norway, Germany, France, the United Kingdom and the United States, while Denmark is still behind in this trend. Some large Danish corporations have instead used foreign corporate bonds...... markets. However, NASDAQ OMX has introduced the First North Bond Market in December 2012 and new regulatory framework came into place in 2014, which may contribute to a Danish based corporate bond market. The purpose of this article is to present the regulatory changes in Denmark in relation to corporate...

  3. Corporate sustainability: environmental, social, economic and corporate performance

    Directory of Open Access Journals (Sweden)

    Alena Kocmanová

    2011-01-01

    Full Text Available The article deals with corporate sustainability and environmental and social issues of the integration of corporate performance measurement that may lead to sustainable economic success. Sustainability is a strategy of the process of sustainable development. Sustainability of businesses and sustainable performance can be defined as an integration of environmental, social and economic performance. First and foremost, businesses will want to know what indicators can be used to measure environmental, social and economic performance. What is the mutual relationship between environmental, social and economic performance? How can firms arrive at a comprehensive assessment of their performance in relation to sustainability? The aim of this paper is to analyze corporate environmental, social and economic performance and to analyze their mutual relationships. The final part of the article is an assessment of the contemporary situation and draft Key Performance Indicators (KPI for assessment of corporate sustainability that will be the subject of further research in a selected NACE-CZ sector and in accordance with Corporate Sustainability Reporting. KPI provide businesses with a means of measuring progress toward achieving objectives.

  4. Land-use evaluation for sustainable construction in a protected area: A case of Sara mountain national park.

    Science.gov (United States)

    Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena

    2018-01-15

    The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. THE YUAN-TSEH LEE ARRAY FOR MICROWAVE BACKGROUND ANISOTROPY

    International Nuclear Information System (INIS)

    Ho, Paul T. P.; Altamirano, Pablo; Chang, C.-H.; Chang, S.-H.; Chang, S.-W.; Chen, C.-C.; Chen, K.-J.; Chen, M.-T.; Han, C.-C.; Ho, West M.; Huang, Y.-D.; Hwang, Y.-J.; Ibanez-Romano, Fabiola; Jiang Homin; Koch, Patrick M.; Kubo, Derek Y.; Li, C.-T.; Lim, Jeremy; Lin, K.-Y.; Liu, G.-C.

    2009-01-01

    The Yuan-Tseh Lee Array for microwave background anisotropy is the first interferometer dedicated to study the cosmic microwave background radiation at 3 mm wavelength. The choice of 3 mm is to minimize the contributions from foreground synchrotron radiation and Galactic dust emission. The initial configuration of seven 0.6 m telescopes mounted on a 6 m hexapod platform was dedicated in 2006 October on Mauna Loa, Hawaii. Scientific operations began with the detection of a number of clusters of galaxies via the thermal Sunyaev-Zel'dovich effect. We compare our data with Subaru weak-lensing data to study the structure of dark matter. We also compare our data with X-ray data to derive the Hubble constant.

  6. Acceleration of ageing on lees in red wines by application of ultrasounds

    OpenAIRE

    Fresno, Juan Manuel del; Morata Barrado, Antonio Dionisio; Loira, Iris; Escott, Carlos; Cuerda, Rafael; Calderon Fernandez, Fernando; Suarez Lepe, Jose Antonio

    2017-01-01

    A transfer of parietal polysaccharides and mannoproteins is produced during aging on lees [1]. This transfer of compounds to wine is carried out after cell death. It comes to breakdown of polysaccharides from cell wall (yeast autolysis). This technique increases the density in wines [2] and gives more body and structure. Interactions between yeast polysaccharides and wine tannins will result in decrease of tannic perception (decrease of astringency). Increase of varietal characteristics is pr...

  7. Corporate Awakening

    DEFF Research Database (Denmark)

    LaFrance, Julie; Lehmann, Martin

    2005-01-01

    Predominantly since the 1992 Rio Summit, corporations have been increasingly pursuing partnerships with public institutions including governments, international organisations and NGOs that aim to contribute to sustainable development activities. Partnerships have become more common as corporation...... public-private partnerships. These theoretical perspectives are used to gain a deeper understanding of the corporate drivers that motivated TOTAL S.A. to approach UNESCO for cooperation on community development programs in Myanmar....

  8. Exploring corporate eco-modernism: Challenging corporate rhetoric and scientific discourses

    DEFF Research Database (Denmark)

    Ulhøi, John Parm; Welford, Richard

    2000-01-01

    in shaping a new corporate environmentalism and, ten years on, we argue that it is time to step back and critically assess the nature and scope of corporate actions and scientific research within the field of corporate environmental management. This paper starts from the assertions that: (i) disturbing...

  9. Evolution of Corporate Essence

    DEFF Research Database (Denmark)

    Fomcenco, Alex

    2016-01-01

    that applies to a traditional limited liability company. Its main distinctive attributes are corporate purpose, accountability of its management, and transparency requirements. Although, a Public Benefit Corporation does not impose any revolutionary amendments to the way the traditional corporations are......, it offers a legal framework where public benefit is more important than profits. As a corporate entity, Public Benefit Corporation already exists in numerous jurisdictions and those jurisdictions that do not yet facilitate creation of this corporate form should most definitely consider it....

  10. The Brain Dead Patient Is Still Sentient: A Further Reply to Patrick Lee and Germain Grisez.

    Science.gov (United States)

    Austriaco, Nicanor Pier Giorgio

    2016-06-01

    Patrick Lee and Germain Grisez have argued that the total brain dead patient is still dead because the integrated entity that remains is not even an animal, not only because he is not sentient but also, and more importantly, because he has lost the radical capacity for sentience. In this essay, written from within and as a contribution to the Catholic philosophical tradition, I respond to Lee and Grisez's argument by proposing that the brain dead patient is still sentient because an animal with an intact but severed spinal cord can still perceive and respond to external stimuli. The brain dead patient is an unconscious sentient organism. © The Author 2016. Published by Oxford University Press, on behalf of the Journal of Medicine and Philosophy Inc. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  11. Nonsingular cosmology with a scale-invariant spectrum of cosmological perturbations from Lee-Wick theory

    International Nuclear Information System (INIS)

    Cai Yifu; Qiu Taotao; Brandenberger, Robert; Zhang Xinmin

    2009-01-01

    We study the cosmology of a Lee-Wick type scalar field theory. First, we consider homogeneous and isotropic background solutions and find that they are nonsingular, leading to cosmological bounces. Next, we analyze the spectrum of cosmological perturbations which result from this model. Unless either the potential of the Lee-Wick theory or the initial conditions are finely tuned, it is impossible to obtain background solutions which have a sufficiently long period of inflation after the bounce. More interestingly, however, we find that in the generic noninflationary bouncing cosmology, perturbations created from quantum vacuum fluctuations in the contracting phase have the correct form to lead to a scale-invariant spectrum of metric inhomogeneities in the expanding phase. Since the background is nonsingular, the evolution of the fluctuations is defined unambiguously through the bounce. We also analyze the evolution of fluctuations which emerge from thermal initial conditions in the contracting phase. The spectrum of gravitational waves stemming from quantum vacuum fluctuations in the contracting phase is also scale-invariant, and the tensor to scalar ratio is not suppressed.

  12. Creating corporate advantage.

    Science.gov (United States)

    Collis, D J; Montgomery, C A

    1998-01-01

    What differentiates truly great corporate strategies from the merely adequate? How can executives at the corporate level create tangible advantage for their businesses that makes the whole more than the sum of the parts? This article presents a comprehensive framework for value creation in the multibusiness company. It addresses the most fundamental questions of corporate strategy: What businesses should a company be in? How should it coordinate activities across businesses? What role should the corporate office play? How should the corporation measure and control performance? Through detailed case studies of Tyco International, Sharp, the Newell Company, and Saatchi and Saatchi, the authors demonstrate that the answers to all those questions are driven largely by the nature of a company's special resources--its assets, skills, and capabilities. These range along a continuum from the highly specialized at one end to the very general at the other. A corporation's location on the continuum constrains the set of businesses it should compete in and limits its choices about the design of its organization. Applying the framework, the authors point out the common mistakes that result from misaligned corporate strategies. Companies mistakenly enter businesses based on similarities in products rather than the resources that contribute to competitive advantage in each business. Instead of tailoring organizational structures and systems to the needs of a particular strategy, they create plain-vanilla corporate offices and infrastructures. The company examples demonstrate that one size does not fit all. One can find great corporate strategies all along the continuum.

  13. Corporate Language Policies

    DEFF Research Database (Denmark)

    Sanden, Guro Refsum

    This paper offers a review of literature dealing with language policies in general and corporate language policies in particular. Based on a discussion of various definitions of these concepts within two research traditions, i.e. sociolinguistics and international management, a three......-level definition of corporate language policies is presented, emphasising that a corporate language policy is a context-specific policy about language use. The three-level definition is based on the argument that in order to acquire a complete understanding of what corporate language policies involve, one needs...... to consider three progressive questions; 1) what is a policy? 2) what is a language policy?, and ultimately, 3) what is a corporate language policy?...

  14. Corporate Language Policies

    DEFF Research Database (Denmark)

    Sanden, Guro Refsum

    2015-01-01

    This paper offers a review of literature dealing with language policies in general and corporate language policies in particular. Based on a discussion of various definitions of these concepts within two research traditions, i.e. sociolinguistics and international management, a three......-level definition of corporate language policies is presented, emphasising that a corporate language policy is a context-specific policy about language use. The three-level definition is based on the argument that in order to acquire a complete understanding of what corporate language policies involve, one needs...... to consider three progressive questions; 1) what is a policy? 2) what is a language policy?, and ultimately, 3) what is a corporate language policy?...

  15. Fighting with Reality: Considering Mark Johnson's Pragmatic Realism through Bruce Lee's Jeet Kune Do Method

    Science.gov (United States)

    Miller, Alexander David

    2015-01-01

    This dissertation considers the supportive and complementary relation between Mark Johnson's embodied realism and Bruce Lee's Jeet Kune Do as a philosophical practice. In exploring this relationship, the emphasis on one's embodiment condition and its relationship with metaphor and self-expression are the primary focus. First, this work involves…

  16. 77 FR 14032 - John H. Chafee Coastal Barrier Resources System; Lee County, FL, and Newport County, RI...

    Science.gov (United States)

    2012-03-08

    ... conduct a comprehensive review of the history of the CBRS unit in question. The Service has a large... by Lee County, and 1 restaurant. The Service's assessment of 2011 aerial imagery estimates that the...

  17. Functional renormalization group approach to the Yang-Lee edge singularity

    Energy Technology Data Exchange (ETDEWEB)

    An, X. [Department of Physics, University of Illinois at Chicago,845 W. Taylor St., Chicago, IL 60607 (United States); Mesterházy, D. [Albert Einstein Center for Fundamental Physics, University of Bern,Sidlerstrasse 5, 3012 Bern (Switzerland); Stephanov, M.A. [Department of Physics, University of Illinois at Chicago,845 W. Taylor St., Chicago, IL 60607 (United States)

    2016-07-08

    We determine the scaling properties of the Yang-Lee edge singularity as described by a one-component scalar field theory with imaginary cubic coupling, using the nonperturbative functional renormalization group in 3≤d≤6 Euclidean dimensions. We find very good agreement with high-temperature series data in d=3 dimensions and compare our results to recent estimates of critical exponents obtained with the four-loop ϵ=6−d expansion and the conformal bootstrap. The relevance of operator insertions at the corresponding fixed point of the RG β functions is discussed and we estimate the error associated with O(∂{sup 4}) truncations of the scale-dependent effective action.

  18. Analysis of the membrane fouling on cross-flow ultrafiltration and microfiltration of soy sauce lees; Shoyuhiireden no kurosuforo roka ni okeru fauringu no kaiseki

    Energy Technology Data Exchange (ETDEWEB)

    Furukakwa, T. [Kikkoman Corporation, Chiba (Japan); Kobayashi, H.; Kokubo, K.; Watanabe, A. [Niigata University, Niigata (Japan). Graduate School of Science and Technology

    2000-05-10

    Although since the 1980's Japanese soy sauce manufactures have developed cross-flow membrane filtration systems to recover soy sauce from its lees, the mechanisms by which the membrane fouls during filtration have not been theoretically discussed. Calculated flux declines using a theoretical equation developed for cross-flow cake filtration were compared against experimental results involving the filtration of soy sauce lees using polysulfone ultrafiltration and micro filtration membranes. Membrane fouling due to the deposition and intrusion of soy sauce lees was evaluated from the hydraulic resistances of the membrane and the cake layer. Calculated flux declines with time agree with the experimental results. Specific resistance of the cake layer which is an adjustable parameter of the equation, decreases with increasing cross-flow velocity. Hydraulic resistance exhibited by the membranes is independent of feed flow velocity. However, the resistance of the cake layers decreases with increasing cross-flow velocity. This corresponds to the steady-state flux increase. In conclusion, the main cause of fouling in the filtration of soy sauce lees is cake layer formation. By using the cake filtration model for cross-flow, the flux decline with time during the filtration is capable of being predicted. (author)

  19. Corporate culture: It's impact on corporate life and business ...

    African Journals Online (AJOL)

    Corporate culture: It's impact on corporate life and business practices in Nigeria. ... on the work behaviour of management strategists and business policy makers. ... culture include, multinational organizations as well as mergers/acquisitions.

  20. Еnterprise’s corporate management improvement on the base of corporate culture development

    Directory of Open Access Journals (Sweden)

    T.O. Biliak

    2016-12-01

    Full Text Available The author reveals extremely important role of corporate culture and uniqueness of the corporate culture system. It is established that the corporate management is characterized above all, by the economic activity and corporate culture practice. The securement of the balance in the process of interaction between organization and its environment plays one of the key roles in any management system. The author determines the influence of corporate culture on the business activity of the enterprise, when personnel predicts the situation development according to which they build models and evaluate their behavior. While realizing them in their activity employees strengthen certain trends and create in such a way appropriate situations. The search of ways of development and changing corporate culture as the base of corporate management improvement is conducted with the use of the strategic approach. The creation of a corporate culture that supports the development strategy of the enterprise, is an essential component of effective business and management, because the culture shapes a socio-psychological climate and corporate spirit which contributes to the operational execution of tasks and achievement of certain goals. Accordingly to the mentioned above, the set of measures of enterprise’s corporate culture development securement is proposed.

  1. Corporate Business Diplomacy

    DEFF Research Database (Denmark)

    Søndergaard, Mikael

    2014-01-01

    This article illustrates the interdisciplinary nature of the field of corporate business diplomacy using examples from academic disciplines, such as economics and political science, which can contribute to the understanding of corporate business diplomacy. Examples also show that corporate business...... diplomacy can complement business theories such as stakeholder theory and agency theory. Examples from practice show that in a broad sense, corporate business diplomacy is concerned with managing external stakeholders, while in a narrow sense, it is concerned with managing internal stakeholders....... The usefulness of an analytical research triangulation is illustrated....

  2. Corporate boards and ownership structure as antecedents of corporate governance disclosure in Saudi Arabian publicly listed corporations

    OpenAIRE

    Al-Bassam, Waleed M.; Ntim, Collins G.; Opong, Kwaku K.; Downs, Yvonne

    2015-01-01

    This study investigate whether and to what extent publicly listed corporations voluntarily comply with and disclose recommended good corporate governance (CG) practices, and distinctively examine whether the observed cross-sectional differences in such CG disclosures can be explained by ownership and board mechanisms with specific focus on Saudi Arabia. Our results suggest that corporations with larger boards, a big-four auditor, higher government ownership, a CG committee and higher institut...

  3. The Corporate Marketing Department

    DEFF Research Database (Denmark)

    Ritter, Thomas; Eggert, Andreas; Münkhoff, Eva

    Corporate marketing has been downsized or eliminated in many firms. At the same time, firms that still own a corporate marketing department struggle with organizing and positioning their commercial front‐end. The question arises whether firms need a corporate marketing department, and if so, how...... it can best add value to the firm. Based on a qualitative study among B2B companies, we develop a conceptual framework highlighting the various parental roles through which corporate marketing can contribute to overall firm and business unit performance. In addition, we identify five gaps that restrain...... successful outcomes of corporate marketing activities. In sum, our framework provides important insights on how to successfully organize corporate marketing activities....

  4. Global business management for sustainability and competitiveness: The role of corporate branding, corporate identity and corporate reputation

    OpenAIRE

    Gupta, Suraksha; Melewar, T.C.; Czinkota, Michael C.

    2013-01-01

    This special issue of the Journal of World Business is devoted to the role of intangibles of a firm in building sustainable business for success in competitive markets. The research articles included in this issue have contributed to the on-going academic knowledge about the ability of marketing and management practices to drive business sustainability. This special issue on business sustainabili- ty focuses on the role of corporate branding, corporate identity and corporate reputation.

  5. Distribution of non-LEE-encoded type 3 secretion system dependent effectors in enteropathogenic Escherichia coli

    Directory of Open Access Journals (Sweden)

    Fábia A. Salvador

    2014-09-01

    Full Text Available Enteropathogenic Escherichia coli (EPEC are important human gastroenteritis agents. The prevalence of six non-LEE genes encoding type 3 translocated effectors was investigated. The nleC, cif and nleB genes were more prevalent in typical than in atypical EPEC, although a higher diversity of genes combinations was observed in atypical EPEC.

  6. Corporate Social Responsibility and Corporate Social Innovation: A Conceptual Understanding

    Directory of Open Access Journals (Sweden)

    Jali Muhamad Nizam

    2017-01-01

    Full Text Available In decades, various organizations worldwide engaged with Corporate Social Responsibility (CSR in order to show their corporate commitments and responsibilities towards societies at large. These commitments and responsibilities are coming from monetary and non-monetary resources for example cash, equipment’s and human resources whom are used for social purposes and activities that leads to a betterment of society and also to improved organization reputation. However, in today’s knowledge and innovation led economy, organizations can no longer affords to get involve in charity and community services merely to fulfil social return without having any sort of economic payoffs. This situation warrants organizations moving beyond CSR to Corporate Social Innovation. This paper explores conceptual understanding between CSR and Corporate Social Innovation. CSR is a traditional philanthropy and old paradigm which is somewhat no longer sufficient in coping with current economic situation. Hence, this paper provides an insight and suggests that corporate social innovation as an emergence new paradigm that perhaps could provide a comprehensive representation in the era of knowledge and innovation led economy that will leads to real change in improving the well-being of people’s life, enhance economic and technological growth. Furthermore, this paper also highlighted knowledge resource is the most significant resource of Corporate Social Innovation.

  7. Generation of hyperchaos from the Chen-Lee system via sinusoidal perturbation

    International Nuclear Information System (INIS)

    Tam, L.M.; Chen, J.H.; Chen, H.K.; Wai Meng Si Tou

    2008-01-01

    A system with more than one positive Lyapunov exponent can be classified as a hyperchaotic system. In this study, a sinusoidal perturbation was designed for generating hyperchaos from the Chen-Lee chaotic system. The hyperchaos was identified by the existence of two positive Lyapunov exponents and bifurcation diagrams. The system is hyperchaotic in several different regions of the parameters c, ε, and ω. It was found that this method not only can enhance or suppress chaotic behavior, but also induces chaos in non-chaotic parameter ranges. In addition, two interesting dynamical behaviors, Hopf bifurcation and intermittency, were also found in this study

  8. Generation of hyperchaos from the Chen-Lee system via sinusoidal perturbation

    Energy Technology Data Exchange (ETDEWEB)

    Tam, L.M. [Department of Electromechanical Engineering, Faculty of Science and Technology, University of Macau, Av. Padre Thomas Pereira S.J., Taipa, Macau (China)], E-mail: fstlmt@umac.mo; Chen, J.H. [Department of Mechanical Engineering, Chung Hua University, Hsinchu, Taiwan (China); Chen, H.K. [Department of Mechanical Engineering, Hsiuping Institute of Technology, Taichung, Taiwan (China); Wai Meng Si Tou [Department of Electromechanical Engineering, Faculty of Science and Technology, University of Macau, Av. Padre Thomas Pereira S.J., Taipa, Macau (China)

    2008-11-15

    A system with more than one positive Lyapunov exponent can be classified as a hyperchaotic system. In this study, a sinusoidal perturbation was designed for generating hyperchaos from the Chen-Lee chaotic system. The hyperchaos was identified by the existence of two positive Lyapunov exponents and bifurcation diagrams. The system is hyperchaotic in several different regions of the parameters c, {epsilon}, and {omega}. It was found that this method not only can enhance or suppress chaotic behavior, but also induces chaos in non-chaotic parameter ranges. In addition, two interesting dynamical behaviors, Hopf bifurcation and intermittency, were also found in this study.

  9. Lee-Yang zeroes and logarithmic corrections in the Φ44 theory

    International Nuclear Information System (INIS)

    Kenna, R.; Lang, C.B.

    1993-01-01

    The leading mean-field critical behaviour of φ 4 4 -theory is modified by multiplicative logarithmic corrections. We analyse these corrections both analytically and numerically. In particular we present a finite-size scaling theory for the Lee-Yang zeroes and temperature zeroes, both of which exhibit logarithmic corrections. On lattices from size 8 4 to 24 4 , Monte-Carlo cluster methods and multi-histogram techniques are used to determine the partition function zeroes closest to the critical point. Finite-size scaling behaviour is verified and the logarithmic corrections are found to be in good agreement with our analytical predictions. (orig.)

  10. INTEGRATED CORPORATE STRATEGY MODEL

    Directory of Open Access Journals (Sweden)

    CATALINA SORIANA SITNIKOV

    2014-02-01

    Full Text Available Corporations are at present operating in demanding and highly unsure periods, facing a mixture of increased macroeconomic need, competitive and capital market dangers, and in many cases, the prospect for significant technical and regulative gap. Throughout these demanding and highly unsure times, the corporations must pay particular attention to corporate strategy. In present times, corporate strategy must be perceived and used as a function of various fields, covers, and characters as well as a highly interactive system. For the corporation's strategy to become a competitive advantage is necessary to understand and also to integrate it in a holistic model to ensure sustainable progress of corporation activities under the optimum conditions of profitability. The model proposed in this paper is aimed at integrating the two strategic models, Hoshin Kanri and Integrated Strategy Model, as well as their consolidation with the principles of sound corporate governance set out by the OECD.

  11. Corporations as social contractors : a study on corporate social responsibility

    OpenAIRE

    Kalstad, Marius Aas

    2007-01-01

    This thesis takes up the issue of the role of business in today s society, in the form of Corporate Social Responsibility (CSR). The research question is: Do corporations/does business have responsibilities beyond maximising profit for owners? Social contract theory, as presented by Hobbes and Locke, is used to morally justify a corporate responsibility that goes beyond the traditional business responsibility of maximising profit for stolckholders. Further, the stakeholder model is proscribed...

  12. Corporate environmental responsibility – a key determinant of corporate reputation

    OpenAIRE

    Cristina Ganescu; Laura Dindire

    2014-01-01

    This paper aims to determine the trend of the relationship between corporate environmental responsibility and corporate reputation by focusing on a study of the European automotive sector. The starting point of our research is content analysis of the sustainability or social responsibility reports published in 2010, 2011, and 2012 by 13 businesses operating in the European automotive industry. Content analysis was carried out in order to identify the indicators used to assess corporate enviro...

  13. Corporate governance and corporate social responsibility: A typology of OECD countries

    Directory of Open Access Journals (Sweden)

    Patricia Crifo

    2016-06-01

    Full Text Available This article investigates the relationships between corporate governance and Corporate Social Responsibility (CSR. The underlying intuition is that governance factors are major determinants of CSR policies and extra-financial performance. More precisely, we identify three main factors that determine the strength of CSR engagement at the firm level: the structure of equity ownership (identity of shareholders, the composition and structure of board of directors, and the regulatory framework on corporate governance and CSR. We show how evolutions regarding corporate governance over the three previous decades have paved the way and shaped the rise of CSR. In addition, we elaborate a typology of CSR and governance structures that characterize OECD countries depending on whether the CSR reporting regime is stringent versus non-stringent, and on whether the corporate governance model is based on the shareholder, stakeholder or hybrid regime.

  14. CORPORATE SOCIAL RESPONSIBILITY. EXAMPLE ROSIA MONTANA GOLD CORPORATION

    OpenAIRE

    Vasile Burja; Silvia – Stefania Mihalache

    2010-01-01

    Corporate Social Responsibility, a concept without a world accepted definition is starting to beused in Romania as well. This is the reason why in the present article we try to make a theoreticaldescription of the present concept and to exemplify it by presenting the responsible activities of acorporation in Romania, Rosia Montana Gold Corporation.

  15. Corporate Governance

    Directory of Open Access Journals (Sweden)

    Dragoș-Mihail Daghie

    2011-05-01

    Full Text Available The purpose of this study is to analyze and understand the recently introduced form of managementof a company limited by shares. The Law no. 441/2006, which fundamentally amended Company Law,created this form of controlling the company, the corporate governance, but the legislation does not explicitlydefine what it wants to achieve through this instrument. This topic is recent in research as the theme ofgerman-roman commercial law systems (in French corporate governance system was introduced in 1966 andin Romania in 2006 but in terms of Anglo-Saxon law, the topic has been addressed years since 1776 (AdamSmith: The Wealth of Nations The concept of corporate governance would like, as a result, to establish somerules that companies must comply in order to achieve effective governance, transparent and beneficial forboth shareholders and for the minority. Corporate governance is a key element with an aim at improvingefficiency and economic growth in full accordance with the increase of investors’ confidence. Corporategovernance assumes a series of relationship between the company management, leadership, shareholders andthe other people concerned. Also corporate governance provides for that structure by means of which thecompany’s targets are set out and the means to achieve them and also the manner how to monitor such.

  16. Corporate Governance Country Assessment : Malaysia

    OpenAIRE

    World Bank

    2012-01-01

    This report assesses Ghana s corporate governance policy framework. It highlights recent improvements in corporate governance regulation, makes policy recommendations, and provides investors with a benchmark against which to measure corporate governance in Ghana. It is an update of the 2005 Corporate Governance ROSC. Good corporate governance enhances investor trust, helps to protects mino...

  17. The Essential Elements of Corporate Law. What is Corporate Law?

    OpenAIRE

    Armour, John; Hansmann, Henry; Kraakman, Reinier

    2017-01-01

    This article is the first chapter of the second edition of “The Anatomy of Corporate Law: A Comparative and Functional Approach”, by Reinier Kraakman, John Armour, Paul Davies, Luca Enriques, Henry Hansmann, Gerard Hertig, Klaus Hopt, HidekiKanda and Edward Rock (Oxford University Press, 2009). The book as a whole provides a functional analysis of Corporate (or Company) Law in Europe, the U.S., and Japan. Its organization reflects the structure of Corporate Law throughout all jurisdictions, w...

  18. Does Corporate Social Responsibility Shape the Relationship between Corporate Governance and Financial Performance?

    Directory of Open Access Journals (Sweden)

    Jaja Suteja

    2017-12-01

    Full Text Available The correlation between theoretical and empirical of corporate governance (CG and corporate financial performance (CFP is not there without controversy. This paper aims to determine the moderating effects of corporate social responsibility (CSR, on the relationship between corporate governance and corporate financial performance. The sample of this research are banking companies that are listed on Indonesia Stock Exchange between the period of 2010-2014, taken by using purposive sampling method. Moderated Regression Analysis (MRA analysis was used in this study. The results of this study indicate that corporate governance affects the company's financial performance positively. Aspects of corporate governance such as audit committees and number of board meetings have a positive relationship with financial performance, but there is no relationship from the aspect of independent board of commissioners. Furthermore, CSR can only strengthen the positive relationship between the number of board of commissioners’ meetings and the financial performance of the company. The frequency intensity of board of commissioners’ meetings can increasingly address corporate governance reforms by improving and realizing social responsibility as part of sustainability innovation by optimizing media and CSR reporting methods.

  19. Revisiting the Complexities of Corporate Branding

    DEFF Research Database (Denmark)

    Gyrd-Jones, Richard; Merrilees, Bill; Miller, Dale

    2013-01-01

    The evolution of corporate branding literature since the seminal paper by Balmer is evaluated. The literature exhibits signs of maturing, which is evidenced by multiple theoretical underpinnings and a widening scope. Four themes are identified: (i) corporate brand as differentiation; (ii) corporate...... brand as corporate communication; (iii) corporate brand as a values-based approach; and (iv) corporate brand as internal branding approaches. We give special attention to issues of corporate communication, corporate identity, corporate vision, multiple stakeholders, alignment, multiple voices, corporate...... values and organisational culture. The themes are examined through a ‘paradox’ lens. Each theme is discussed in terms of the theoretical challenges arising from complexities in that aspect of corporate branding, ensuing apparent paradoxes and possible solutions for each paradox. The paradoxes...

  20. The Impact of Corporate Board Meetings on Corporate Performance ...

    African Journals Online (AJOL)

    Our findings suggest a statistically significant and positive association between the frequency of corporate board meetings and corporate performance, implying that SA boards that meet more frequently tend to generate higher financial performance. A further investigation indicates a significant non-monotonic link between ...

  1. Corporate Schooling Meets Corporate Media: Standards, Testing, and Technophilia

    Science.gov (United States)

    Saltman, Kenneth J.

    2016-01-01

    Educational publishing corporations and media corporations in the United States have been converging, especially through the promotion of standardization, testing, and for-profit educational technologies. Media and technology companies--including News Corp, Apple, and Microsoft--have significantly expanded their presence in public schools to sell…

  2. Transnational Corporations and Corporate Citizenship: Analyzing New Roles of Organization Development Practitioners

    Science.gov (United States)

    Stolz, Ingo Stephan

    2012-01-01

    Research shows that too few transnational corporations (TNCs) have the organizational capacity to manage corporate citizenship. Evidence exists that ever more TNCs adopt programs of corporate citizenship development in order to increase this capacity. However, both in academic and practical literature, there is a general lack of a strategic…

  3. 12 CFR 561.15 - Corporation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Corporation. 561.15 Section 561.15 Banks and... SAVINGS ASSOCIATIONS § 561.15 Corporation. The terms Corporation and FDIC mean the Federal Deposit Insurance Corporation. ...

  4. 12 CFR 583.8 - Corporation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Corporation. 583.8 Section 583.8 Banks and... SAVINGS AND LOAN HOLDING COMPANIES § 583.8 Corporation. The term Corporation means the Federal Deposit Insurance Corporation. ...

  5. Corporal punishment.

    Science.gov (United States)

    Bauman, L J; Friedman, S B

    1998-04-01

    Pediatricians differ on the optimal ways to discipline children. The major controversy surrounds the use of corporal punishment. In an effort to resolve this controversy, the American Academy of Pediatrics (AAP) cosponsored a conference entitled "The Short and Long-Term Consequences of Corporal Punishment" in February 1996. This article reviews scientific literature on corporal punishment and summarizes the proceedings from the conference. The authors conclude that, although the research data are inadequate to resolve the controversy, there are areas of consensus. Practitioners should assess the spanking practices of the parent they see and counsel parents to avoid those that are, by AAP consensus, dangerous, ineffective, or abusive.

  6. Corporate risk management : an overview

    NARCIS (Netherlands)

    Oosterhof, Casper M.

    2001-01-01

    Corporate risk management and hedging are important activities within financial as well as non-financial corporations. Under the assumptions of Modigliani and Miller [1958], corporate risk management is a redundant activity. However, the existence of market imperfections can explain the corporate

  7. Corporate marketing: Apocalypse, advent and epiphany

    OpenAIRE

    Balmer, JMT

    2009-01-01

    Purpose - this paper aims to explain the nature and relevance of corporate marketing and details the antecedents of the territory. Corporate marketing is a marketing and management paradigm which synthesises practical and theoretical insights from corporate image and reputation, corporate identity, corporate communications and corporate branding, among other corporate-level constructs. Design/methodology/approach – via the adoption of a quadrivium; a traditional classical, four-part, app...

  8. Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973

    Directory of Open Access Journals (Sweden)

    Guillermina Feudal

    2017-12-01

    Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.

  9. Corporate Finance, Incomplete Contracts, and Corporate Control

    OpenAIRE

    Patrick Bolton

    2014-01-01

    This essay in celebration of Grossman and Hart (GH) (Grossman, S., and H. Oliver. 1986. "The Costs and Benefits of Ownership: A Theory of Vertical and Lateral Integration," 94 Journal of Political Economy 691–719.) discusses how the introduction of incomplete contracts has fundamentally changed economists’ perspectives on corporate finance and control. Before GH, the dominant theory in corporate finance was the tradeoff theory pitting the tax advantages of debt (relative to equity) against ba...

  10. Corporate Risk Disclosure and Corporate Governance

    Directory of Open Access Journals (Sweden)

    Kaouthar Lajili

    2009-12-01

    Full Text Available To date, research which integrates corporate governance and risk management has been limited. Yet, risk exposure and management are increasingly becoming the core function of modern business enterprises in various sectors and industries domestically and globally. Risk identification and management are crucial in any business strategy design and implementation. From the investors’ point of view, knowledge of the risk profile, risk appetite and risk management are key elements in making sound portfolio investment decisions. This paper examines the relationships between corporate governance mechanisms and risk disclosure behavior using a sample of Canadian publicly-traded companies (TSX 230. Results show that Canadian public companies are more likely to disclose risk management information over and above the mandatory risk disclosures, if they are larger in size and if their boards of directors have more independent members. Minority voting control ownership structures appear to negatively impact risk disclosure and CEO incentive compensation shows mixed results. The paper concludes that more research is needed to further assess the impact of various governance mechanisms on corporate risk management and disclosure behavior.

  11. THE SOUND OF CORPORATE GOVERNANCE

    Directory of Open Access Journals (Sweden)

    DUMITRASCU LUMINITA MIHAELA

    2012-07-01

    Full Text Available The paper explores the corporate governance and corporate social responsibility in music industry, by reviewing the literature and investigating the aspects in the context of a sample made by top companies in this domain. The paper spotlighting the mutual connections between corporate governance and corporate social responsibility. The research methodology used consists in investigate the corporate governance codes. It’s about a qualitative interpretive research methodology that was adopted. The findings suggest the intercorelation of corporate governance with corporate social responsibility. The main contribution of the author consists in the fact that the added value of this paper and the original contribution leads in the intercorelation of these two aspects of corporate governance and corporate social responsibility, the findings beeing interesting, implying that recent preoccupation with corporate governance in music industry is starting to be equable by some attention to social responsibility aspects, with growing appreciation of their interdependencies. Previous literature has researched corporate governance and corporate social responsibility independently. Due to this fact, this paper is considering them jointly. The paper is important for both practical and theoretical aspects: for managers and also can serve as the basis for future research on this topic. The current paper is realized in the doctoral program entitled “PhD in Economics at the Standards of European Knowledge- DoEsEc”, scientific coordinator Prof. PhD Niculae Feleaga, Institution: The Academy of Economic Studies Bucharest, Faculty of Accounting and Management Informatic System, Department of International Accounting, period of research 2009-2012.

  12. CORPORATE BRANDING COWORKING PLACE IN BANDUNG (CORPORATE BRANDING COWORKING SPACE DI BANDUNG

    Directory of Open Access Journals (Sweden)

    Dewi Damayanti

    2017-10-01

    Full Text Available The title of this research is “Corporate Branding Coworking Space in Bandung” with the subtitle is “Descriptive Study of Corporate Branding Coworking Space in Bandung to Create Product Differentiation”. The high demand for economical workspace makes business coworking space growing. The growth happen in Bandung and make the level of competition coworking space in Bandung is quite high, especially with the uniformity of the product offered each coworking space. Seeing these growth, researchers interested in conducting research on how corporate branding coworking space in Bandung to create product differentiation.The purpose of this study is to discover how company create the vision, implemented vision to their corporate culture, and the compability between their vision and image of Bandung Digital Valley, Freenovation, and Ruang Reka that stakeholder created. The method used in this research is descriptive method with qualitative data and Hatch & Schultz’s concept of corporate branding. The data collection techniques used in interviews, observation, and documentation study.The result of this study indicate that Bandung Digital Valley, Freenovation, and Ruang Reka focus to introduce the company to their target market. Started from create the vision of the company by founder based on their experiences and business opportunity. Then, the application of corporate vision to corporate culture. Non of Bandung Digital Valley, Freenovation, or Ruang Reka implement the vision into corporate culture. Last, Bandung Digital Valley, Freenovation, and Ruang Reka think it is not a right time to create corporate image because they need to improve the quality of their facility first.   Keywords : corporate branding, product differentiation, Bandung Digital Valley, Freenovation, Ruang Reka Judul penelitian yang diangkat adalah “Corporate Branding Coworking Space di Bandung” dengan sub judul Studi Deskriptif mengenai Corporate Branding Coworking

  13. 75 FR 60138 - Consolidated Glass and Mirror Corporation, a Subsidiary of Guardian Industries Corporation, Galax...

    Science.gov (United States)

    2010-09-29

    ... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-73,579] Consolidated Glass and Mirror Corporation, a Subsidiary of Guardian Industries Corporation, Galax, VA; Notice of Affirmative... Consolidated Glass and Mirror Corporation, a Subsidiary of Guardian Industries Corporation, Galax, Virginia...

  14. 76 FR 19472 - Consolidated Glass and Mirror Corporation, a Subsidiary of Guardian Industries Corporation, Galax...

    Science.gov (United States)

    2011-04-07

    ... Mirror Corporation, a Subsidiary of Guardian Industries Corporation, Galax, VA; Notice of Negative... and Mirror Corporation, a Subsidiary of Guardian Industries Corporation, Galax, Virginia (subject firm... firm, stated that the Galax, Virginia facility is owned by ``Guardian Industries, a [[Page 19473...

  15. Corporate Involvement in C AI

    Science.gov (United States)

    Baker, Justine C.

    1978-01-01

    Historic perspective of computer manufacturers and their contribution to CAI. Corporate CAI products and services are mentioned, as is a forecast for educational involvement by computer corporations. A chart of major computer corporations shows gross sales, net earnings, products and services offered, and other corporate information. (RAO)

  16. Corporate values of the 25 largest European banks : Exploring the ambiguous link with corporate scandals

    NARCIS (Netherlands)

    Ehrenhard, Michel L.; Fiorito, Timo L.

    2018-01-01

    Corporate value statements communicate what a firm aspires for and what drives their value creation. In addition, corporate values often also define which behaviors are acceptable and which are not. Ideally, corporate values are representations of a firm's informal corporate values and

  17. Relationship between Corporate Governance and Information Security Governance Effectiveness in United States Corporations

    Science.gov (United States)

    Davis, Robert E.

    2017-01-01

    Cyber attackers targeting large corporations achieved a high perimeter penetration success rate during 2013, resulting in many corporations incurring financial losses. Corporate information technology leaders have a fiduciary responsibility to implement information security domain processes that effectually address the challenges for preventing…

  18. Electricity generation using white and red wine lees in air cathode microbial fuel cells

    Science.gov (United States)

    Pepe Sciarria, Tommy; Merlino, Giuseppe; Scaglia, Barbara; D'Epifanio, Alessandra; Mecheri, Barbara; Borin, Sara; Licoccia, Silvia; Adani, Fabrizio

    2015-01-01

    Microbial fuel cell (MFC) is a useful biotechnology to produce electrical energy from different organic substrates. This work reports for the first time results of the application of single chamber MFCs to generate electrical energy from diluted white wine (WWL) and red wine (RWL) lees. Power obtained was of 8.2 W m-3 (262 mW m-2; 500 Ω) and of 3.1 W m-3 (111 mW m-2; 500Ω) using white and red wine lees, respectively. Biological processes lead to a reduction of chemical oxygen (TCOD) and biological oxygen demand (BOD5) of 27% and 83% for RWL and of 90% and 95% for WWL, respectively. These results depended on the degradability of organic compounds contained, as suggest by BOD5/TCOD of WWL (0.93) vs BOD5/TCOD of RWL (0.33), and to the high presence of polyphenols in RWL that inhibited the process. Coulombic efficiency (CE) of 15 ± 0%, for WWL, was in line with those reported in the literature for other substrates, i.e. CE of 14.9 ± 11.3%. Different substrates led to different microbial consortia, particularly at the anode. Bacterial species responsible for the generation of electricity, were physically connected to the electrode, where the direct electron transfer took place.

  19. Corporate social responsibility and corporate governance in Indonesian public listed companies

    OpenAIRE

    Ika Siti Rochmah; Dwiwinarno Titop; Widagdo Ari Kuncara

    2017-01-01

    This study aims to investigate whether theree has been a change in the level of corporate social responsibility (CSR) disclosure and to examine whether corporate governance attributes influence CSR disclosure in corporate annual report of Indonesian public listed companies(PLCs). The annual reports of 115 PLC for two years (2011 and 2012) were analysed using content analysis. Multiple regression analysis was utilized to determine factors influencing CSR disclosure in annual reports. Consisten...

  20. 77 FR 65543 - Energy Corporation of America; Eastern American Energy Corporation; First ECA Midstream LLC...

    Science.gov (United States)

    2012-10-29

    ... Corporation of America; Eastern American Energy Corporation; First ECA Midstream LLC; Notice of Application Take notice that on October 16, 2012, Energy Corporation of America and Eastern American Energy Corporation (collectively, ECA), and First ECA Midstream LLC (First ECA Midstream), 501 56th Street SE...

  1. Comments, with reply, on 'Parallel resonant converter with LLC-type commutation' by C. Q. Lee et al.

    Science.gov (United States)

    Hamill, David C.

    1991-05-01

    In a recent paper by Lee et al. (1989), the authors analyzed a DC-DC converter that they termed the LLC-type PRC (parallel resonant converter). Its resonant network contains three active components-two inductances and a parallel capacitance -and as a consequence the the converter might be expected to have third-order dynamics. But Lee et al. employed a matrix transformation to show that the behavior of the circuit may be represented as a state-plane trajectory, as for a second-order circuit. The purpose of this contribution is to show that the converter has a zero-frequency eigenvalue, associated with undesirable circulating DC. The second-order dynamics exhibited by the third-order converter are explained by an application of Thevenin's theorem. Some aerospace applications of the LLC-type parallel resonant converter (PRC) are discussed. In their reply, the authors show that the circulating direct current does not exist in the practical converter circuit.

  2. Analyses and optimization of Lee propagation model for LoRa 868 MHz network deployments in urban areas

    Directory of Open Access Journals (Sweden)

    Dobrilović Dalibor

    2017-01-01

    Full Text Available In the recent period, fast ICT expansion and rapid appearance of new technologies raised the importance of fast and accurate planning and deployment of emerging communication technologies, especially wireless ones. In this paper is analyzed possible usage of Lee propagation model for planning, design and management of networks based on LoRa 868MHz technology. LoRa is wireless technology which can be deployed in various Internet of Things and Smart City scenarios in urban areas. The analyses are based on comparison of field measurements with model calculations. Besides the analyses of Lee propagation model usability, the possible optimization of the model is discussed as well. The research results can be used for accurate design, planning and for preparation of high-performance wireless resource management of various Internet of Things and Smart City applications in urban areas based on LoRa or similar wireless technology. The equipment used for measurements is based on open-source hardware.

  3. Information and Corporate Cultures.

    Science.gov (United States)

    Drake, Miriam A.

    1984-01-01

    This paper defines "corporate culture" (set of values and beliefs shared by people working in an organization which represents employees' collective judgments about future) and discusses importance of corporate culture, nature of corporate cultures in business and academia, and role of information in shaping present and future corporate…

  4. 78 FR 77508 - Duke Energy Carolinas, LLC; William States Lee III Nuclear Station, Units 1 and 2; Combined...

    Science.gov (United States)

    2013-12-23

    ... NUCLEAR REGULATORY COMMISSION [Docket Nos. 52-018 and 52-019; NRC-2008-0170] Duke Energy Carolinas, LLC; William States Lee III Nuclear Station, Units 1 and 2; Combined Licenses Application Review AGENCY: Nuclear Regulatory Commission. ACTION: Final environmental impact statement; availability...

  5. Negative employee corporate brand identification: A case study of a prominent Malaysian University corporate brand

    OpenAIRE

    Syed alwi, SF; Balmer, JMT; CheHa, N; Yen, D

    2014-01-01

    The purpose of this paper is to investigate negative employee corporate brand identification towards a business school in Malaysia. The research marshals the nascent literature of corporate brand identification (Balmer and Liao 2007; Balmer, Liao and Wang 2008) which marked new ground by drawing on social identity theory in corporate branding contexts. Corporate brand identification is relatively new concept but has been recognized as very important facet of corporate marketing (Balmer and Li...

  6. CORPORATE GOVERNANCE, OWNERSHIP STRUCTURE AND CORPORATE DIVERSIFICATION: EVIDENCE FROM THE MALAYSIAN LISTED COMPANIES

    Directory of Open Access Journals (Sweden)

    Ayoib Che Ahmad

    2003-01-01

    Full Text Available Previous research has contributed much to our understanding of the relationship between corporate diversification strategy and corporate governance quality. The majority of published works has been on sophisticated and mature markets in first world nations. This paper extends previous knowledge by examining this relationship in a developing country. Malaysia is a developing country that provides a rich setting for corporate governance research. The structure of the business environment and the availability of published data make it an interesting research site.The results showed that outside blockholding especially non-institutional blockholding was negatively associated with diversification. However, evidence of significant relationship between managerial ownership and diversification was not found although the directions were generally as expected. Similarly, good corporate governance was shown to reduce diversification activities. The variable for separate board structure was consistently significant in most of the estimations. However, the other measure of corporate governance namely the proportion of outside directors was not as significant as might be expected. The study opens the way for a richer understanding of the links between corporate governance, ownership structure and corporate diversification in a developing country.

  7. Corporate Universities and Corporation- University Partnerships in Thailand: Complimenting Education in Learning, Leadership and Change

    Directory of Open Access Journals (Sweden)

    Oliver S. Crocco

    2017-04-01

    Full Text Available With an estimated workforce of 285 million and the establishment of the Association of Southeast Asian Nations (ASEAN Economic Community in 2015, ASEAN faces vast challenges in human resource development (HRD and higher education. These challenges in Thailand have resulted in the rise of corporate universities and corporation-university partnerships. Corporate partnerships in education adapt quickly to industry needs and are increasingly popular and complimentary to traditional higher education. This research looks at one corporate university and one corporation-university partnership to investigate how, if at all, corporate universities and partnerships address HRD issues such as adult learning, leadership development, organisational change, corporate social responsibility (CSR, as well as ethical and global issues. This research finds initial evidence that corporate educational strategies address a variety of HRD issues and have the potential to revolutionise and compliment higher education in Thailand in a way that drives the nation toward a more sustainable future.

  8. La práctica corporal y la imagen corporal: reconstruyendo significados

    Directory of Open Access Journals (Sweden)

    Angela Vaquero Barba

    2014-01-01

    Full Text Available Este trabajo presenta una experiencia, en el ámbito de la formación del profesorado, vinculada a la propia imagen corporal. Ha pretendido, tomando como eje la actividad corporal y motriz, tomar conciencia de cómo percibimos, sentimos y valoramos nuestro cuerpo; valorar la actividad motriz-corporal como herramienta para la construcción de nuevos significados; y capacitar al alumnado para reaprender la manera en que percibimos, sentimos y valoramos nuestro cuerpo. Los resultados apoyan la necesidad de capacitar al alumnado femenino para valorar su imagen corporal, la idoneidad de las prácticas corporales para impulsar procesos de reconstrucción y el interés de la escritura como herramienta que da forma a la reconstrucción.

  9. CORPORATE GOVERNANCE IN MALAYSIA: THE EFFECT OF CORPORATE REFORMS AND STATE BUSINESS RELATION IN MALAYSIA

    Directory of Open Access Journals (Sweden)

    Nor Azizah Zainal Abidin

    2007-01-01

    Full Text Available The Asian Financial Crisis in 1997 not only introduced the term of corporate governance but also drew attention of the public about the weaknesses of Malaysian corporate governance practice. After 1998, Malaysian government decided to adopt corporate reform that could enhance the quality of good corporate management practice. Thisreform is clearly stated in the code and rules of corporate governance. The purpose of this research is to study the significance of implementing the code and rules of corporategovernance since the public already realize the close relationship between business and politics. Three companies were chosen as indicators for this study. As a result, it was found that companies which are involved in corporate malpractice but have goodrelationship with states will always be excluded from the legal corporate action.

  10. Corporate strategy in turbulent environments: Key roles of the corporate level

    OpenAIRE

    Caldart, Adrian A.; Ricart, Joan E.

    2006-01-01

    This paper analyzes the evolution during the period 1986-2002 of the corporate strategy of Lujan, a highly successful car components manufacturer headquartered in Spain, as a way to explore how the corporate level influences the successful evolution of a company exposed to a "turbulent" environment over a long period. We find that the corporate level plays three key roles. First, it drives a firm's evolution by developing a cognitive representation of the firm's competitive landscape. Second,...

  11. Corporate Innovation and Entrepreneurial Development | Iyayi ...

    African Journals Online (AJOL)

    This paper aimed at a theoretical exposition of the influence of corporate innovation on entrepreneurial development. To achieve this purpose a review of extant literature on innovation and creativity, concept of corporate innovation process of corporate innovation, approaches to corporate innovation, corporate innovation ...

  12. CORPORATE GOVERNANCE IN MALAYSIA: THE EFFECT OF CORPORATE REFORMS AND STATE BUSINESS RELATION IN MALAYSIA

    OpenAIRE

    Nor Azizah Zainal Abidin; Halimah @ Nasibah Ahmad

    2007-01-01

    The Asian Financial Crisis in 1997 not only introduced the term of corporate governance but also drew attention of the public about the weaknesses of Malaysian corporate governance practice. After 1998, Malaysian government decided to adopt corporate reform that could enhance the quality of good corporate management practice. Thisreform is clearly stated in the code and rules of corporate governance. The purpose of this research is to study the significance of implementing the code and rules ...

  13. Lee Silverman Voice Treatment for People with Parkinson's: Audit of Outcomes in a Routine Clinic

    Science.gov (United States)

    Wight, Sheila; Miller, Nick

    2015-01-01

    Background: Speaking louder/more intensely represents a longstanding technique employed to manage voice and intelligibility changes in people with Parkinson's. This technique has been formalized into a treatment approach and marketed as the Lee Silverman Voice Treatment (LSVT®) programme. Evidence for its efficacy has been published. Studies…

  14. From Corporate Social Responsibility to Corporate Sustainability: Features of Financing Sustainable Development

    Directory of Open Access Journals (Sweden)

    Vasylchuk Irуna P.

    2018-03-01

    Full Text Available The theoretical basis of the concepts of corporate social responsibility and sustainable development are studied. It is revealed that scientists mainly distinguish two main stages in the evolution of the concept of corporate social responsibility. There argued the expediency of singling out the third stage of the development of the concept (version CSR 2.0, which is characterized by the integration of the theoretical and practical foundations of the concepts of CSR and sustainable development as well as by their implementation into activities of corporations. The presence of the necessary prerequisites for singling out the new stage in the evolution of these concepts (version CSR 3.0, which is based on the provisions of the collaborative theory and provides for the cooperation of social enterprises and sustainable corporations in achieving the goals of sustainable development, is revealed, its expediency is justified. The determinant of the stage is the use of opportunities for sustainable development, the dominant is the social orientation, and its content is characterized by the slogan “doing common good to do common well”. Using generalization, there identified the features of the established models of sustainable development of corporations by key aspects (goals, principles, methods. On this basis, the features of approaches to financing sustainable development at the macro and micro levels are determined, and the principles for financing the activities of corporations in the new conditions are defined. It is concluded that achieving sustainability requires an effective system of financing corporate measures aimed at sustainable development, for the creation of which in Ukraine it is necessary to use the experience of “best practices” at the national, local and corporate levels.

  15. Quantum-statistical mechanics of an atom-dimer mixture: Lee-Yang cluster expansion approach

    International Nuclear Information System (INIS)

    Ohkuma, Takahiro; Ueda, Masahito

    2006-01-01

    We use the Lee-Yang cluster expansion method to study quantum-statistical properties of a mixture of interconvertible atoms and dimers, where the dimers form in a two-body bound state of the atoms. We point out an infinite series of cluster diagrams whose summation leads to the Bose-Einstein condensation of the dimers below a critical temperature. Our theory captures some important features of a cold atom-dimer mixture such as interconversion of atoms and dimers and properties of the mixture at the unitarity limit

  16. Adaptation of Sing Lee's model to the Filippov type plasma focus geometry

    International Nuclear Information System (INIS)

    Siahpoush, V; Tafreshi, M A; Sobhanian, S; Khorram, S

    2005-01-01

    A new model for plasma behaviour in Filippov type plasma focus (PF) systems has been described and used. This model is based on the so-called slug model and Sing Lee's model for Mather type PF devices. Using the model, the discharge current and its derivative as a function of time, and the pinch time and the maximum discharge current as a function of pressure, have been predicted. At the end, the predicted data are compared with the experimental data obtained through a Filippov type PF facility with a nominal maximum energy of 90 kJ

  17. Corporate Governance and Shareholder Litigation

    OpenAIRE

    Kalchev, Georgi

    2009-01-01

    The probability for shareholder litigation is studied and how corporate governance characteristics and other factors explain it. Shareholder litigation results from failure of corporate governance. Thus a better quality of corporate governance is hypothesized to decrease the litigation probability. Corporate governance index is constructed based on principal components. It is found to be a significant predictor of shareholder litigation.

  18. COMPARATIVE STUDY ON CORPORATE GOVERNANCE

    Directory of Open Access Journals (Sweden)

    Gavrea Corina

    2011-12-01

    Full Text Available Corporate governance is a key element of today’s economic reality being more and more present in many countries around the world. This paper has two main objectives. The first one is to offer more insight into the concept of corporate governance by a thorough literature review and by presenting and analyzing a framework of corporate governance. The second objective of this paper is to investigate the corporate governance situation in three developing economies (Romania, Bulgaria and Hungary. The World Bank and the European Bank for Reconstruction and Development published a series of reports on corporate governance. The present study uses data from these reports in order to illustrate how these developing economies are dealing with corporate governance. Based on ROSC Reports a corporate governance score was calculated. As this score shows, there is room for improvement for all three developing economies. This study is important because it shows the differences in corporate governance among developing economies and the need to study these nations at the individual country level. Corporate governance has many benefits for developing economies. It helps developing economies to register sustainable growth rates, to increases investors’ confidence in the national economy, and to increase the ability of capital markets to mobilize savings.

  19. European Corporate Law

    DEFF Research Database (Denmark)

    Dorresteijn, Adriaan; Teichmann, Christoph; Werlauff, Erik

    , and the United Kingdom are taken into account; Italy is now included in this new edition. As in earlier editions, the authors demonstrate that analysis and comparison of national corporate laws yield highly valuable general principles and observations, not least because business organizations, wherever located...... initiatives in such aspects of the corporate environment as regulation of financial institutions and non-financial reporting obligations with a view to sustainability and other social responsibility concerns. The authors, all leading experts in European corporate law, describe current and emerging trends...

  20. Corporate income tax

    OpenAIRE

    Popová, Barbora

    2014-01-01

    1 RESUMÉ Corporate Income Tax The aim of this diploma thesis on "Corporate Income Tax" is to outline the current legal background of the corporate income tax and asses and evaluate the most substantial changes regarding the Act no. 586/1992 Coll., Income Tax Act, as amended that have become effective as of January 1, 2014. The changes discussed in this thesis include especially, but are not limited to, the changes adopted in connection with the recodification of Czech Civil Law. This thesis c...

  1. Impacts of Socially Responsible Corporate Activities on Korean Consumers’ Corporate Evaluations in the Agrifood Industry

    Directory of Open Access Journals (Sweden)

    Dongmin Lee

    2016-12-01

    Full Text Available The variety of socially responsible corporate activities employed in the agrifood industry has been broadening. An increasing number of agrifood companies have been employing strategic approaches to socially responsible activities, reinforced by Porter and Kramer’s concept of creating shared value (CSV. This study compares the effects on corporate evaluations of two socially responsible corporate activities: philanthropic giving and CSV. Because prior studies concerning the effects of corporate prosocial behaviors on consumer responses have yielded mixed results, the present study examines the effects of a priori perceptions of companies by using corporate stereotypes as moderators. The results show that the type of socially responsible corporate activity (CSV vs. philanthropic giving does not influence corporate evaluations. However, in cases of CSV (vs. philanthropic giving, consumers evaluate an unwarm but competent company more attractively and place higher value on an incompetent but warm company. This research is important not only for enriching existing literature, but also for providing guidelines to practitioners with respect to selecting appropriate corporate initiatives based on perceived consumer stereotypes.

  2. Determinants of Corporate Governance and Corporate Performance among Consumer Product Industry in Malaysia: A Theoretical Model

    OpenAIRE

    Kogilavani Apadore; Siti Subaryani Binti Zainol

    2014-01-01

    This study discusses on the relationship between corporate governance mechanisms and corporate performance of public listed companies in Bursa Malaysia among the consumer product industry. It investigates the corporate governance mechanisms such as ownership concentration, audit quality, board independence and CEO duality, are used to test on the relationship between both corporate governance and corporate performance. The proposed model indicates that the proportion of independent non-execut...

  3. Corporate Governance Country Assessment : Uruguay

    OpenAIRE

    World Bank

    2005-01-01

    This report provides an assessment of Uruguay's corporate governance policy framework, enforcement and compliance practices. It highlights recent improvements in corporate governance regulation, makes policy recommendations, and provides investors with a benchmark against which to measure corporate governance in Uruguay. The report identifies several key next steps that focus on implementation including: Improving corporate information, particularly ownership disclosure, related party transac...

  4. An Analytical Evaluation of Spall Suppression of Impulsively Loaded Aluminum Panels Based on a One Dimensional Stress Wave Propagation Model.

    Science.gov (United States)

    1984-03-01

    continued support in this research work. The author also wishes to thank Mr. Ronald E. Musante , Mr. Anthony P. Lee and the staff of FMC Corporation’s...West Point, New York 10996 8. Mr. R. E. Musante Manager, Armor Design Group Ordnance Division FMC Corporation California 90041 1105 Coleman Ave., Box

  5. Visioni vittoriane: il paesaggio fiorentino nelle opere di Janet Ross e Vernon Lee

    Directory of Open Access Journals (Sweden)

    Gabriele Corsani

    2015-11-01

    Full Text Available Fra l’ultimo scorcio dell’Ottocento e i primi decenni del Novecento Firenze e i suoi dintorni sono il soggetto privilegiato di una grande quantità di descrizioni, note di diario, racconti, opera di scrittori stranieri, in particolare inglesi, che si radicano nell’approdo elettivo di quei luoghi. Il testo presenta la traccia letteraria del paesaggio fiorentino nelle opere di Vernon Lee e Janet Ross, due tipiche rappresentanti di questa tendenza che hanno vissuto, attraverso vicende biografiche in qualche modo parallele, un’esperienza di intensa identificazione con il paesaggio fiorentino. Di Janet Ross, viene commentato Old Florence and Modern Tuscany, volume che raccoglie una serie di articoli pubblicati su alcune riviste inglesi e fornisce una efficace panoramica sull’interesse molto concreto di Janet Ross per il mondo rurale che la vede addirittura impegnata nella gestione della fattoria di Castagnolo, a Lastra a Signa. Più sfaccettato è il commento alle opere di Vernon Lee, di cui sono commentati passi da Vanitas. Polite Stories, Genius Loci, Hortus Vitae and Limbo, in virtù della maggiore ampiezza e complessità del suo mondo culturale. Ne sono cifra distintiva la associazione fra storia e realtà attraverso la dimensione del mistero, che risulta una delle chiavi di acccesso alla bellezza e alla vitalità del paesagggio e la capacità di cogliere il ritmo proprio dei luoghi e di entrare in reale sintonia con essi. 

  6. James Lee Byars 1/2 an autobiography, sourcebook

    CERN Document Server

    Byars, James Lee; Eleey, Peter

    2014-01-01

    "I see my autobiography as an arbitrary segment of so many pages of time, of things that I have paid attention to at this point in my life," wrote James Lee Byars (1932-1997) in 1969. He was then 37, about half the average male lifespan at the time, and accordingly thought it appropriate to write his "1/2 autobiography." Byars' art ranged from highly refined objects to extremely minimal performance and events, and books, ephemera and correspondence that he distributed widely among friends and colleagues. Today, more than 15 years after his death, assessments of his art must negotiate Byars' performance of his charismatic self in his life and art. For his first major posthumous survey in the US, exhibition curators Magalí Arriola and Peter Eleey decided to produce a catalogue in two "halves," playing on his "1/2 autobiography": a catalogue of the exhibition itself, including new scholarship, and a sourcebook of primary documents. 1/2 an Autobiography, Sourcebook constitutes the latter volume--a reference guid...

  7. Corporate Taxation and Investment: The Case of the Split Rate Corporate Tax System in Macedonia

    Directory of Open Access Journals (Sweden)

    Ilija Gruevski

    2018-12-01

    Full Text Available The majority of experts agree that taxes are distortionary in nature. This is relatively true for all of the different groups of taxes, but for the corporate taxes is exceptionallyobvious. The existence of the corporate tax system can affect the company’s behavior in number of ways and one of the most criticized is the ability for distortion of the choice of the sources of finance. In the following article, we explore the effects from corporate taxation on investment, through the methodological frame of the effective marginal tax rates. The objective is to analyze the investment decision in the case of isolated implementation of corporate taxes which means that the effects from the so-called “double taxation”, induced by the personal taxes are not taken in consideration. We hope to prove that these conditions generate “uneven” distribution of the burden across the projects covered with different sources of finance. Also, we intend to test and explore the properties of some alternative corporate tax systems which are widely known as neutral, such as: the comprehensive business income tax system (CBIT, the imputation corporate tax system (ICT, the full imputation corporate tax system (FICT, the allowance for corporate equity tax system (ACE and the split rate corporate tax system (SRCT. In addition, we support our findings with a practical example: the case study from the implementation of the split rate corporate tax system in Macedonia.

  8. 20 CFR 404.1006 - Corporation officer.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Corporation officer. 404.1006 Section 404... Corporation officer. If you are an officer of a corporation, you are an employee of the corporation if you are... director of a corporation, we consider you to be self-employed when you work as a director. ...

  9. Fungal and enzymatic remediation of a wine lees and five wine-related distillery wastewaters

    CSIR Research Space (South Africa)

    Strong, PJ

    2008-09-01

    Full Text Available The alcohol fermentation industry is divided into three main categories: brewing, distilling and wine manufacture. Each of these categories produces wastewaters with com- mon characteristics, such as acidic pH values and high bio- chemical oxygen demand....O. Box 94, Grahamstown 6140, South Africa , Pretoria 0001, South Africa 6 December 2007; accepted 12 December 2007 (2008) xxx–xxx and enzymatic remediation of a wine lees and five ..., Bioresour. e ARTICLE IN PRESS Distillery and wine...

  10. Corporate design management

    NARCIS (Netherlands)

    drs. Patrick van Thiel; drs. Wil Michels

    2006-01-01

    'Corporate designmanagement' is een vlot geschreven en zeer overzichtelijk standaardwerk op het gebied van corporate designmanagement. Een sterke visuele identiteit is voor een organisatie een doeltreffend middel om zich te positioneren en te profileren. Voorwaarde is wel dat de visuele identiteit

  11. Integration of Corporate Social Responsibility and Corporate Communication

    OpenAIRE

    Islam, Mohammad Nur

    2017-01-01

    The purpose of this study is to present a new perspective on the current practices in corporate communications and CSR which calls for an integration of social responsibility and communication activities of corporations as an opportunity of competitive advantage. More specifically, this study looks at this subject from the angle of how companies can use communications to achieve CSR goal, while CSR can be a way to attain efficacy in communication. The study is designed to examine the current ...

  12. THE RELATIONSHIP BETWEEN CORPORATE VOLUNTEERING AND CORPORATE SOCIAL RESPONSIBILITY: RESULTS OF AN EMPIRICAL STUDY

    Directory of Open Access Journals (Sweden)

    Oscar Licandro

    2017-01-01

    Full Text Available Corporate Volunteering (CV is a phenomenon that emerged in the second half of the 20th century and began to grow and globalize at the beginning of the 21st century. There seems to be a consensus that the recent growth of Corporate Volunteering is related to the development and growing legitimacy of the concept of Corporate Social Responsibility (CSR. Nevertheless, the theoretical discussion on how the two concepts (Corporate Volunteering and Corporate Social Responsibility are related is just beginning, while empirical research on how this relationship operates in corporate practice is still incipient. This paper presents preliminary results of a research on this subject carried out in Uruguay in 2016. This is a statistical study that analyses the relationship between the application of corporate volunteering activities and the incorporation of a CSR approach to the management of companies. The incorporation of both types of practices is measured by a self-assessment questionnaire that includes 81 indicators (using a Likert scale to assess them, which were designed based on ISO 26000 Guidance of Social Responsibility. The questionnaire was administered to 96 companies, using a comparative analysis between those that practice Corporate Volunteering and those which do not. The results obtained allow us to support the hypothesis that the application of Corporate Volunteering is positively associated with the incorporation of CSR when managing the relationship between the company and its employees and also with the community. Moreover, these results contribute to a better understanding on how both concepts are related.

  13. Corporate governance and the audit committee as part of Corporate Social Responsibility

    OpenAIRE

    Mancilla Rendón María Enriqueta; Saavedra García María Luisa

    2015-01-01

    The purpose of this paper is to study the principles of the international standard ISO 26000, and the relation between social responsibility and internal control rules management organizations establish their business and relationship with Corporate Social Responsibility the board of directors and the audit committee to strengthen corporate trust and manage corporate risk. The research is based on a survey of companies listed on the Mexican stock market, in 2011. The variables have been studi...

  14. Strategic corporate sustainability

    DEFF Research Database (Denmark)

    Grewatsch, Sylvia; Rohrbeck, René; Madsen, Henning

    antecedents and outcomes. To overcome this limitation we propose an integrated typology which may facilitate more research on the link between corporate sustainability performance (CSP) and corporate financial performance (CFP). Our expectation is that the strategy type might play a moderating or mediating...

  15. Understanding Corporate Culture.

    Science.gov (United States)

    Cluff, Gary A.

    1988-01-01

    Considers concept of corporate culture and discusses several values which can be considered when assessing corporate culture, and the "compatibility scales" used to measure them. Included are discussions of employee attitudes, work atmosphere, internal communications, management style, employment opportunity, stability, business ethics, corporate…

  16. Reinventing Corporate Communications.

    Science.gov (United States)

    Toth, Elizabeth L.; Trujillo, Nick

    1987-01-01

    Urges a "re-inventing" of corporate communications in today's organizations, and provides information about how corporations can change in new and positive ways during the current "information age." Discusses specific public relations and organizational communication concepts essential for a comprehensive understanding of…

  17. Identical or Just Compatible? The Utility of Corporate Identity Values in Communicating Corporate Social Responsibility

    DEFF Research Database (Denmark)

    Schmeltz, Line

    2014-01-01

    This study explores whether companies embracing a corporate social responsibility agenda have a strategic focus on adapting and aligning their value systems to reflect such commitment. The analysis is based on empirical data and a conceptual model juxtaposing corporate values, corporate social...... is discussed in relation to the reported difficulties that companies experience when facing the new and complex challenge of communicating corporate social responsibility....

  18. CORPORATE GOVERNANCE IN INDIA: AN ANALYSIS

    Directory of Open Access Journals (Sweden)

    Meghna Thapar

    2017-03-01

    Full Text Available Corporate governance is a process, relation and mechanism set up for the corporations and firms based on certain guidelines and principles by which a company is controlled and directed. The principles provided in the system ensure that the company is governed in a way that it is able to set and achieve its goals and objectives in the context of the social, regulatory and market environment, and is able to maximize profits and also benefit those whose interest is involved in it, in the long run. The division and distribution of rights and responsibilities among different participants in the corporation (such as the board of directors, managers, shareholders, creditors, auditors, regulators, and other stakeholders and inclusion of the rules and procedures for making decisions in corporate affairs are identified with the help of Corporate Governance mechanism and guidelines. The need to make corporate governance in India transparent was felt after the high profile corporate governance failure scams like the stock market scam, the UTI scam, Ketan Parikh scam, Satyam scam, which were severely criticized by the shareholders. Thus, Corporate Governance is not just company administration but more than that and includes monitoring the actions, policies, practices, and decisions of corporations, their agents, and affected stakeholders thereby ensuring fair, efficient and transparent functioning of the corporate management system. By this paper, the authors intend to examine the concept of corporate governance in India with regard to the provisions of corporate governance under the Companies Act 2013. The paper will highlight the importance and need of corporate governance in India. We will also discuss the important case laws which contributed immensely in the emergence of corporate governance in India.

  19. Behavioral corporate governance : four empirical studies

    NARCIS (Netherlands)

    van der Laan, G.

    2009-01-01

    This thesis consists of studies of corporate governance from a behavioral perspective. The chapters are about trust between chief executive officers (CEOs) and board chairpersons, asymmetric effects of corporate social responsibility on corporate financial performance, compliance with corporate

  20. CORPORATIONS IN RUSSIAN ECONOMICS OF TODAY

    Directory of Open Access Journals (Sweden)

    S. A. Shirokovskikh

    2011-01-01

    Full Text Available In Russian economics there are purely Russian private corporations as well as mixed state/private owned and transnational corporations. Specific ways of forming corporations in Russia resulted in corporate management models different from those used abroad (exclusive of largest holdingcompanies with considerable participation of the state. Difference in the corporation forms is determined by relations between owners and top managers. Efficient and sustainable (in the western sense functioning of Russian corporations may become effective only after long timeprovided RF ownership right legislation gets simultaneously improved.

  1. Intelligence analysis in corporate security

    Directory of Open Access Journals (Sweden)

    Manojlović Dragan

    2014-01-01

    Full Text Available Located in the survey indicate that the protection of a corporation, its internal and external interest from the perspective of quality data for intelligence analysis and the need for kroporacije and corporate security. Furthermore, the results indicate that the application is not only practical knowledge of intelligence analysis, but also its scientific knowledge, provides epistemologically oriented critique of traditional techniques undertaken in corporate security in connection with the analysis of the challenges, risks and threats. On the question of whether it can and should be understood only as a form of corporate espionage, any aspect of such a new concept in the theory and practice of corporate security, competitive intelligence activities, as well as an activity or involves a range of different methods and techniques meaningful and expedient activities to be implemented integrally and continuously within corporate security, given the multiple responses to the work. The privatization of intelligence activities as an irreversible process that was decades ago engulfed the western hemisphere, in the first decade of the third millennium has been accepted in Europe, in the sense that corporations at national and multinational levels of system intelligence analysis used not only for your safety but also for the competition, and nothing and less for growth companies and profits. It has become a resource that helps control their managers in corporations to make timely and appropriate decisions. Research has shown that intelligence analysis in corporate security one factor that brings the diversity of the people and give corporations an advantage not only in time, but much more on the market and product.

  2. Corporate entrepreneurship in organisational life-cycle

    OpenAIRE

    Duobienė, Jurga

    2013-01-01

    Paper deals with the development of corporate entrepreneurship in different stages of organisational life-cycle. The research presents a model for the evaluation of corporate entrepreneurship and systemises relevant theoretical and empirical research in the field of entrepreneurship and corporate entrepreneurship. Moreover, it describes the development of corporate entrepreneurship in the entire organisational life-cycle since most of researchers who discuss the topics of corporate entreprene...

  3. Role of the Occupational Physician in Corporate Management of Health Risks: An Important Aspect of Corporate Social Responsibility (CSR).

    Science.gov (United States)

    Sugita, Minoru; Miyakawa, Michiko

    2016-01-01

    There are various risks involved in corporate activities conducted both within and outside the corporation. Among these, health risks are very important and should be managed effectively as an integral part of corporate social responsibility (CSR). A corporation is responsible for health impairments caused by its activities and suffers great moral and economic loss when they occur. It is essential that corporate management takes proper preventive measures against such risks. Occupational physicians possess substantial knowledge of health risks in corporations. In this study, we examine the role of occupational physicians in the management of corporate health risks. Information was obtained from articles in print and on the Internet. Health risks due to corporate activities involve not only the employees of the corporation but also individuals outside the corporation. Each corporation should effectively use available resources to manage health risks. Occupational physicians are one such valuable resource. However, many corporations do not actively involve occupational physicians in health risk management. According to a current Japanese law, health risks for employees in corporations are managed by occupational physicians, but in general, health risks outside corporations are not. The 1984 Bhopal Disaster in India is an example in which physicians of the corporation were only minimally, if at all, involved in assessing and treating impaired health outside the corporation. The role of occupational physicians should be expanded to include management of health risks outside the corporation. This places a greater burden on the physicians and they must make the effort to train in many academic fields in order to better understand the entire context of health risks due to corporate activities. Some occupational physicians may be hesitant to take on such added responsibilities. Some corporations may not recognize the overall health risks due to its activities and do not

  4. Theoretical Framework for Corporate Governance

    OpenAIRE

    Georgescu Cristina Elena

    2012-01-01

    History has revealed that there is a never-ending evolution of theories or models of corporate governance. Companies are trying to instill the sense of governance into their corporate structure. This article is a review of literature on the range of theories in corporate governance. The fundamental theories in corporate governance began with the agency theory, expanded into stewardship theory and stakeholder theory and evolved to transaction cost theory. However, these theories address the ca...

  5. Corporate Media Governance

    NARCIS (Netherlands)

    Kempen, Petrus Cornelis

    2011-01-01

    The media can make or break a reputation. This being said, it seems to be essential for companies, governments and institutions to pay specific attention to corporate media management in their daily operations. However, this thesis shows that they often neglect to pay adequate attention to corporate

  6. Corporate contestability and corporate expropriation

    Directory of Open Access Journals (Sweden)

    Abdul Hadi Zulkafli

    2016-12-01

    Full Text Available This paper presents evidence on the role of ownership in dealing with corporate expropriation of listed companies in Malaysia. From the perspective of expropriation, a single controlling shareholder is always associated with such behavior due to their power and control at the expense of minority shareholder. However, subsequent individual or coalition of large shareholders can be an important corporate governance tool by providing effective monitoring that would lessen the possibility of expropriation by the controlling shareholder. Relating to that, this study evaluates the role of controlling and large shareholders in dealing with corporate expropriation. It is found that there is a negative relationship between single controlling shareholders and dividend payout ratio indicating that firms with only controlling shareholder will pay a lower dividend due to possible expropriation through profit diversion by controlling shareholder. Using Herfindahl Index as a proxy for ownership contestability, the presence of large shareholders along with controlling shareholder has a positive relationship with dividend payout implying that increased contestability helps to curb the power of controlling shareholder to expropriate fund for their own benefit. In accordance with agency theory, the outcome suggests that large shareholders play a monitoring role in minimizing the Type II agency problem. It is also verifying the argument made based on the Catering Theory of Dividend that the presence of large shareholder brings benefit to all shareholders as they are able to reduce profit diversion by demanding for higher dividend

  7. Corporate Social Performance and Corporate Financial Performance: A Link for the Indian Firms

    Directory of Open Access Journals (Sweden)

    Rupal Tyagi

    2013-03-01

    Full Text Available The present study addresses the issue of the relationship between Corporate Social performance and corporate Financial Performance in Indian context under good management theory. The study used S&P ESG India Index as a proxy of CSP/ CSR (Corporate social performance or Corporate Social Responsibility of Indian firms for the first time over the 2005–2011 periods. We designed econometric models and controlled industry specific attributes and performed Weighted Least Square method for the analysis. Overall results show neutral though modest negative relationship between the CSP and CFP which eventually informs that if there would be any relationship, it would be negative.

  8. Corporate Responsibility

    OpenAIRE

    World Bank

    2004-01-01

    Appeals to corporate responsibility often simply take for granted that businesses have ethical responsibilities that go beyond just respecting the law. This paper addresses arguments to the effect that businesses have no such responsibilities. The interesting claim is not that businesses have no ethical responsibility at all but that their primal responsibility is to increase their profits. The extent to which there is reason to take such arguments seriously delineates the limits of corporate...

  9. The Organisation of Multibusiness Corporations: Four Roles of the Corporate Office

    OpenAIRE

    David J. Collis

    1998-01-01

    This paper derives four archetypal roles for the corporate office in diversified companies and a set of hypotheses about the organisation structure, systems and processes of each from an analysis of the resources which justify the existence of the corporation as a multibusiness entity.

  10. Rise of a New Corporate Vehicle

    DEFF Research Database (Denmark)

    Fomcenco, Alex

    2014-01-01

    So-called Public Benefit Corporations do not bring any revolutionary amendments to the way the traditional corporations are. But they represent a shift in the way our corporate mind and mentality is evolving. Despite the deficiencies in legislation, it must be acknowledged that this new corporate...

  11. 12 CFR 619.9185 - Funding Corporation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Funding Corporation. 619.9185 Section 619.9185 Banks and Banking FARM CREDIT ADMINISTRATION FARM CREDIT SYSTEM DEFINITIONS § 619.9185 Funding Corporation. The term Funding Corporation refers to the Federal Farm Credit Banks Funding Corporation...

  12. Numerical Simulation of Wake Effects in the Lee of a Farm of Wave Dragon Wave Energy Converters

    DEFF Research Database (Denmark)

    Beels, C.; Troch, P.; De Visch, K.

    2009-01-01

    . In this paper wake effects in the lee of a single Wave Dragon WEC and multiple Wave Dragon WECs are studied in a time-dependent mild-slope equation model. The Wave Dragon WEC is a floating offshore converter of the overtopping type. The water volume of overtopped waves is first captured in a basin above mean...

  13. Analisis Pengaruh Islamic Corporate Governance Terhadap Corporate Social Responsibility (Studi kasus pada Bank Syariah di Indonesia

    Directory of Open Access Journals (Sweden)

    Ismawati Haribowo

    2016-01-01

    Full Text Available This study aims to examine the influence of Islamic corporate governance, size of the Board of Commissioners, the composition of the Board of Commissioners, Frequency of Meetings of the Board of Commissioners, the size of the Audit Committee Independent, The composition of the Audit Committee Number of Meetings Audit Committee, Profitability and Liquidity on the disclosure of corporate social responsibility (case study on the bank Sharia in Indonesia. This research is a quantitative study using scientific research in the form of positive economics. The nature and type of this research is descriptive method used is based on a survey of the literature. Data used is secondary data obtained from www.bi.go.id and corporate websites. The analytical method used is multiple linear regression analysis with SPSS version 22. The population in this study are all Islamic banks registered in Bank Indonesia during the period 2012 to 2014. While the sample is determined by using purposive sampling method in order to obtain a sample of 10 banks with observations for 3 years.Based on the results of multiple regression analysis with significance level of 5%, then the results of this study concluded: (1 Islamic Corporate Governance consisting of Existence and expertise Sharia Supervisory Board has no significant effect on the disclosure of corporate social responsibility. (2 The size of the BOC significant effect on the disclosure of corporate social responsibility. (3 The composition of the Board of Commissioners has no significant effect on the disclosure of corporate social responsibility. (4 The frequency of the number of board meetings no significant effect on the disclosure of disclosure of corporate social responsibility. (5 The size independent audit committee has no significant effect on the disclosure of corporate social responsibility. (6 The composition of the independent audit committee has no significant effect on the disclosure of corporate social

  14. Corporate Governance Quality, Board Gender Diversity and Corporate Dividend Policy: Evidence from Jordan

    Directory of Open Access Journals (Sweden)

    Ayat S. Al-Rahahleh

    2017-06-01

    Full Text Available This paper examines the impact of corporate governance quality and board gender diversity on the corporate dividend policy for a set of all non-financial companies listed on Amman Stock Exchange (ASE during the period 2009-2015. The results documented that corporate governance quality and board gender diversity proxies have positive impact on corporate dividend policy. The results also showed that the women representation on the boards of non-financial companies in Jordan is considered low relative to other countries. Particularly, the causes of the poor board gender diversity in Jordan range from lack of awareness about the benefits of gender diversity to the lack of legislation that regulates this issue. It is recommended to non-financial companies in Jordan to boost their compliance with the corporate governance code and adopt diversity policies to enhance the effectiveness of the boards and keep favorable relationships with their shareholders. Furthermore, regulatory bodies in Jordan should take a step towards encouraging gender diversity on boards.

  15. CORPORATE SOCIAL RESPONSIBILITY – CORPORATE BRANDING RELATIONSHIP: AN EMPIRICAL COMPARATIVE STUDY

    Directory of Open Access Journals (Sweden)

    Bistra VASSILEVA

    2009-01-01

    Full Text Available Current academic research on the relationship of firms’ CSR activities with corporate branding typically focuses on consumers’ and shareholders’ viewpoints. This research aims to shed light on how organisational members in firms perceive to be the impact of CSR activities upon their corporate brand strategy. Using a survey administered to companies in the U.K. and Bulgaria, the author investigate, firstly, organisational members’ perceptions of the impact of different CSR-related activities upon corporate branding and, secondly, their beliefs about what customers and shareholders think are the impacts of CSR-related activities upon brand image and brand identity. The findings indicated that while organisational members rated quality products, customer service and corporate governance highly as key components of CSR activity, they were much more ambivalent about their companies'commitment to broader actions which involve the 'community' and 'society'. This paper concludes by discussing the implications of the findings for future 'CSR education' among companies.

  16. TAX AVOIDANCE, RELATED PARTY TRANSACTIONS, CORPORATE GOVERNANCE AND THE CORPORATE CASH DIVIDEND POLICY

    OpenAIRE

    Sari, Dewi Kartika; Utama, Sidharta; Rossieta, Hilda

    2017-01-01

    This study aims to investigate the relationship between tax avoidance, related party transactions and the corporate dividend policy. Furthermore, this study will also investigate the moderating effects of the implementation of Corporate Governance (CG) on the relationship between tax avoidance, Related Party Transactions (RPT) and corporate dividend policies. Our sample covers companies listed on the Indonesian Stock Exchange during 2011-2014. The results provide moderate support for the prop...

  17. Introductory Guide to European Corporate Law

    DEFF Research Database (Denmark)

    Fomcenco, Alex

    Introductory Guide to European Corporate Law presents in an easily comprehensible and accessible way the main features and principles that govern European corporate law.......Introductory Guide to European Corporate Law presents in an easily comprehensible and accessible way the main features and principles that govern European corporate law....

  18. The Complementarity between Corporate Governance and Corporate Social Responsibility

    OpenAIRE

    Andrea Beltratti

    2005-01-01

    The paper aims at understanding the relation between corporate governance (CG) and corporate social responsibility (CSR). In theory, CG refers mainly to the mechanisms which protect outsiders and ensure an effective working of the firm, while CSR refers mainly to the objective function of the firm and the attention for various stakeholders. The paper discusses these concepts, with particular attention to the relation between CSR and profit maximization. This relation is important to evaluate ...

  19. Corporate Governance in Costa Rica

    OpenAIRE

    Gilberto E. Arce; Edgar Robles C.

    2005-01-01

    This paper examines corporate governance practices in Costa Rica. First, it estimates corporate governance charter measures using firm-level data for 87 Costa Rican firms and studies their impact on the firms` performance; here, the mean of the corporate governance charters for the publicly traded firms is equal to 56. 14. Second, new evidence is presented on de jure and de facto corporate governance charter measures at the firm level and on their effect on the performance of the firm. The re...

  20. Regulating Corporate Governance in the EU

    DEFF Research Database (Denmark)

    Horn, Laura

    In the context of the financial and economic crisis, corporate governance and regulatory supervision failures are at the centre of public debates. Who controls the modern corporation, and why, has become one of the defining social power relations in contemporary capitalism. Regulation Corporate...... transformation of company law and corporate governance regulation. Her findings about the marketization of corporate control are at the core to a better understanding of the broader context of capitalist restructuring in the European Union....

  1. De Ratio van Corporate Governance

    NARCIS (Netherlands)

    A. de Jong (Abe)

    2006-01-01

    textabstractAbe de Jong (1970) is Professor in Corporate Finance and Corporate Governance at RSM Erasmus University. He obtained a PhD in finance at Tilburg University (1999). His research and teaching interests are in the area of empirical corporate finance and include capital structure choice,

  2. Corporate crime: Criminological and cultural aspects

    Directory of Open Access Journals (Sweden)

    Keković Zoran

    2011-01-01

    Full Text Available The process of economic transition in Serbia has highlighted the problem of socially responsible behavior of corporations and especially the growing phenomenon of corporate crime. The consequences of corporate wrongdoing are almost everywhere and cannot be overseen. The most tremendous ones are those related to human casualties, environmental disasters, long-term negative health effects and great material budget losses on local and state levels. The fact that corporations are profiting from criminal activity which causes enormous damage to society and individuals makes public policy makers face the ultimate choice - either to devise new effective measures for reducing and controlling this phenomenon or to retain the standard model of crime control, in accordance with the principles of classical criminal law. The first choice would require one of the pillars of criminal law - the principle of individual and subjective guilt of physical persons as the exclusive grounds for imposing criminal liability - to be either modified and widened in order to be used as a base for imposing corporate criminal liability or partially changed by new criminal law categories which would introduce different grounds for imposing criminal liability on an organization. The second choice would require the decision-makers to refuse to change old and well-established principles. The criminal reality, however, has made most legislatures in Europe and around the world choose the first option and introduce different forms of corporate criminal liability. Serbian criminal legislation has been headed in the same direction since 2008, when it was changed in order to enable the imposing of liability for criminal acts on corporations. However, although corporate criminal liability is becoming the European legislative standard, one question remains - Is this the only measure of criminal politics which can be used as a means of reducing and preventing corporate crime? The authors

  3. Sometimes Pursuits Don't Pan Out: Anticipated Destinations and Other Caveats--Comment on Hom, Mitchell, Lee, and Griffeth (2012)

    Science.gov (United States)

    Bergman, Mindy E.; Payne, Stephanie C.; Boswell, Wendy R.

    2012-01-01

    Hom, Mitchell, Lee, and Griffeth (2012) presented an extensive review of employee turnover research, reconceptualized the turnover criterion to include multiple destinations, and proposed to expand the predictor domain. They illuminated the multiple destinations employees pursue following turnover. By crossing desire to remain and volitional…

  4. Communicating Corporate Social Responsibility on Social Media: Strategies, Stakeholders, and Public Engagement on Corporate Facebook

    Science.gov (United States)

    Cho, Moonhee; Furey, Lauren D.; Mohr, Tiffany

    2017-01-01

    The purpose of this study was to explore what corporations with good reputations communicate on social media. Based on a content analysis of 46 corporate Facebook pages from "Fortune's" "World's Most Admired Companies," this study found that corporations communicate noncorporate social responsibility messages more frequently…

  5. Discourses and Inter-Corporeity

    Directory of Open Access Journals (Sweden)

    Algis Mickūnas

    2015-10-01

    Full Text Available Contemporary European theories have focused attention on corporeity, its surface excitations and passions, and even on politically constructed bodies – how do men and women “carry their bodies”. The great variety of such claims suggests transformations in theoretical thinking, yet such changes were already articulated at another level by phenomenological studies: kinesthetic body. It is obvious that to speak of corporeity is possible only on the basis of analyses of corporeal movements. Thus, the aim of this essay is to disclose the structures of bodily movements, constituting the basis of primordial awareness – not “I think” but “I can”. In the essay there are presented a number of theses of post modernists who have not developed adequate analyses of corporeal movements.

  6. 12 CFR 561.45 - Service corporation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Service corporation. 561.45 Section 561.45... AFFECTING ALL SAVINGS ASSOCIATIONS § 561.45 Service corporation. The term service corporation means any corporation, the majority of the capital stock of which is owned by one or more savings associations and which...

  7. 46 CFR 67.39 - Corporation.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Corporation. 67.39 Section 67.39 Shipping COAST GUARD... Citizenship Requirements for Vessel Documentation § 67.39 Corporation. (a) For the purpose of obtaining a registry or a recreational endorsement, a corporation meets citizenship requirements if: (1) It is...

  8. Corporate Governance in Crisis? The Politics of EU Corporate Governance Regulation

    DEFF Research Database (Denmark)

    Horn, Laura

    2012-01-01

    on the transformation of company law and corporate governance in the last decade. Here, the article illustrates how company law has become increasingly focused on the rights of shareholders, while worker rights have been relegated to the area of social policies and labour law. The study also traces the shift from...... a legislative programme centred on company law harmonisation towards a regulatory approach based on minimum requirements and mutual recognition, increasingly geared at adjusting the governance of corporations to the demands of liberalised capital markets. The second section then reflects on the current...... developments in corporate governance regulation in the context of financial and economic crisis....

  9. Corporate Foresight and Strategic Decisions

    DEFF Research Database (Denmark)

    Gomez Portaleoni, Claudio; Marinova, Svetla Trifonova; Ul-Haq, Rehan

    . It provides an extensive analysis of extant theories of corporate foresight and strategic management, brings in new notions and insights, and presents an in-depth case study exploration of corporate foresight of a European bank. The understanding of organizational future is influenced by the perceived......The investigation of the future of an organization has always captivated the attention of academics and business managers. Presently, the aspiration to entrench future-relevant insights into management practices is a must. Companies that have made attempts to use corporate foresight have generally...... dealt successfully with internal information sharing processes that in most cases have prepared them for the challenges of the future. Corporate Foresights and Strategic Decisions investigates the relationships between corporate foresight and management decision-making processes in organizations...

  10. THE IMPACT OF CORPORATE SOCIAL RESPONSIBILITY ON CORPORATE VALUE

    Directory of Open Access Journals (Sweden)

    Diana DOBRESCU

    2013-12-01

    Full Text Available This paper investigates the correlation between Corporate Social Responsability actions and companies’ value. For this purpose a data base was created for 101 important companies in Romania, for years 2011 and 2012. The data was processed using Eviews 7 and SAS 9.2 softwares and the econometric variables specific determinations were interpreted in an econometric approach. A new index for the Corporate Social Responsabilitiy hierarchy levels was proposed and its applicability was demonstrated.

  11. 27 CFR 31.123 - New corporation.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false New corporation. 31.123... Requiring Registration As A New Business § 31.123 New corporation. Where a new corporation is formed to take over and conduct the business of one or more corporations that have registered under this part, the new...

  12. Fortune 500 Corporate Headquarters

    Data.gov (United States)

    Department of Homeland Security — Large Corporate Headquarters in the United States This database is composed of 'an annual list of the 500 largest industrial corporations in the U.S., published by...

  13. Finite-volume spectra of the Lee-Yang model

    Energy Technology Data Exchange (ETDEWEB)

    Bajnok, Zoltan [MTA Lendület Holographic QFT Group, Wigner Research Centre for Physics,H-1525 Budapest 114, P.O.B. 49 (Hungary); Deeb, Omar el [MTA Lendület Holographic QFT Group, Wigner Research Centre for Physics,H-1525 Budapest 114, P.O.B. 49 (Hungary); Physics Department, Faculty of Science, Beirut Arab University (BAU),Beirut (Lebanon); Pearce, Paul A. [School of Mathematics and Statistics, University of Melbourne,Parkville, Victoria 3010 (Australia)

    2015-04-15

    We consider the non-unitary Lee-Yang minimal model M(2,5) in three different finite geometries: (i) on the interval with integrable boundary conditions labelled by the Kac labels (r,s)=(1,1),(1,2), (ii) on the circle with periodic boundary conditions and (iii) on the periodic circle including an integrable purely transmitting defect. We apply φ{sub 1,3} integrable perturbations on the boundary and on the defect and describe the flow of the spectrum. Adding a Φ{sub 1,3} integrable perturbation to move off-criticality in the bulk, we determine the finite size spectrum of the massive scattering theory in the three geometries via Thermodynamic Bethe Ansatz (TBA) equations. We derive these integral equations for all excitations by solving, in the continuum scaling limit, the TBA functional equations satisfied by the transfer matrices of the associated A{sub 4} RSOS lattice model of Forrester and Baxter in Regime III. The excitations are classified in terms of (m,n) systems. The excited state TBA equations agree with the previously conjectured equations in the boundary and periodic cases. In the defect case, new TBA equations confirm previously conjectured transmission factors.

  14. The Conceptual Review of Interaction between Corporate Wisdom and Corporate Entrepreneurship

    Directory of Open Access Journals (Sweden)

    Metehan ORTKARPUZ

    2017-12-01

    Full Text Available Wisdom is an important point of view in the literature as the highest desired attainment of knowledge management and a new goal. Wisdom is a mysterious concept existing at the top of the hierarchy of data, information, and knowledge that occurs by the evolving of knowledge with experience and thought. This concept constitutes institutional wisdom when dealt with on an institutional basis. Today's competition conditions move corporate wisdom understanding on the agenda due to the insufficiency of traditional knowledge management approach towards sustainable targets and keeping the business vulnerable to rapidly changing conditions. Entrepreneurship is one of the most popular phenomena influenced by the developments in knowledge management. Entrepreneurship necessitates the creation of value by seeing opportunities, reaching different information before others, and using it differently from others, thereby becoming a member of the information society. Entrepreneurship processes aiming to create value through transformation and innovation studies in an existing organization are called "corporate entrepreneurship". Corporate entrepreneurship is a capability that enables businesses to gain competitive advantage through conscious efforts which actuate internal and external initiatives against changing conditions and uncertainties. It is thought that the factors of corporate wisdom understanding are interacting with elements of corporate entrepreneurship. In this study, a conceptual review is carried out in order to reveal the mentioned interaction, to take all dimensions of the elements which the concepts are based on.

  15. Corporal Punishment and the Schools.

    Science.gov (United States)

    Bauer, Gordon B.; And Others

    1990-01-01

    In order to understand and evaluate the continued prevalence of corporal punishment in school systems, this article reviews the following topics: (1) historical issues; (2) current demographics and correlates; (3) the effectiveness of corporal punishment in school settings; (4) myths; (5) alternatives to corporal punishment; and (6) social policy.…

  16. Uruguay - Corporate Governance Country Assessment

    OpenAIRE

    World Bank

    2005-01-01

    This report provides an assessment of Uruguay's corporate governance policy framework, enforcement and compliance practices. It highlights recent improvements in corporate governance regulation, makes policy recommendations, and provides investors with a benchmark against which to measure corporate governance in Uruguay. The report identifies several key next steps that focus on implementa...

  17. Corporate Social Responsibility for Sustainability

    Directory of Open Access Journals (Sweden)

    Wojciech Przychodzeń

    2014-06-01

    Full Text Available Purpose: The purpose of this paper is to is to provide insights on implementing corporate social responsibility for sustainability (CSRS concept and show how it differs from basic corporate social responsibility (CSR. Methodology: The paper discusses major issues with references to existing literature and real business cases from S&P500 consumer discretionary sector. Findings: The main fi nding of this paper is that CSRS could provide the company with a competitive advantage as a growing number of consumers become more sustainable conscious. It could also help to overcome the increasing consumers’ skepticism towards corporate social responsibility practices. Finally, it can also be seen as a step forward in defi ning what types of corporate activities are associated with desirable social and environmental gains. Research limitations: Our sample was restricted to the U.S. fi rms from the consumer discretionary sector. Therefore, conclusions should not be generalized to other markets. Our study is based on the analysis of environmental and social responsibility statements and assumes that they accurately represent corporate commitment in majority of the cases. Practical implications: CSRS offers corporations the opportunity to use their unique skills, culture, values, resources, and management capabilities to lead social progress by making sustainability part of its internal corporate logic. Originality: The paper raises the importance of the different conditions necessary for making sustainable development concept an important part of corporate strategy.

  18. Further Clarifying Proximal Withdrawal States and the Turnover Criterion Space: Comment on Hom, Mitchell, Lee, and Griffeth (2012)

    Science.gov (United States)

    Maertz, Carl P., Jr.

    2012-01-01

    In "Reviewing Employee Turnover: Focusing on Proximal Withdrawal States and an Expanded Criterion," Hom, Mitchell, Lee, and Griffeth (2012) brought together many of the most important content and process factors in the employee turnover literature. In this paper, I attempt to clarify the true contributions of this framework for the turnover area…

  19. Creditor Governance and Corporate Policies

    DEFF Research Database (Denmark)

    Arnold, Marc; Westermann, Ramona

    This paper analyzes the impact of debt covenant renegotiations on corporate policies. We develop a structural model of a levered firm that can renegotiate debt both at investment and in corporate distress. Covenant renegotiation at investment disciplines equity holders in their financing...... and investment decisions and, hence, mitigates the agency cost of debt. Our model explains the empirical intensity and patterns of the occurrence of debt renegotiation. We also quantify the role of debt covenant renegotiations as a governance channel on corporate financial policies and on the value of corporate...

  20. Corporate Accounting Policy Efficiency Improvement

    Directory of Open Access Journals (Sweden)

    Elena K. Vorobei

    2013-01-01

    Full Text Available The article is focused on the issues of efficient use of different methods of tax accounting for the optimization of income tax expenses and their consolidation in corporate accounting policy. The article makes reasoned conclusions, concerning optimal selection of depreciation methods for tax and bookkeeping accounting and their consolidation in corporate accounting policy and consolidation of optimal methods of cost recovery in production, considering business environment. The impact of the selected methods on corporate income tax rates and corporate property tax rates was traced and tax recovery was estimated.

  1. Notas sobre Feral y las cigüeñas, de Fernando Alonso, y la "Historia del califa cigüeña" (Wilhelm Hauff, Sara Cone Bryant

    Directory of Open Access Journals (Sweden)

    Hans Christian Hagedorn

    2011-01-01

    Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.

  2. CORPORATE REBRANDING OF GRAMEDIA STORE (CORPORATE REBRANDING DI GRAMEDIA STORE

    Directory of Open Access Journals (Sweden)

    Natasha Helena Kairupan

    2016-10-01

    Full Text Available Abstract. The purposes of this research are to determine the stages of analysis, planning, and evaluation of corporate rebranding process of Gramedia Book Store to be Gramedia Store to rise stakeholder’s awareness. The method used is descriptive qualitative with positivism paradigm. The technique of collecting data through in-depth interview, observation, and literature study. The result of this research showed the analysis stage by analyzing the market through insights and foresights, brand audit through SWOT analysis, and identifying opportunities. The planning stage is by determine the purpose of the planning process and then determine the target audience, consist of external and internal customer. The planning of external customer by renaming and change of corporate identity, and marketing planning using communication channel (above the line and below the line. The planning of internal customer by Brand Induction, training, inspiration briefing at store, and innovation competition. The evaluation of rebranding process of Gramedia Store is having a focus group discussion with customer, media monitoring, and presentation to BOD. Keywords : Process, Corporate Rebranding, Stakeholder Awareness, Corporate Identity, Gramedia Store Abstrak.Tujuan penelitian ini adalah untuk mengetahui bagaimana tahapan analisis, perencanaan, dan evaluasi proses corporate rebranding Gramedia Book Store menjadi Gramedia Store untuk meningkatkan stakeholder awareness. Pendekatan yang digunakan adalah kualitatif dengan paradigma positivisme dan jenis studi deksriptif. Teknik pengumpulan data yang dilakukan melalui wawancara mendalam, observasi, dan studi pustaka. Berdasarkan hasil penelitian, tahapan analisis dilakukan dengan menganalisis pasar melalui insights dan foresights, audit merek dengan analisis SWOT, dan mengidentifikasi peluang. Dalam tahapan perencanaan dengan menentukan tujuan kemudian menentukan target audiens, yaitu eksternal dan internal. Perencanaan

  3. Corporate accountability and transitional justice

    Directory of Open Access Journals (Sweden)

    Sabine Michalowski

    2015-10-01

    Full Text Available Traditionally, transitional justice processes do not address the role of corporations in dictatorships or in armed conflicts that give rise to the need for dealing with grave and systematic human rights violations. However, there is a growing awareness that in many contexts corporations contribute to these violations, often in the form of corporate complicity with the principal violators. An argument can therefore be made that to achieve the aims of transitional justice and establish a holistic narrative of the past as well as obtain justice and reparations for victims requires investigating and addressing the role of corporate actors. This article uses the example of Colombia’s Justice and Peace process to show some of the complexities, opportunities and challenges that arise if transitional justice measures focus primarily on criminal law and create a specific legal framework, outside of the ordinary justice systems, only for a limited group of primary perpetrators, in the Colombian case for members of the armed groups who demobilised. It is argued that the exclusion of corporate actors in contexts where their role is regarded as significant leads to victims seeking alternatives ways to obtain justice and that both victims and corporations would benefit if transitional justice mechanisms addressed the role of corporations.

  4. Corporate moral responsibility in health care.

    Science.gov (United States)

    Wilmot, S

    2000-01-01

    The question of corporate moral responsibility--of whether it makes sense to hold an organisation corporately morally responsible for its actions, rather than holding responsible the individuals who contributed to that action--has been debated over a number of years in the business ethics literature. However, it has had little attention in the world of health care ethics. Health care in the United Kingdom (UK) is becoming an increasingly corporate responsibility, so the issue is increasingly relevant in the health care context, and it is worth considering whether the specific nature of health care raises special questions around corporate moral responsibility. For instance, corporate responsibility has usually been considered in the context of private corporations, and the organisations of health care in the UK are mainly state bodies. However, there is enough similarity in relevant respects between state organisations and private corporations, for the question of corporate responsibility to be equally applicable. Also, health care is characterised by professions with their own systems of ethical regulation. However, this feature does not seriously diminish the importance of the corporate responsibility issue, and the importance of the latter is enhanced by recent developments. But there is one major area of difference. Health care, as an activity with an intrinsically moral goal, differs importantly from commercial activities that are essentially amoral, in that it narrows the range of opportunities for corporate wrongdoing, and also makes such organisations more difficult to punish.

  5. Motives of corporate political donations: industry regulation, subjective judgement and the origins of pragmatic and ideological corporations.

    Science.gov (United States)

    Harrigan, Nicholas M

    2017-12-01

    What motivates corporate political action? Are corporations motivated by their own narrow economic self-interest; are they committed to pursuing larger class interests; or are corporations instruments for status groups to pursue their own agendas? Sociologists have been divided over this question for much of the last century. This paper introduces a novel case - that of Australia - and an extensive dataset of over 1,500 corporations and 7,500 directors. The paper attempts to understand the motives of corporate political action by examining patterns of corporate political donations. Using statistical modelling, supported by qualitative evidence, the paper argues that, in the Australian case, corporate political action is largely motivated by the narrow economic self-interest of individual corporations. Firms' interests are, consistent with regulatory environment theory, defined by the nature of government regulation in their industry: those in highly regulated industries (such as banking) and those dependent on government support (such as defence) tend to adopt a strategy of hedging their political support, and make bipartisan donations (to both major parties). In contrast, firms facing hostile regulation (such as timber or mining), and those without strong dependence on state support (such as small companies) tend to adopt a strategy of conservative partisanship, and make conservative-only donations. This paper argues that regulatory environment theory needs to be modified to incorporate greater emphasis on the subjective political judgements of corporations facing hostile regulation: a corporation's adoption of conservative partisanship or hedging is not just a product of the objective regulation they face, but also whether corporate leaders judge such regulation as politically inevitable or something that can be resisted. Such a judgement is highly subjective, introducing a dynamic and unpredictable dimension to corporate political action. © London School of

  6. Comment on "Combination of cupric ion with hydroxylamine and hydrogen peroxide for the control of bacterial biofilms on RO membranes by Hye-Jin Lee, Hyung-Eun Kim, Changha Lee [Water Research 110, 2017, 83-90]".

    Science.gov (United States)

    Chen, Long; Peng, Ying; Tang, Min; Wu, Feng

    2017-07-01

    The methodology employed by Lee et al. to terminate their bactericidal assays was found to be flawed via our demonstrations. Briefly, EDTA or sulfite combining with cupric ion did not fully terminate, and instead even boosted the P. aeruginosa death. We therefore suggested them to seek for other means of reaction termination, such as the combination of buffering agent PBS and Cu(II)-complexing agent EDTA. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. The corporate security professional

    DEFF Research Database (Denmark)

    Petersen, Karen Lund

    2013-01-01

    In our age of globalization and complex threat environments, every business is called upon to manage security. This tendency is reflected in the fact that a wide range of businesses increasingly think about security in broad terms and strive to translate national security concerns into corporate...... speech. This article argues that the profession of the security manager has become central for understanding how the relationship between national and corporate security is currently negotiated. The national security background of most private sector security managers makes the corporate security...... professional inside the company a powerful hybrid agent. By zooming in on the profession and the practice of national security inside companies, the article raises questions about where to draw the line between corporate security and national security along with the political consequences of the constitution...

  8. Empirical study on the link between corporate citizenship behaviour and spirituality in the corporate environment

    Directory of Open Access Journals (Sweden)

    Sanjana Brijball Parumasur

    2016-08-01

    Full Text Available This study explores the relationship between spirituality in the corporate environment and corporate or organisational citizenship behaviour. The relationships amongst the sub-dimensions of workplace spirituality (meaningfulness of work, sense of community, alignment with organisational values and the sub-dimensions of corporate or organisational citizenship behaviour (altruism, conscientiousness, sportsmanship, courtesy, civic virtue are also examined. The extent to which the sub-dimensions of organisational citizenship behaviour predict workplace spirituality are analysed. The study was undertaken in a retail products outlet that focuses on quality and professionalism. The sample was drawn using cluster sampling and the adequacy of the sample was assessed using the Kaiser-Meyer-Olkin Measure and Bartlett’s Test of Sphericity. Data was collected using a closed-ended, established questionnaire and analysed using descriptive and inferential statistics. The results reflect that the organisation is fairly high on workplace spirituality with the focus being on meaningfulness of work and, on corporate or organisational citizenship behaviour with altruism and civic virtue being its greatest strength. There is a significant relationship between spirituality in the corporate environment and corporate or organisational citizenship behaviour, with sportsmanship and civic virtue being strong predictors of workplace spirituality. The results therefore, display the dynamic relationship between spirituality in the corporate environment and corporate or organisational citizenship behaviour, which when nurtured has the potential to enhance both bottom-lines of profits and people as well as society as a whole

  9. Energy Information Data Base: corporate author entries

    International Nuclear Information System (INIS)

    1980-03-01

    One of the controls for information entered into the data bases created and maintained by the DOE Technical Information Center is the standardized name for the corporate entity or the corporate author. The purpose of Energy Information Data Base: Corporate Author Entries (TID-4585-R1) and this supplemental list of authorized or standardized corporate entries is to provide a means for the consistent citing of the names of organizations in bibliographic records. In general, an entry in Corporate Author Entries consists of the seven-digit code number assigned to the particular corporate entity, the two-letter country code, the largest element of the corporate name, the location of the corporate entity, and the smallest element of the corporate name (if provided). This supplement [DOE/TIC-4585-R1(Suppl.5)] contains additions to the base document (TID-4585-R1) and is intended to be used with that publication

  10. Arvustused / Mart Kalvet

    Index Scriptorium Estoniae

    Kalvet, Mart, 1975-

    2007-01-01

    Heliplaatidest:Type O Negative "Dead Again", Luv Machine "Turns You On", Loits "Leegion laval", Chrome Hoof "Beyond Zade", Neoandertals "Neoanderthals Were Master Butchers", Deathbound "To Cure The Sane With Insanity", Guardians Of Mankind/Merging Flare "Beyond the Blackhole/Under the Fire", Funeral "From These Wounds", Black Bile "Cloacal Meditation", Furze (Woe J. Reaper) "UTD", Embrace "The Last Embrace", Blut Aus Nord "MoRT", Diskreet "Infernal Rise", Sepia Dreamer "The Sublime", SaraLee "Darkness Between", Urt "Saatanhark", Onslaught "Killing Peace", Paganize "Evolution Hour", Kroda "Fimbulwinter", Scent Of Flesh "Deform In Torture", Zatokrev "Bury the Ashes", Misery Signals "Mirrors", Sarpanitum "Despoilment Of Origin", Umbra Nihil "Gnoia", Saattue "Ikiuneen", Sanctimony "Hell in Stereo", Twilight Ophera "Descension", Year Of Desolation "Year Of Desolation", "Resistance"

  11. Perancangan Corporate Identity Astro Rent Car Surabaya

    OpenAIRE

    Gunardi, Yohanes Calvin; Negara, I Nengah Sudika; Aryanto, Hendro

    2017-01-01

    Corporate Identity merupakan hal yang krusial dalam perkembangan sebuah Perusahaan dalam segi internal maupun eksternal. Dalam membuat perancangan Corporate identity yang efektif, perancangan ini menampilkan segala teori dan ilmu yang berhubungan dengan Corporate identity. Dengan adanya perancangan ini diharapkan para pembaca mengerti betapa pentingnya peran sebuah corporate identity yang tepat dan mengena.Kata kunci: corporate identity, Astro, logo.

  12. Examining the Relationship between Corporate Social ...

    African Journals Online (AJOL)

    Recently the concept of corporate social responsibility (CSR) is being ... recognize and instill CSR initiatives into their corporate culture and business ... Keywords: Corporate Social Responsibility, Financial Performance, ROA, ROE, and ROS.

  13. Features of the content of corporate contracts

    Directory of Open Access Journals (Sweden)

    Elena Petrovna Gladneva

    2015-09-01

    Full Text Available Objective to study the legal nature to reveal the peculiarities of the subject and other essential terms of corporate contracts as a technique and means of legal regulation of corporate relations. Methods general and specific methods of cognition dialectical formal logic analysis synthesis modeling structural and systemicfunctional methods as well as comparative legal logical legal historical legal grammatical methods and systemic interpretation. Results it is concluded that the object of corporate contracts includes terms about the features of implementation of corporate rights for shares and share in capital assets conditions order of the implementation of corporate rights and approval of other actions related to company management activity reorganization and liquidation the passive duty of corporate organizations to refrain from committing any action authority arising from the nature of corporate agreements as well as the active responsibilities associated with the certain implementation of corporate rights certified by stocks shares rights to stocks shares. In addition to the subject the content of corporate contractsincludes other essential necessary conditions stipulated by the corporate legislation norms and the agreement of the participants of economic entity. Scientific novelty for the first time taking into account modern achievements of civilistic jurisprudence and practice the authors investigate the relationship between the concepts of a civil contract and corporate contract give the definition of corporate contract show the specificity of the subject and other material terms of corporate contracts. Practical significance the findings can be taken into account in the further research of corporate law issues as subbranch of civil law used in law making and enforcement activities in the educational process as a teaching material in civil law. nbsp

  14. Corporate Language and Corporate Talk

    DEFF Research Database (Denmark)

    Zølner, Mette

    2013-01-01

    The article presents the case studies of two Danish based multinational companies (MNCs) which provides the an insight into the role of languages in organizational learning. It mentions that the studies focus on the sharing of the understanding and practices among their employees across the geogr......The article presents the case studies of two Danish based multinational companies (MNCs) which provides the an insight into the role of languages in organizational learning. It mentions that the studies focus on the sharing of the understanding and practices among their employees across...... the geographical borders by the medium of common corporate values for knowledge management, collection of data and analysis in these studies inspired by approach of ground theory and presents a usefulness of distinguishing between corporate language and talks to enable the headquarters learning. Also it concludes...... that both of the MNCs are of Danish origin but executives of both companies are proficient in English language....

  15. Aligning corporate real estate with the corporate strategies of higher education institutions

    NARCIS (Netherlands)

    Beckers, R; van der Voordt, Theo; Dewulf, G

    2015-01-01

    Purpose
    The purpose of this paper is to explore how corporate real estate (CRE) managers of higher education institutions formulate their CRE strategies and CRE operating decisions to align CRE with the corporate strategies of these institutions.

    Design/methodology/approach
    An

  16. Aligning corporate real estate with the corporate strategies of higher education institutions

    NARCIS (Netherlands)

    Theo van der Voordt; Geert Dewulf; Ronald Beckers

    2015-01-01

    Purpose – The purpose of this paper is to explore how corporate real estate (CRE) managers of higher education institutions formulate their CRE strategies and CRE operating decisions to align CRE with the corporate strategies of these institutions. Design/methodology/approach – An analytical

  17. Corporate environment protection as a legal problem

    International Nuclear Information System (INIS)

    Kloepfer, M.

    1993-01-01

    It is discussed what legal instruments companies have for integrating environment protection into their corporate policy: Industrial self-monitoring; the environmental health officer as an instrument of corporate environment protection (environmental health officer, radiation protection officer); obligations to disclose information on corporate organisation pursuant to Article 52 a of the Federal Emmission Control Act; corporate environment protection as a general obligation of the operator. Possible ways of strengthening corporate environment protection are considered de lege ferende, e.g. the additional instruments of corporate self-monitoring laid down in the General Part of the Environmental Code, audits on environment protection, corporate environment protection through quality assurance systems. (orig.) [de

  18. Delineation of the corporate use of Environmental Information Systems (EIS: Selected cases of the Corporate Organizations in Tanzania

    Directory of Open Access Journals (Sweden)

    Felichesmi Selestine Lyakurwa

    2013-11-01

    Full Text Available Environmental information systems are essential platforms for the provision of adequate and relevant information necessary for the planning and decision making for greener production. Corporate use of Environmental Information Systems gained several benefits in the global and local markets. Nevertheless, there was no documentation to explain the extent to which corporate organizations utilize available Environmental Information Systems in Tanzania. This study used purposive sampling with informants being workers from the strategic, tactical and control functions of the corporate organization. Moreover, data collection involved survey of 50 corporate organizations in Dar es Salaam, Arusha, Moshi and Morogoro councils, with 71 respondents. The collected data includes exploration of the extent to which corporate management functions utilize available Environmental Information Systems in Tanzania. The study identified various corporate environmental management functions performed at all levels of the corporate organization, in which workers spends less than one hour on the environmental information systems available. The results also revealed that, there is adequate utilization of available Environmental Information Systems for environmental management. Therefore, the research outcomes provides inputs to corporate organization unit managers, corporate owners and other environmental stakeholders on the extent of the systems’ use as well as sharing experience on different environmental management systems used worldwide. Keywords: Environmental information system, corporate organization, Tanzania, management

  19. Characterization of mannoproteins during white wine (Vitis vinifera L. cv. ENCRUZADO ageing on lees with stirring in oak wood barrels and in a stainless steel tank with oak staves

    Directory of Open Access Journals (Sweden)

    Ana Rodrigues

    2012-12-01

    Significance and impact of the study: This study is a technological approach of a process largely used by white wine producers who want to market a fresh wine produced with stirring of lees with a woody character. It reports the evolution of mannoproteins through four months of ageing on lees with two different stirring processes that can have a direct impact on the cost of the final product.

  20. Corporate Social Responsibility in banking sector

    Directory of Open Access Journals (Sweden)

    Lucie Kvasničková Stanislavská

    2012-01-01

    Full Text Available After popularity increase of the concept of Corporate Social Responsibility over last century in the USA, with the 21st century the concept comes into the European Union as well, actually into Czech Republic. For the European Union, the concept of social responsibility becomes one of the tool for achieving the most competitive and dynamic knowledge-based economy (Lisbon Strategy, 2000. With the start of the financial and economic crisis, the European Commission sees in the Corporate Social Responsibility a way how to cope with the crisis. Also scientific studies (Ghoul, 2011; Gruz, 2009 indicate the positive influence of Corporate Social Responsibility on financial performance of the company. In the Czech Republic, the implementation of the concept is especially for multinational corporations. For example, Corporate Social Responsibility is very popular in financial sector, which the financial crisis did not damage so perceptible as in other countries of developed economies (Singer, 2009. This article defines on a theoretical level the concept of Corporate Social Responsibility, its development, its present form and the influence on financial performance of the company. Another part of the article focuses on three czech banking subjects (Česká spořitelna, Komerční banka a Československá obchodní banka, which regularly take the leading positions of the official corporate donors chart „TOP Filantrop“. The article explores the evolution of corporate donations and finds the connection between corporate donations and corporate profit and financial and economic crisis.

  1. Evaluating the performance of the Lee-Carter method and its variants in modelling and forecasting Malaysian mortality

    Science.gov (United States)

    Zakiyatussariroh, W. H. Wan; Said, Z. Mohammad; Norazan, M. R.

    2014-12-01

    This study investigated the performance of the Lee-Carter (LC) method and it variants in modeling and forecasting Malaysia mortality. These include the original LC, the Lee-Miller (LM) variant and the Booth-Maindonald-Smith (BMS) variant. These methods were evaluated using Malaysia's mortality data which was measured based on age specific death rates (ASDR) for 1971 to 2009 for overall population while those for 1980-2009 were used in separate models for male and female population. The performance of the variants has been examined in term of the goodness of fit of the models and forecasting accuracy. Comparison was made based on several criteria namely, mean square error (MSE), root mean square error (RMSE), mean absolute deviation (MAD) and mean absolute percentage error (MAPE). The results indicate that BMS method was outperformed in in-sample fitting for overall population and when the models were fitted separately for male and female population. However, in the case of out-sample forecast accuracy, BMS method only best when the data were fitted to overall population. When the data were fitted separately for male and female, LCnone performed better for male population and LM method is good for female population.

  2. APL: a corporate strategy.

    Science.gov (United States)

    Fox, J; Nyatanga, L; Ringer, C; Greaves, J

    1992-06-01

    This paper is based on, and summarises, papers read at the second annual international conference of Nurse Education Tomorrow held at the University of Durham (UK) September 1991. To this end this paper will offer: Some Accreditation of Prior Learning (APL) definition and process as reflected in the literature available. A distinction will be made between APL and Accreditation of Prior Experiential Learning (APEL) although the procedures and processes for assessing them will be shown to be the same. A brief outline of corporate strategy, as it applies to APL, will be given to form the basis for logical demonstration of how Derbyshire Institute of Health and Community Studies has employed such a corporate strategy. Insights developed and gained from APL research currently being undertaken through the college of nursing and midwifery will be used to inform the development and nature of corporate strategy. A flowchart of the operationalisation of the corporate strategy is offered as an integrative summary of how all the APL ideas have had a positive cumulative effect. The paper finishes by highlighting the possible strengths and limitations of APL corporate strategy.

  3. A Corporate Governance Index : Convergence and Diversity of National Corporate Governance Regulations

    NARCIS (Netherlands)

    Martynova, M.; Renneboog, L.D.R.

    2010-01-01

    The issue of appropriate corporate governance framework has been a focal point of recent reforms in many countries. This study provides a comprehensive comparative analysis of corporate governance regulatory systems and their evolution over the last 15 years in 30 European countries and the US. It

  4. Corporal punishment.

    Science.gov (United States)

    Zolotor, Adam J

    2014-10-01

    Corporal punishment is used for discipline in most homes in the United States. It is also associated with a long list of adverse developmental, behavioral, and health-related consequences. Primary care providers, as trusted sources for parenting information, have an opportunity to engage parents in discussions about discipline as early as infancy. These discussions should focus on building parents' skills in the use of other behavioral techniques, limiting (or eliminating) the use of corporal punishment and identifying additional resources as needed. Copyright © 2014 Elsevier Inc. All rights reserved.

  5. Corporate Blogging For Dummies

    CERN Document Server

    Karr, Douglas

    2010-01-01

    Establish a successful corporate blog to reach your customers. Corporate blogs require careful planning and attention to legal and corporate policies in order for them to be productive and effective. This fun, friendly, and practical guide walks you through using blogging as a first line of communication to customers and explains how to protect your company and employees through privacy, disclosure, and moderation policies. Blogging guru Douglas Karr demonstrates how blogs are an ideal way to offer a conversational and approachable relationship with customers. You'll discover how to prepare, e

  6. The Role of Corporate Governance in Firm Performance

    OpenAIRE

    Naimah Zahroh; Hamidah

    2017-01-01

    The objective of this study is to examine the role of corporate governance to increase firm performance. The measure of corporate governance are corporate governance mechanism and Corporate Governance Perception Index (CGPI). Samples are companies that followed CGPI award at 2005-2014. The examination of the relationship of corporate governance and firm performance is conducted by regression of corporate governance mechanism variables and control variables to profitability. Corporate governan...

  7. Corporate Governance in Publicly Traded Canadian Companies

    OpenAIRE

    Hu, Jie; Wang, Chong

    2011-01-01

    We investigate the effectiveness of corporate governance practices in this paper, focusing on the corporate governance practices implemented by TSX listed companies in Canada. We analyze the determinants of the effectiveness of corporate governance practices and test whether corporate governance mechanisms relate to quality of accounting earnings and company performance. We obtain mixed results from regression analyses indicating that corporate governance mechanisms are not significantly rela...

  8. Board Directors and Corporate Social Responsibility

    OpenAIRE

    Mariana Nedelcu (Bunea)

    2014-01-01

    The boards of directors and corporate social responsibility (CSR) have been the subject of much study and debate in the corporate governance circles over the two last decades. With issues ranging from poor corporate reporting to excessive executive compensation often splashed in the headlines, the role of boards comes into the media limelight as never before. Boards of directors are also becoming increasingly aware of corporate social responsibility issues.

  9. Financial and Economic Crisis and Corporate Finance Development

    Institute of Scientific and Technical Information of China (English)

    LI Xinhe

    2015-01-01

    Financial and economic crisis has challenged the ideological and methodological basis,the basic assumptions and the universal applicability of the research conclusions of the mainstream corporate finance.In order to construct corporate finance appropriate to the state of financial crisis,it is necessary to adjust the objective function of corporate finance,modify the corporate financing theory,extend corporate investment theory,enrich corporate working capital management theory,and adjust corporate dividend policy theory.

  10. Corporate brand building from the corporate stories perspective: a Brazilian football teams study

    Directory of Open Access Journals (Sweden)

    Edson Roberto Scharf

    Full Text Available Abstract The study aims to investigate the content of corporate stories of the Brazilian’s football clubs and how these stories are used to build their corporate brands. The stories were collected from the corporate websites of football clubs in Brazil belonging to series A, B and C. A qualitative analysis of the corporate stories was carried on by means of content analysis of the corpus resulting from them. The results showed that emotion is a key element and is most strongly represented in the websites. The findings also revealed that although the clubs work with human talent, and positive results of the teams in the pitch are dependent on talent, this important aspect is practically forgotten on the websites. Academic and managerial implications, as well as limitations of the study are presented at the end.

  11. Modern model of integrated corporate communication

    Directory of Open Access Journals (Sweden)

    Milica Slijepčević

    2018-03-01

    Full Text Available The main purpose of this paper is to present the modern model of integrated corporate communication. Beside this, the authors will describe the changes occurring in the corporate environment and importance of changing the model of corporate communication. This paper also discusses the importance of implementation of the suggested model, the use of new media and effects of these changes on corporations. The approach used in this paper is the literature review. The authors explore the importance of implementation of the suggested model and the new media in corporate communication, both internal and external, addressing all the stakeholders and communication contents. The paper recommends implementation of a modern model of integrated corporate communication as a response to constant development of the new media and generation changes taking place. Practical implications: the modern model of integrated corporate communication can be used as an upgrade of the conventional communication models. This modern model empowers companies to sustain and build up the existing relationships with stakeholders, and to find out and create new relationships with stakeholders who were previously inaccessible and invisible.

  12. Corporation as climate ambassador

    DEFF Research Database (Denmark)

    Trapp, Leila

    2012-01-01

    At a time when corporations are addressing increasingly complex, global corporate social responsibility (CSR) issues, this study examines and evaluates the strategies used in Vattenfall’s challenging and innovative CSR campaign which aimed at establishing the energy company as a credible climate...

  13. 78 FR 60375 - Rogue Valley Terminal Railroad Corporation-Corporate Family Transaction Exemption

    Science.gov (United States)

    2013-10-01

    ... approximately 14 miles of rail line located in the Medford Industrial Park in White City, Or., where it connects... corporate affiliate, Medford Industrial Trainline Management LLC (Medford), to which Rogue Valley will... changes, or changes in the competitive balance with carriers outside the corporate family. Under 49 U.S.C...

  14. Corporate Governance Quality in Selected Transition Countries

    Directory of Open Access Journals (Sweden)

    Danila Djokic

    2017-12-01

    Full Text Available Important questions that concern the notion of good corporate governance focus on what good corporate governance is, who benefits from good corporate governance, and how corporate governance quality can be measured. The aim of our study was to broaden our understanding of the role of standards and codes of good corporate governance in improving governance practices.We found that not only formal regulations, standards, and governance codes, but also corporate governance indices-which make the assessment of companies’ governance practices possible-are important in measuring and improving governance quality. The results of the research based on the SEECGAN Index methodology indicated that mandatory requirements and voluntary recommendations of high governance standards had a positive impact on the corporate governance practice in Slovenia.

  15. Perancangan Corporate Identity Brotherwood Decoration

    OpenAIRE

    Ciputra, Ongky Permana; Bangsa, Petrus Gogor; Christianna, Aniendya

    2015-01-01

    Sebagai Perusahaan interior di Surabaya, “BROTHERWOOD” sedang membangun citra positif melalui penguatan corporate identity secara menyeluruh.Oleh karena itu “Brotherwood” memerlukan corporate identity dan mengaplikasikannya pada media promosi dan informasi yang sesuai dengan karakter dari target audience dan target market-nya.Dengan menggunakan corporate identity diharapkan “Brotherwood” menjadi lebih dikenal oleh target audience dan target market-nya sehingga membuat market “Brotherwood” men...

  16. The Energy Efficiency of Corporate Real Estate Assets: The Role of Professional Management for Corporate Environmental Performance

    OpenAIRE

    Markus Surmann; Wolfgang A. Brunauer; Sven Bienert

    2015-01-01

    Despite the rising information about the ecological footprint and greenhouse gas externalities of corporates' activities only little is known about the energy efficiency of corporate real estate assets. When considering achievements from the past, such as significant reduction of carbon emissions and towards carbon accounting, the energy consumption of corporate real estate assets is of emerging interest within the sustainability strategy of corporations. On the contrary to residential and co...

  17. Lithuanian corporate tax accounting improvement solutions

    OpenAIRE

    Bružauskas, Valentinas; Stončiuvienė, Neringa

    2012-01-01

    The article sets out the research results of existing Corporate Tax accounting in Lithuania. There is disclosed the link between financial and Corporate Tax accounting, and their coordination improvement. The authors think that, the closer link between financial and tax accounting is obligatory. The provisions of Corporate Tax calculation should be adjusted with requirements of financial accounting. Also there is specified the methods of Corporate Tax reform and their feasibility. In the arti...

  18. Board Directors and Corporate Social Responsibility

    Directory of Open Access Journals (Sweden)

    Mariana Nedelcu (Bunea

    2014-08-01

    Full Text Available The boards of directors and corporate social responsibility (CSR have been the subject of much study and debate in the corporate governance circles over the two last decades. With issues ranging from poor corporate reporting to excessive executive compensation often splashed in the headlines, the role of boards comes into the media limelight as never before. Boards of directors are also becoming increasingly aware of corporate social responsibility issues.

  19. 76 FR 45673 - Methods of Accounting Used by Corporations That Acquire the Assets of Other Corporations

    Science.gov (United States)

    2011-08-01

    ... accounted for under the new method of accounting. The definition of cut-off basis is expanded in the final... of Accounting Used by Corporations That Acquire the Assets of Other Corporations AGENCY: Internal... regulations relating to the methods of accounting, including the inventory methods, to be used by corporations...

  20. W3C director Tim Berners-Lee to be Knighted by Queen Elizabeth web inventor recognized for contributions to internet development

    CERN Document Server

    2003-01-01

    "Tim Berners-Lee, the inventor of the World Wide Web and director of the World Wide Web Consortium (W3C), will be made a Knight Commander, Order of the British Empire (KBE) by Queen Elizabeth" (1/2 page).

  1. Does corporate governance shape the relationship between corporate social responsibility and financial performance?

    NARCIS (Netherlands)

    Kabir, Rezaul; Thai Minh, Hahn

    2017-01-01

    Purpose: The theoretical and empirical relationships between corporate social responsibility (CSR) and corporate financial performance are not without controversy. Yet, CSR activities are increasingly undertaken by a large number of firms, not only in developed countries but also in emerging

  2. Does corporate governance shape the relationship between corporate social responsibility and financial performance?

    NARCIS (Netherlands)

    Kabir, Mohammed Rezaul; Thai Minh, H.; Thai Minh, H.

    2016-01-01

    The theoretical as well as empirical relationships between corporate social responsibility and corporate financial performance are not without controversy. Yet, CSR activities are increasingly undertaken by a large number of firms, not only in developed countries but also in emerging countries.

  3. Measuring instruments of corporate reputation

    Directory of Open Access Journals (Sweden)

    Damir Grgić

    2008-12-01

    Full Text Available The subject of this paper is focused on the instruments for the measurement of corporate reputation. Recent research of the elements which influence the success of a company shows a growing interest in intangible values. Corporate reputation itself has been identified as one of the key intangible assets which create the company’s added value. Understanding of the importance of corporate reputation has been determined as a significant component of the company’s competitiveness, that is, of its competitive edge. Reputation is a normal part of our life and an integral part of our society. Our interest in the honesty and integrity of others is firmly established in all cultures and nowadays the focus of this interest is switching increasingly on companies. Corporate reputation can be acquired by means of strong, well-developed strategies, which are crucial for the opinion of stakeholders regarding future stability and competitive sustainability of the company. On the other hand, it should be emphasized that in order to manage it, corporate reputation has to be measured first. However, although the concept of corporate reputation is universally accepted and its significance has been recognized especially in the last two decades, the process of its measurement is still at an early stage and there is no universally accepted instrument for its measurement. Therefore, the author of this paper gives an overview of the instruments used for the measurement of corporate reputation which have gained a foothold through former practical usage.

  4. Corporate strategic branding: How country and corporate brands come together

    OpenAIRE

    Đorđević Bojan

    2008-01-01

    The concept of countries as brands has been increasingly recognized in the post-modern global world. A strong country brand can provide corporate brands with a unique set of values, which supports their positioning on the international market. Simultaneously, once corporate brands achieve worldwide success, they contribute actively to developing new features of the country brand. Consumers pay more and more attention to products' country of origin. When the name of a country is mentioned, the...

  5. Corporate governance attributes, firm characteristics and the level of corporate disclosure: Evidence from the Indian listed firms

    Directory of Open Access Journals (Sweden)

    Sunil Nandi

    2013-01-01

    Full Text Available This study investigates the association between firm characteristics, corporate governance attributes and the level of corporate disclosure of listed firms in India. The research paper has been based on a sample of 60 firms listed in the Bombay Stock Exchange (BSE / National Stock Exchange (NSE during the study period from 2000-01 to 2009-10. The study has used the Standard & Poor (2008 model for measuring the level of corporate disclosure. To examine the association between explanatory variables and the level of corporate disclosure, multiple regression model has been used. The results suggest a positive relationship between board size, ratio of audit committee members to total board members, family control, CEO duality, firm size, profitability, liquidity and the extent of corporate disclosure. However, the degree of corporate disclosure is negatively related to board composition, leverage and age of the firm.

  6. 12 CFR 7.2000 - Corporate governance procedures.

    Science.gov (United States)

    2010-01-01

    ... OPERATIONS Corporate Practices § 7.2000 Corporate governance procedures. (a) General. A national bank proposing to engage in a corporate governance procedure shall comply with applicable Federal banking... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Corporate governance procedures. 7.2000 Section...

  7. Corporate social reponsability strategic corporate social responsability: External and internal outcomes

    OpenAIRE

    Laka, Edite

    2012-01-01

    This study investigates the importance and benefits of having a strategic Corporate Social Responsibility (CSR) program by testing the interrelationships between strategic CSR with three external (reputation, corporate image, and customer loyalty) and four internal (organizational commitment, job satisfaction, performance, and organizational deviance) variables. 269 clients and non-clients along with 190 employees and their direct supervisors completed the survey. Strategic CSR has shown to h...

  8. Examining the Relationship between Corporate Social ...

    African Journals Online (AJOL)

    user

    this study, we explore and test the relationship between financial ... initiatives into their corporate culture and business operations because increases ... Corporate social responsibility (CSR for short and also called corporate social ..... with the inclusion criteria. ...... financial performance: Evidence from the banking industry.

  9. RELEVANCE OF CORPORATE GOVERNANCE IN NIGERIAN ...

    African Journals Online (AJOL)

    economy, their corporate governance is of prime interest to government, ... supervisory framework and unethical practices among top banking chiefs ... Corporate Governance of Public Companies in Nigeria (2003) which sees corporate ... are more interested in their banks' profitability, soundness and good health while the.

  10. 76 FR 79228 - Combined Licenses at William States Lee III Nuclear Station Site, Units 1 and 2; Duke Energy...

    Science.gov (United States)

    2011-12-21

    ... NUCLEAR REGULATORY COMMISSION [Docket Nos. 52-018 and 52-019; NRC-2008-0170] Combined Licenses at William States Lee III Nuclear Station Site, Units 1 and 2; Duke Energy Carolinas, LLC AGENCY: Nuclear.... SUMMARY: Notice is hereby given that the U.S. Nuclear Regulatory Commission (NRC) and the U.S. Army Corps...

  11. Vernon Lee in the Vatican: the uneasy alliance of aestheticism and archaeology.

    Science.gov (United States)

    Evangelista, Stefano

    2009-01-01

    From the 1800s onward, aesthetic critics attempted to free the study of ancient Greek art from the frameworks of institutional education and professionalized criticism. In this process, aestheticism entered an uneasy alliance with archaeology, a discipline that was likewise challenging traditional modes of classical learning practiced in public schools and the old universities. In "The Child in the Vatican" (1881), Vernon Lee -- writing under the influence of Pater and from a position of cosmopolitan female amateurism -- examines the uses of archaeological science in the study of classical art. Her analysis of the sculptures of the Niobe Group at once relies on the archaeological method and asks readers to doubt scientific approaches to art that dim the sublime power of the art object.

  12. Kinoshita-Lee-Nauenberg theorem and soft radiation in gauge theories: Abelian case

    International Nuclear Information System (INIS)

    Akhoury, R.; Sotiropoulos, M.G.; Zakharov, V.I.

    1997-01-01

    We present a covariant formulation of the Kinoshita-Lee-Nauenberg (KLN) theorem for processes involving the radiation of soft particles. The role of the disconnected diagrams is explored and a rearrangement of the perturbation theory is performed such that the purely disconnected diagrams are factored out. The remaining effect of the disconnected diagrams results in a simple modification of the usual Feynman rules for the S-matrix elements. As an application, we show that, when combined with the Low theorem, this leads to a proof of the absence of the 1/Q corrections to inclusive processes (such as the Drell-Yan process). In this paper the Abelian case is discussed to all orders in the coupling. copyright 1997 The American Physical Society

  13. Corporate Social Responsibility, social contract, corporate personhood and human rights law: Understanding the emerging responsibilities of modern corporations

    OpenAIRE

    Amao, O

    2008-01-01

    Copyright @ 2008 Olufemi Amao. The social contract theory has been advanced as a theoretical basis for explaining the emerging practice of Corporate Social Responsibility (CSR) by corporations. Since the 17th century the social contract concept has also been used to justify human rights. The concept is the constitutional foundation of many western states starting with England, US and France. Business ethicists and philosophers have tried to construct and analyse the social responsibility o...

  14. Leaders as Corporate Responsibility Spokesperson: How Leaders Explain Liabilites Via Corporate Web Sites?

    Directory of Open Access Journals (Sweden)

    Burcu Öksüz

    2014-12-01

    Full Text Available The aim of this paper is to reveal the corporate social responsibility (CSR understandings of corporations from the leaders’ perspective and discuss how leaders define and explain CSR practices their organizations executed as spokesperson via social media channels of their organizations.  In this context, a content analysis aiming to display the ideas of Turkey’s top 250 corporations’ leaders (CEO, chairman of the board, general manager designated by Istanbul Chamber of Industry in 2013. The leader messages about different dimensions of CSR and CSR practices that are partaking in corporate web sites were examined. According to the results of the analysis, it is found that the leaders act as responsible leaders, and also the spokesperson of their corporations. In addition it is found out that responsible leaders included multiplexed information on different dimensions and various practices of CSR in their social media messages.

  15. Corporate Taxation and Multinational Activity

    OpenAIRE

    Peter Egger; Simon Loretz; Michael Pfaffermayr; Hannes Winner

    2009-01-01

    This paper assesses the impact of corporate taxation on multinational activity. A numerically solvable general equilibrium model of trade and multinational firms is used to incorporate the following components of corporate taxation: parent and host country statutory corporate tax rates, withholding tax rates, and parent and host country depreciation allowances. We account for their differential impact under alternative methods of double taxation relief (i.e., credit, exemption, and deduction)...

  16. Network Culture, Performance & Corporate Responsibility

    OpenAIRE

    Silvio M. Brondoni

    2003-01-01

    The growth and sustainability of free market economies highlights the need to define rules more suited to the current condition of market globalisation and also encourages firms to adopt more transparent and accountable corporate responsibility (and corporate social responsibility, namely the relationship between the company, environment and social setting). From a managerial perspective, corporate responsibility is linked to ensure the lasting pursuit of the company mission, seeking increasi...

  17. FINANCING DECISION AND CORPORATE GOVERNANCE

    OpenAIRE

    ANDREI STANCULESCU; DAN NICOLAE IVANESCU; PETRE BREZEANU

    2011-01-01

    This paper sustains the existence of a biunivocal link between a company’s financing decision and the corporate governance. On the one hand, the financing decision has an impact on corporate performance, which has been confirmed. According to the agency theory, the financing decision will contribute to solving interest conflicts between shareholders and managers. On the other hand, the corporate governance mechanism provides the proper contractual framework for attracting financing resources....

  18. Corporate governance and intellectual capital

    Directory of Open Access Journals (Sweden)

    Rahmat Alizadeh

    2014-01-01

    Full Text Available The purpose of this paper is to examine the association between corporate governance and Intellectual capital in the pharmaceutical companies accepted in Tehran Stock Exchange over the period 2004-2009 using a regression based model. The study investigates the impacts of three some independent variables of the corporate governance (i.e. the number of board members, the relative extent of nonexecutive to executive directors, the auditing committee. The results suggest that corporate governance had no special effect on intellectual capital in the pharmaceutical companies. Furthermore among corporate governance's variables, the first one (i.e. board size had negative impact on firms' intellectual capital and the second and the third variables had no effects on intellectual capital.

  19. Corporate social responsibility and financial markets

    NARCIS (Netherlands)

    Dam, Lammertjan

    2008-01-01

    This thesis examines the economics of corporate social responsibility, with an emphasis on the role of financial markets and institutions. Questions that are raised are: What does corporate social responsibility mean in an economic context? What is the impact of corporate social responsibility on

  20. 76 FR 53819 - Methods of Accounting Used by Corporations That Acquire the Assets of Other Corporations; Correction

    Science.gov (United States)

    2011-08-30

    ... of Accounting Used by Corporations That Acquire the Assets of Other Corporations; Correction AGENCY... describes corrections to final regulations (TD 9534) relating to the methods of accounting, including the... corporate reorganizations and tax-free liquidations. These regulations were published in the Federal...

  1. Book Review of : The Theory of Corporate Finance

    OpenAIRE

    Georges Dionne

    2011-01-01

    The book proposes an original contribution to the economics and finance literature by developing the foundations of corporate finance. It also covers in detail various corporate governance issues faced by organizations. The common treatment of corporate finance and corporate governance started with the contribution of Williamson (Journal of Finance, 1988), who argued that corporate finance and corporate governance must be treated simultaneously because they are complementary. This book fills ...

  2. 39 CFR 221.4 - Corporate officers.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Corporate officers. 221.4 Section 221.4 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION GENERAL ORGANIZATION § 221.4 Corporate officers. The Board of Governors determines the number of corporate officers and appoints the...

  3. Florida Progress Corporation 1991 annual report

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    Florida Progress Corporation is a utility holding company with assets of 5 billion dollars. Its principal subsidiary is the Florida Power Corporation; others are the Electric Fuels Corporation, the Mid-Continent Life Assurance Company, the Talquin Corporation, the Progress Credit Corporation and Advanced Separation Technologies Incorporated. The annual report describes achievements during the year. To meet growing energy demand Florida Power is building new peaking and base-load generating units, purchasing power from neighbouring utilities and cogenerators, and building more bulk power transmission line capacity in the state. Emphasis has been placed on meeting load growth by demand-site management. Attention is given to balancing energy needs with concerns for the environment, and there is an award-winning recycling program. The Electric Fuels Corporation major area of business is coal mining and transportation services. Advanced Separation Technologies has sold several of its patented ion separation machines. The report includes consolidated financial statements for the year ended 31 December 1991

  4. Piercing the corporate veil

    International Nuclear Information System (INIS)

    Goodwin, L.M.

    1992-01-01

    This article addresses the potential problems an economically troubled subsidiary can cause a parent company and offers strategies for insulating the trouble through good business practices and careful planning. The topics of the article include corporations and limited liability, piercing the corporate veil, environmental cleanup liabilities, and avoiding trouble

  5. Strategic Leadership of Corporate Sustainability

    DEFF Research Database (Denmark)

    Strand, Robert

    2014-01-01

    Strategic leadership and corporate sustainability have recently come together in conspicuously explicit fashion through the emergence of top management team (TMT) positions with dedicated corporate sustainability responsibilities. These TMT positions, commonly referred to as 'Chief Sustainability......? What effects do corporate sustainability TMT positions have at their organizations? We consider these questions through strategic leadership and neoinstitutional theoretical frameworks. Through the latter, we also engage with Weberian considerations of bureaucracy. We find that the reasons why...

  6. Trends in Corporate Communication Strategies

    OpenAIRE

    Constantin Milosteanu; Ionel Scaunasu; Alina Cornescu; Nicolae Popovic

    2011-01-01

    When business strategy is correlated with corporate communication strategy, this is reflected in the position and image of the organization on the market, leading to higher sales and increased profitability. The major changes caused by globalization, coupled with the new dynamic of the markets where consumers have access to more information in less time, require new forms of corporate communication. The new corporate communication concept involves major challenges for managers and can help de...

  7. Sustainability and corporate environmental focus

    DEFF Research Database (Denmark)

    Madsen, Henning; Sinding, Knud; Ulhøi, John Parm

    1997-01-01

    has ranged widely, including different aspects of corporate environmental management, dedicated "green accounting" and "green auditing" and consumer behaviour and "green marketing". Furthermore, this growth has taken place against a background of generally increasing environmental awareness. The paper...... environmental perceptions, driving forces, and corporate responses. The final section discusses the possibility that corporate environmental management, and the many people involved in this area, are less deeply concerned with environmental imperatives than is usually expressed....

  8. Corporate social responsibility in Ukraine

    OpenAIRE

    Polyakova, E.

    2013-01-01

    In the article are considered essence of corporate social responsibility and terms necessary for realization of social activity management subjects. Hikes over are brought to realization of corporate social responsibility, meaningfulness of large and middle business is certain in becoming of social responsibility of enterprises. It is set that exactly midsize business must come forward as a main motor of economic development of Ukraine. Becoming features and modern state of corporate social r...

  9. The Effects of Input Enhancement on Grammar Learning and Comprehension: A Modified Replication of Lee (2007) with Eye-Movement Data

    Science.gov (United States)

    Winke, Paula M.

    2013-01-01

    In his 2007 study "Effects of Textual Enhancement and Topic Familiarity on Korean EFL Students' Reading Comprehension and Learning of Passive Form," Lee demonstrated that learners were better able to correct written sentences that contained incorrect English passive forms after exposure to texts flooded with enhanced (versus…

  10. 26 CFR 1.9002-6 - Acquiring corporation.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false Acquiring corporation. 1.9002-6 Section 1.9002... (CONTINUED) INCOME TAXES General Actuarial Valuations § 1.9002-6 Acquiring corporation. Section 5(d) of the... corporation by another corporation in a distribution or transfer described in section 381(a) of the Code the...

  11. Corporate Strategies in Global Investment Business

    Directory of Open Access Journals (Sweden)

    Tetiana Frolova

    2012-02-01

    Full Text Available The article deals with topical issues of the development of corporate strategies for businesses. We proposed the classification and defined the ways to implement corporate strategies. We also analysed the current trends in the development of global corporate strategies mainly implemented through mergers and acquisitions.

  12. 22 CFR 96.31 - Corporate structure.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Corporate structure. 96.31 Section 96.31 Foreign Relations DEPARTMENT OF STATE LEGAL AND RELATED SERVICES ACCREDITATION OF AGENCIES AND APPROVAL OF... Approval Licensing and Corporate Governance § 96.31 Corporate structure. (a) The agency qualifies for...

  13. The Ethics of Deontology in Corporate Communication

    African Journals Online (AJOL)

    Francis E.A. Owakah and Daniel R. Aswani

    Corporate communication, public relations, ethics, deontology, teleology. Introduction. Corporate .... function of a corporate communicator is necessary in strategy formulation and implementation. ..... Exploring Public Relations. Essex: Pearson.

  14. Corporate communication and impression management - New perspectives why companies engage in corporate social reporting

    NARCIS (Netherlands)

    Hooghiemstra, R

    This paper addresses the theoretical framework on corporate social reporting. Although that corporate social reporting has been analysed from different perspectives, legitmacy theory currently is the dominating perspective. Authors employing this framework suggest that social and environmental

  15. 78 FR 25132 - Enercorp, Inc., FTS Group, Inc., Games, Inc. (n/k/a InQBate Corporation), Hartmarx Corporation (n...

    Science.gov (United States)

    2013-04-29

    .... (n/k/a InQBate Corporation), Hartmarx Corporation (n/k/a XMH Corp. 1), and Penn Treaty American... current and accurate information concerning the securities of Games, Inc. (n/k/a InQBate Corporation... securities of Hartmarx Corporation (n/k/a XMH Corp. 1) because it has not filed any periodic reports since...

  16. PENGARUH GOOD CORPORATE GOVERNANCE, KARAKTERISTIK PERUSAHAAN TERHADAP LUAS PENGUNGKAPAN CORPORATE SOCIAL RESPONSIBILITY PADA PERUSAHAAN TERDAFTAR DI BEI

    Directory of Open Access Journals (Sweden)

    Alang Wiyuda

    2017-03-01

    Full Text Available Penelitian ini bertujuan untuk menguji pengaruh kepemilikan institusional, dewan komisaris, komite audit yang diprosikan kedalam good corporate governance dan profitabilitas, ukuran perusahaan, tipe industri (profile, leverage diprosikan kedalam karakteristik perusahaan terhadap luas pengungkapan corporate social responsibility. Variabel dependen yang digunakan dalam penelitian ini adalah luas pengungkapan corporate social responsibility, sedangkan variabel independenya adalah kepemilikan institusional, dewan komisaris, komite audit, profitabilitas, ukuran perusahaan, tipe industri (profile, leverage. Populasi dalam penelitian ini adalah perusahaan manufaktur yang terdaftar di Bursa Efek Indonesia tahun 2015. Sampel dalam penelitian ini dipilih menggunakan metode purposive sampling, dan diperoleh sebanyak 106 sampel amatan. Teknik analisis yang digunakan dalam penelitian ini adalah analisis linier berganda. Hasil analisis menunjukan bahwa variabel kepemilikan institusional, dewan komisaris, dan profitabilitas berpengaruh positif terhadap luas pengungkapan corporate social responsibility. Variabel komite audit berpengaruh negatif terhadap luas pengungkapan corporate social responsibility. Variabel ukuran perusahaan, tipe industri (profile, dan leverage tidak berpengaruh terhadap luas pengungkapan corporate social responsibility.

  17. Corporate Social Responsibility in Afghanistan

    DEFF Research Database (Denmark)

    Azizi, Sameer

    This doctoral dissertation examines the business-development relations in Afghanistan by focusing on Corporate Social Responsibility (CSR) and other related practices from corporations in the Afghan mobile telecommunications industry. More concretely, the study aims to explore the characteristics...... provides a relevant empirical focus that can enrich the theoretical debates about CSR in developing countries. The study thereby stresses on the importance of context, and integrates both the societal and corporate dimensions to study CSR by corporations in the Afghan mobile telecommunications industry...... and drivers of the various CSR practices in the Afghan mobile telecommunications industry in order to critically assess the relationship between CSR and development in such context. The thesis highlights that the national context of Afghanistan in combination with the global mobile telecommunications industry...

  18. Bridging Corporate and Organizational Communication

    DEFF Research Database (Denmark)

    Christensen, Lars Thøger; Cornelissen, Joep

    2011-01-01

    organizational communication as well. We provide a formative and critical review of research on corporate communication as a platform for highlighting crucial intersections with select research traditions in organizational communication to argue for a greater integration between these two areas of research....... Following this review, we relax the assumptions underlying traditional corporate communication research and show how these dimensions interact in organizational and communication analysis, thus, demonstrating the potential for a greater cross-fertilization between the two areas of research. This cross......The theory and practice of corporate communication is usually driven by other disciplinary concerns than the field of organizational communication. However, its particular mind-set focusing on wholeness and consistency in corporate messages increasingly influence the domain of contemporary...

  19. Iranian Corporations and Corporate Social Responsibility

    Directory of Open Access Journals (Sweden)

    Hadi Chapardar

    2011-10-01

    Full Text Available Comparative studies have demonstrated that the themes for corporate social responsibility (CSR initiatives are different among nations and geographic regions based on their cultural, political, legal, social, and economic contexts. In this research, which was conducted on 56 corporations from IMI100 (100 Iranian companies with highest annual sales, ranked by Industrial Management Institute or IMI, CSR themes in priority have been identified. Data collected from a semistructured questionnaire and some complementary interviews were analyzed against the results of a reference study over 100 companies from developed countries. The resulted themes, some of which may have several subthemes, were developed in three economic, environmental, and social categories. Beside these qualitative findings, two indices are constructed for indicating the “importance” of and “contribution” to each theme. The results and discussions are supposed to help business leaders, international companies inside Iran, governmental authorities, and researchers to improve CSR discussions and practices in the country where CSR undergoes a less structured platform.

  20. Brown trout in the Lees Ferry reach of the Colorado River—Evaluation of causal hypotheses and potential interventions

    Science.gov (United States)

    Runge, Michael C.; Yackulic, Charles B.; Bair, Lucas S.; Kennedy, Theodore A.; Valdez, Richard A.; Ellsworth, Craig; Kershner, Jeffrey L.; Rogers, R. Scott; Trammell, Melissa A.; Young, Kirk L.

    2018-04-17

    Over the period 2014–2016, the number of nonnative brown trout (Salmo trutta) captured during routine monitoring in the Lees Ferry reach of the Colorado River, downstream of Glen Canyon Dam, began increasing. Management agencies and stakeholders have questioned whether the increase in brown trout in the Lees Ferry reach represents a threat to the endangered humpback chub (Gila cypha), to the rainbow trout (Oncorhynchus mykiss) sport fishery, or to other resources of concern. In this report, we evaluate the evidence for the expansion of brown trout in the Lees Ferry reach, consider a range of causal hypotheses for this expansion, examine the likely efficacy of several potential management interventions to reduce brown trout, and analyze the effects of those interventions on other resources of concern.The brown trout population at Lees Ferry historically consisted of a small number of large fish supported by low levels of immigration from downstream reaches. This population is now showing signs of sustained successful reproduction and is on the cusp of recruiting locally hatched fish into the spawning class, based on analysis with a new integrated population model. The proximate causes of this change in status are a large pulse of immigration in the fall of 2014 and higher reproductive rates in 2015–2017. The ultimate causes of this change are not clear. The pulse of immigrants from downstream reaches in fall 2014 may have been induced by three sequential high-flow releases from the dam in November of 2012–2014, but may also have been the result of a unique set of circumstances unrelated to dam operations. The increase in reproduction may have been the result of any number of changes, including an Allee effect, warmer water temperatures, a decrease in competition from rainbow trout, or fall high-flow releases. Correlations over space and time among predictor variables do not allow us to make a clear inference about the cause of the changes. Under a null causal

Some links on this page may take you to non-federal websites. Their policies may differ from this site.