WorldWideScience

Sample records for sara kelly johns

  1. Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

    Science.gov (United States)

    Goldrick-Rab, Sara; Kelly, Andrew P.

    2016-01-01

    In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…

  2. Sara John: Ethnisierte Arbeit. Eine feministische Perspektive. Marburg: Tectum Wissenschaftsverlag 2009.

    Directory of Open Access Journals (Sweden)

    Grit Grigoleit

    2011-03-01

    Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.

  3. Howard Atwood Kelly (1858-1943): founding Professor of Gynecology at Johns Hopkins Hospital and pioneer American radium therapist

    International Nuclear Information System (INIS)

    Robison, R. F.

    2010-01-01

    To date no objective scientific medical biography has been published on Howard Atwood Kelly, one of America's foremost radium pioneers. He had become internationally known since 1889 as the founding Chief of the Gynecology Service at Johns Hopkins, well before the discovery of radium. He was also later to maintain his own hospital in Baltimore. He was a multifaceted man and his biography provides some fascinating reading about the treatment of gynaecological cancer in the USA at the end of the 19 th century and well into the 20 th century. An Appendix is included which contains extracts from Curtis Bumam's 1936 Janeway Memorial Lecture on 'Early Experiences with Radium' which was published (without quoting any references) in the American Journal of Roentgenology (AJR). Bumam was probably the most important of Kelly's collaborators and he provides unique personal and scientific insights on Kelly and the trials (and) tribulations of obtaining and using radium in 1911. (author)

  4. STS-103 Pilot Scott Kelly and MS John Grunsfeld try on oxygen masks

    Science.gov (United States)

    1999-01-01

    In the bunker at Launch Pad 39B, STS-103 Pilot Scott J. Kelly (left) and Mission Specialist John M. Grunsfeld (Ph.D.) (right) try on oxygen masks during Terminal Countdown Demonstration Test (TCDT) activities. The TCDT provides the crew with emergency egress training, opportunities to inspect their mission payloads in the orbiter's payload bay, and simulated countdown exercises. Other crew members taking part are Commander Curtis L. Brown Jr. and Mission Specialists Steven L. Smith, C. Michael Foale (Ph.D.), and Jean-Frangois Clervoy of France and Claude Nicollier of Switzerland, who are with the European Space Agency. STS-103 is a 'call-up' mission due to the need to replace and repair portions of the Hubble Space Telescope, including the gyroscopes that allow the telescope to point at stars, galaxies and planets. The STS-103 crew will be replacing a Fine Guidance Sensor, an older computer with a new enhanced model, an older data tape recorder with a solid-state digital recorder, a failed spare transmitter with a new one, and degraded insulation on the telescope with new thermal insulation. The crew will also install a Battery Voltage/Temperature Improvement Kit to protect the spacecraft batteries from overcharging and overheating when the telescope goes into a safe mode. Four EVA's are planned to make the necessary repairs and replacements on the telescope. The mission is targeted for launch Dec. 6 at 2:37 a.m. EST.

  5. News developments at Sara

    International Nuclear Information System (INIS)

    Belmont, J.L.; Fruneau, M.; Martin, P.

    1989-05-01

    SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration

  6. 2012 SARA Students Technical Report

    International Nuclear Information System (INIS)

    Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet

    2012-01-01

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of

  7. 2012 SARA Students Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

    2012-07-30

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the

  8. The SARA REU Site Program

    Science.gov (United States)

    Wood, M. A.; Oswalt, T. D.; SARA Collaboration

    2000-12-01

    We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.

  9. Sara

    International Nuclear Information System (INIS)

    Aparo, M.; Dionisi, M.; Vicini, C.; Zeppa, P.; Frazzoli, F.V.; Remetti, R.; Portale, C.

    1989-01-01

    Nuclear Material Accountability, supported by Containment and Surveillance measures, is a foundamental means for an effective International Safeguard implemention in nuclear plants. Accountability is based on the verification that difference between a material quantity entering a given material balance and the quantity leaving that area in a given period of time, correspond and the amount of material actually present at the moment of the inspection. In the recent years International Safeguards appealing to the needs of timeliness in detecting diversion and concealing activities, devoted ReD efforts on a new Dynamic Accountability procedures (NRTMA) with particular concern with reprocessing plants. The present paper, which is the result of a research activity carried out in the frame of the Italian Support Programme to IAEA for Safeguards implementation, deals with a feasibility study of a NRTMA system to be applied to the EUREX pilot reprocessing plant. Such a feasibility study was performed by developing a computer program based on simulated plant generated data

  10. STS-103 Crew Interviews: Scott Kelly

    Science.gov (United States)

    1999-01-01

    Live footage of a preflight interview with Pilot Scott J. Kelly is seen. The interview addresses many different questions including why Kelly became an astronaut, the events that led to his interest, any role models that he had, and his inspiration. Other interesting information that this one-on-one interview discusses is an explanation of the why this required mission to service the Hubble Space Telescope must take place at such an early date, replacement of the gyroscopes, transistors, and computers. Also discussed are the Chandra X Ray Astrophysics Facility, and a brief touch on Kelly's responsibility during any of the given four space walks scheduled for this mission.

  11. Severe Accident Recriticality Analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  12. Severe accident recriticality analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H

    2001-11-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated

  13. Severe accident recriticality analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.

    2001-01-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady

  14. Severe Accident Recriticality Analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  15. Interpreting the SARA and RCRA training requirements

    International Nuclear Information System (INIS)

    Moreland, W.M.; Wells, S.M.

    1987-01-01

    The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements

  16. System Analysis and Risk Assessment (SARA) system

    International Nuclear Information System (INIS)

    Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

    1986-01-01

    Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable

  17. George Kelly: cognitive psychologist, humanistic psychologist, or something else entirely?

    Science.gov (United States)

    Benjafield, John G

    2008-11-01

    George Kelly was regarded by some of his contemporaries as a cognitive psychologist and by others as a humanistic psychologist. Kelly himself resisted being rubricized. He did, however, name several people who had been influential in his life and work, one of whom was J.F. Herbart. A comparison of Herbart and Kelly reveals several similarities. Both shared a belief that psychology was fundamentally a mathematical discipline. Both eliminated distinctions usually taken for granted in psychology, such as emotion versus cognition. Reconstructing Kelly's relation to Herbart allows one to see more clearly why Kelly was such a unique figure in 20th century psychology.

  18. University physics Arfken Griffing Kelly Priest

    CERN Document Server

    Houk, T William; Snider, John W

    1984-01-01

    University Physics: Arfken Griffing Kelly Priest covers the concepts upon which the quantitative nature of physics as a science depends; the types of quantities with which physics deals are defined as well as their nature; and the concepts of units and dimensions. The book describes the concepts of scalars and vectors; the rules for performing mathematical operations on vector quantities; the concepts of force, torque, center of gravity, and types of equilibrium. The text also describes the concepts and quantities required to describe motion; the linear kinematical relationships to describe m

  19. Blair oli ikkagi seotud Kelly nime lekitamisega / Maris Lillak

    Index Scriptorium Estoniae

    Lillak, Maris, 1970-

    2003-01-01

    Suurbritannia kaitseministeeriumi relvaeksperdi David Kelly surmaga seotud asjaolusid uuriv Huttoni komisjon selgitas, et peaminister Tony Blair oli kohtumisel, kus otsustati relvaeksperdi nime avalikustamine

  20. C. Walker-Said and J. D. Kelly (eds), Corporate Social Responsibility? Human Rights in the New Global Economy (Chicago, IL: The University of Chicago Press, 2015), 392 pp

    DEFF Research Database (Denmark)

    Whelan, Glen

    2017-01-01

    Book review of: Charlotte Walker-Said and John D. Kelly (eds), Corporate Social Responsibility? Human Rights in the New Global Economy (Chicago, IL: The University of Chicago Press, 2015), 392 pp.......Book review of: Charlotte Walker-Said and John D. Kelly (eds), Corporate Social Responsibility? Human Rights in the New Global Economy (Chicago, IL: The University of Chicago Press, 2015), 392 pp....

  1. STS-103 Pilot Scott Kelly during TCDT activities

    Science.gov (United States)

    1999-01-01

    STS-103 Pilot Scott J. Kelly is ready to take his turn at driving a small armored personnel carrier that is part of emergency egress training during Terminal Countdown Demonstration Test (TCDT) activities. Behind him (left) is Mission Specialist Jean-Frangois Clervoy of France, who is with the European Space Agency. At right is Mission Specialist Steven L. Smith. The tracked vehicle could be used by the crew in the event of an emergency at the pad during which the crew must make a quick exit from the area. The TCDT also provides simulated countdown exercises and opportunities to inspect the mission payloads in the orbiter's payload bay. STS-103 is a 'call-up' mission due to the need to replace and repair portions of the Hubble Space Telescope. Although Hubble is operating normally and conducting its scientific observations, only three of its six gyroscopes are working properly. Four EVA's are planned to make the necessary repairs and replacements on the telescope. The other STS-103 crew members are Commander Curtis L. Brown Jr. and Mission Specialists C. Michael Foale (Ph.D.), John M. Grunsfeld (Ph.D.), and Claude Nicollier of Switzerland, who also is with the European Space Agency. The mission is targeted for launch Dec. 6 at 2:37 a.m. EST.

  2. Book Review: J. Kelly. Rethinking Industrial Relations: Mobilization ...

    African Journals Online (AJOL)

    Book Review: J. Kelly. Rethinking Industrial Relations: Mobilization, Collectivism and Long Waves. K. Moody. Workers in a Lean World: Unions in the International Economy. B. Nissen. Which Direction for Organized Labour? Essays on Organizing, Outreach and Internal Transformation.

  3. The relationship between SARA fractions and crude oil stability

    Directory of Open Access Journals (Sweden)

    Siavash Ashoori

    2017-03-01

    Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.

  4. Layering of life (Sara novel of Peter Sarić

    Directory of Open Access Journals (Sweden)

    Kostić Dragomir J.

    2015-01-01

    Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safe­guard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.

  5. John Stachel

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. John Stachel. Articles written in Resonance – Journal of Science Education. Volume 3 Issue 8 August 1998 pp 76-92 Reflections. Albert Einstein-The Man Behind the Myths · John Stachel · More Details Fulltext PDF ...

  6. Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.

    Science.gov (United States)

    O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J

    2008-04-01

    Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.

  7. Gene : CBRC-SARA-01-1996 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

  8. Kelly D. Brownell: Award for Distinguished Scientific Applications of Psychology

    Science.gov (United States)

    American Psychologist, 2012

    2012-01-01

    Presents a short biography of Kelly D. Brownwell, winner of the American Psychological Association's Award for Distinguished Scientific Applications of Psychology (2012). He won the award for outstanding contributions to our understanding of the etiology and management of obesity and the crisis it poses for the modern world. A seminal thinker in…

  9. SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS

    International Nuclear Information System (INIS)

    Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.

    2015-01-01

    SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index

  10. Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

    Directory of Open Access Journals (Sweden)

    M. Sidi Ritau'din

    2017-06-01

    Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.

  11. AGN X-Ray emission and black holes (Kelly+, 2008)

    DEFF Research Database (Denmark)

    Kelly, B. C.; Bechtold, J.; Trump, J. R.

    2009-01-01

    In this analysis we combine 169 RQQs from Kelly et al. (2007ApJ...665.1489K) with 149 RQQs from the main SDSS sample of Strateva et al. (2005, Cat. J/AJ/130/387) to create a sample of 318 RQQs. Out of these 318 sources, 276 (86.8%) are detected in the X-ray. (1 data file)....

  12. John Lindsay

    CERN Multimedia

    2005-01-01

    A few weeks ago John Lindsay passed away unexpectedly at his home in St. Genis. With his death we have lost a pioneer in detector electronics and one of the founding fathers of the CERN Electronics Group. John came to CERN in 1956 to join the Electronics Group, which was being formed in the SC Division. He thus participated from the beginning in the design, development, production, commissioning and support of electronics for the experiments at the CERN accelerators, initially at the SC and finally at the SPS. From the University of Glasgow he brought his expertise on pulse height analyzers, which were called kick sorters in those days, and did pioneering work with it in the early CERN experiments. He designed read-out systems for successive generations of detectors, such as wire spark chambers, multiwire proportional chambers, calorimeters, etc., often coming up with innovative solutions. Surely one of his finest moments must have been when he worked on complex detector systems, such as liquid argon calo...

  13. Layering of life (Sara novel of Peter Sarić)

    OpenAIRE

    Kostić, Dragomir J.

    2015-01-01

    Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...

  14. A simple blowdown code for SUPER-SARA loop conditions

    International Nuclear Information System (INIS)

    Fritz, G.

    1981-01-01

    The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section

  15. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...

  16. Briti minister ja Blairi nõunik lekitasid Kelly nime / Maris Lillak

    Index Scriptorium Estoniae

    Lillak, Maris, 1970-

    2003-01-01

    Briti relvaeksperdi David Kelly surma uuriva Huttoni komisjon selgitas, et Briti kaitseminister Geoff Hoon ja peaministri endine kommunikatsioonidirektor Alastair Campbell olid osalised relvaeksperdi nime avaldamises ajakirjandusele

  17. Sara, a patient with borderline personality structure: A "crisis" management

    Directory of Open Access Journals (Sweden)

    Paola Marinelli

    2015-05-01

    Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma. 

  18. Kelly Hoppen - suurte pealkirjadega läbi elu / Ketlin Priilinn

    Index Scriptorium Estoniae

    Priilinn, Ketlin, 1982-

    2006-01-01

    Inglise disainerist ja ruumikujundajast Kelly Hoppenist (sünd. 1962. a. Lõuna-Ameerikas, 1964. aastast elab Londonis) ning tema loomingust ja tegevusest. K. Hoppen on kirjutanud raamatuid ("Kelly Hoppen Style: The Golden Rules Of Design" jt.), 1979. a. avas ta oma disainistuudio, 2002. a. esimese poe Londonis. 5 värv. ill

  19. STS-114: Crew Interviews: 1. Jim Kelly 2. Charlie Camarda

    Science.gov (United States)

    2005-01-01

    1) STS-114 Pilot James Kelly mentions his primary job as the Pilot is to back up Commander Eileen Collins all through the flight. James discusses in detail his robotics operations for all of the extravehicular activities and spacewalk work, as well as moving the logistics module back and forth, onto the station and back in the payload bay. He shares his thoughts on the Columbia, the STS-114 mission as a new chapter in space exploration, and the International Space Station. 2) STS-114 Mission Specialist Charlie Camarda discusses his major role in the mission, his feelings for this being his first Space Shuttle flight; shares his thoughts on the Columbia; mentioned that STS-114 is a baby step to what is needed to do for the next step in space exploration, and gave some examples on how the International Space Station can help pave the path to future space exploration.

  20. Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

    Directory of Open Access Journals (Sweden)

    Jessica N Snowden

    Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.

  1. System Analysis and Risk Assessment system (SARA) Version 4.0

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1992-01-01

    This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis

  2. Peter St. John | NREL

    Science.gov (United States)

    St. John Photo of Peter St. John Peter St. John Researcher III-Chemical Engineering Peter.StJohn @nrel.gov | 303-384-7969 Orcid ID http://orcid.org/0000-0002-7928-3722 Education Peter St. John received his engineering from the University of California at Santa Barbara in 2015. During his Ph.D., St. John applied

  3. The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...

  4. Calculations for the design and modification of the 2 cyclotrons of S.A.R.A

    International Nuclear Information System (INIS)

    Albrand, P.S.; Belmont, J.L.; Ripouteau, F.

    1983-09-01

    S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron

  5. Social humanoid robot SARA: development of the wrist mechanism

    Science.gov (United States)

    Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.

    2018-01-01

    This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.

  6. Richard Kelly: Pioneirismo na iluminação da arquitetura moderna

    Directory of Open Access Journals (Sweden)

    Fernanda Brito Bandeira

    2018-04-01

    Full Text Available Livros resenhado: NEUMANN, Dietrich; STERN, Robert A. M. The structure of light: Richard Kelly and the illumination of modern architecture. New York: Yale University Press, 2010, 214 p. ISBN: 978-0-300-16370-4

  7. Mengukur Politisasi Agama dalam Ruang Publik: Komunikasi SARA dalam Perdebatan Rational Choice Theory

    Directory of Open Access Journals (Sweden)

    Mohammad Supriyadi

    2015-12-01

    Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.

  8. Concurrent software system design supported by SARA at the age of one

    Energy Technology Data Exchange (ETDEWEB)

    Campos, I.M.; Estrin, G.

    A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.

  9. ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

    Directory of Open Access Journals (Sweden)

    Sulistyastuti Sutomo

    2015-01-01

    Full Text Available Not only does art   have   self-fullfillment, but  it also has axiological  benefits both socially, culturally, religiously, and economiclally.  So does Sara Douda dance.  Sara Douda aesthetics  is first contained  in its whole dance movements. In addition, it  can also be found in the whole dance equipments.  Moreover,  this dance aesthetics  may  also be contained in the verbal symbols in the speech forms  prior to the dance performance. However,  both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and  religious values in the Loli community about  their honoring their ancestors,  having social harmony, and  highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance.   Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda

  10. St. John's Wort (image)

    Science.gov (United States)

    The herb St. John's Wort is believed to be helpful in relieving mild to moderate depression, but should only be taken under a physician's supervision. St. John's Wort may clash with other medications or ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...

  17. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    Science.gov (United States)

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...

  5. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  14. Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural

    Directory of Open Access Journals (Sweden)

    Tiara Kharisma

    2017-12-01

    Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

  18. 76 FR 16447 - ETHICON, a Subsidiary of Johnson & Johnson Including On-Site Leased Workers From Kelly Temporary...

    Science.gov (United States)

    2011-03-23

    ... workers of ETHICON, A Johnson and Johnson Company, San Angelo, Texas, separated from employment on or... Johnson & Johnson Including On-Site Leased Workers From Kelly Temporary Services, San Angelo, TX; Amended... of ETHICON, a subsidiary of Johnson & Johnson, including on-site leased workers from Kelly Temporary...

  19. 75 FR 66795 - TTM Technologies, Including On-Site Leased Workers From Kelly Services, Aerotek, and an On-Site...

    Science.gov (United States)

    2010-10-29

    ... follows: ``All workers TTM Technologies, including on-site leased workers from Kelly Services and Aerotek... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-64,993] TTM Technologies, Including On-Site Leased Workers From Kelly Services, Aerotek, and an On-Site Leased Worker From Orbotech...

  20. Botanical insecticides in controlling Kelly's citrus thrips (Thysanoptera: Thripidae) on organic grapefruits.

    Science.gov (United States)

    Vassiliou, V A

    2011-12-01

    Kelly's citrus thrips, Pezothrips kellyanus (Bagnall) (Thysanoptera: Thripidae) was first recorded in Cyprus in 1996 and became an economic citrus pest. In Cyprus, Kelly's citrus thrips larvae cause feeding damage mainly on immature lemon and grapefruit fruits. Use of botanical insecticides is considered an alternative tool compared with synthetic chemicals, in offering solutions for healthy and sustainable citrus production. During 2008-2010, the efficacy of the botanical insecticides azadirachtin (Neemex 0.3%W/W and Oikos 10 EC), garlic extract (Alsa), and pyrethrins (Vioryl 5%SC) was evaluated in field trials against Kelly's citrus thrips larval stage I and II aiming at controlling the pest's population and damage to organic grapefruit fruits. In each of the trial years treatments with pyrethrins and azadirachtin (Neemex 0.3%W/W) were the most effective against Kelly's citrus thrips compared with the untreated control (for 2008: P extract showed the lowest effect from all the botanicals used compared with the untreated control.

  1. John Dewey, an Appreciation

    Science.gov (United States)

    Clopton, Robert W.

    2015-01-01

    The subject of the annual Presidential address of Phi Kappa Phi, presented on May 8, 1962, was John Dewey. Dewey is identified in the public mind chiefly as an educational philosopher. In this address, the author describes the life and work of John Dewey as an indefatigable student of life whose interests ranged, like those of Aristotle, over the…

  2. John P Craig

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. John P Craig. Articles written in Resonance – Journal of Science Education. Volume 17 Issue 10 October 2012 pp 924-925 Article-in-a-Box. S N De - An Appreciation · John P Craig · More Details Fulltext PDF ...

  3. A John Wilson

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. A John Wilson. Articles written in Resonance – Journal of Science Education. Volume 11 Issue 7 July 2006 pp 70-76 Classroom. Inverting Matrices Constructed from Roots of Unity · A John Wilson · More Details Fulltext PDF ...

  4. Transferring generic SARA/OSHA training to US Department of Energy facilities

    International Nuclear Information System (INIS)

    White, A.; McKinley, T.

    1989-01-01

    The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs

  5. SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

    DEFF Research Database (Denmark)

    Martin, Christer; Heinze, C.; Busch, M.

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...

  9. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    OpenAIRE

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...

  11. Identification of Differentially Expressed Proteins in Liver in Response to Subacute Ruminal Acidosis (SARA Induced by High-concentrate Diet

    Directory of Open Access Journals (Sweden)

    X. Y. Jiang

    2014-08-01

    Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.

  12. SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-05-01

    Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.

  13. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    Science.gov (United States)

    Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

    2017-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.

  14. System Analysis and Risk Assessment System (SARA), Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.

    1992-02-01

    This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs

  15. Demythologizing John Dewey

    Science.gov (United States)

    Bhattacharya, N. C.

    1974-01-01

    This article takes a brief but critical look at John Dewey's version of pragmatism, his contribution to philosophical scholarship generally as well as his theory and practice of liberalism. (Author/RK)

  16. Sassis tuumamajandus / John Carey

    Index Scriptorium Estoniae

    Carey, John

    2008-01-01

    USA presidendikandidaadi John McCaini energeetikakava kohaselt tuleks USA-sse ehitada 100 uut tuumaelektrijaama, neist esimesed 45 peaksid valmima aastaks 2030. Tuumaelektrijaamad aitaksid rahuldada USA energiavajadust ning võitleksid ka kliimasoojenemise vastu. Eksperdid on arengukava suhtes kriitilised

  17. Interview with John Milnor

    DEFF Research Database (Denmark)

    Raussen, Martin; Skau, Christian

    2012-01-01

    This interview was given by Professor John Milnor in connection to the Abel Prize 2011 ceremony. Originally the interview appeared in the September issue of the Newsletter of the European Mathematical Society......This interview was given by Professor John Milnor in connection to the Abel Prize 2011 ceremony. Originally the interview appeared in the September issue of the Newsletter of the European Mathematical Society...

  18. Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

    2009-07-01

    Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench

  19. Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

    Science.gov (United States)

    Thomas, S. M.; Su, Y. C.; Hummel, P. R.

    2016-12-01

    Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance

  20. Irradiation damage in graphite. The works of Professor B.T. Kelly

    International Nuclear Information System (INIS)

    Marsden, B.J.

    1996-01-01

    The irradiation damage produced in graphite by energetic neutrons (>100eV) has been extensively studied because of the use of graphite as a moderator in thermal nuclear reactors. In recent times, graphite has been adopted as the protective tiling of the inner wall of experimental fusion systems and property changes due to fusion neutrons have become important. The late Professor B.T. Kelly reviewed the work carried out on the irradiation behaviour of graphite since the 1940s. This work is particularly timely as the scale of research into the effects of fission neutrons has been greatly reduced and many of the active researchers have retired. In recent years, new programmes of work are being formulated for the use of graphite in both the field of high temperature reactor systems and fusion systems. It is therefore important that the knowledge gained by Professor Kelly and other workers is not lost but passed on to future generations of nuclear scientists and engineers. This paper reviews Professor Kelly's last work, it also draws on the experience gained during many long discussions with Brian during the years he worked closely with the present graphite team at AEA Technology. It is hoped to publish his work in full in the near future. (author). 13 refs, 14 figs, 3 tabs

  1. Medical Movies on the Web Debuts with Gene Kelly's "Combat Fatigue Irritability" 1945 Film | NIH MedlinePlus the ...

    Science.gov (United States)

    ... National Library of Medicine (NLM) is a World War II U.S. Navy training film directed by and starring Gene Kelly, who was then a rising Hollywood star. Combat Fatigue Irritability is a historically significant, yet ...

  2. Commemorating John Dyson

    Science.gov (United States)

    Pittard, Julian M.

    2015-03-01

    John Dyson was born on the 7th January 1941 in Meltham Mills, West Yorkshire, England, and later grew up in Harrogate and Leeds. The proudest moment of John's early life was meeting Freddie Trueman, who became one of the greatest fast bowlers of English cricket. John used a state scholarship to study at Kings College London, after hearing a radio lecture by D. M. McKay. He received a first class BSc Special Honours Degree in Physics in 1962, and began a Ph.D. at the University of Manchester Department of Astronomy after being attracted to astronomy by an article of Zdenek Kopal in the semi-popular journal New Scientist. John soon started work with Franz Kahn, and studied the possibility that the broad emission lines seen from the Orion Nebula were due to flows driven by the photoevaporation of neutral globules embedded in a HII region. John's thesis was entitled ``The Age and Dynamics of the Orion Nebula`` and he passed his oral examination on 28th February 1966.

  3. Development of an ion guide coupled to an on-line isotope separation system on Sara. Identification and study of isospin exotic nuclei at Isolde and Sara

    International Nuclear Information System (INIS)

    Bouldjedri, A.

    1992-06-01

    This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements

  4. John Deakin: Double Exposures

    Directory of Open Access Journals (Sweden)

    Paul Rousseau

    2015-11-01

    Full Text Available In this series of short films made by Jonathan Law, the art historian James Boaden, and the curator of The John Deakin Archive, Paul Rousseau, discuss the double-exposure images made by the photographer John Deakin (1912-1972 in the 1950s and 1960s. The films ask you, firstly, to look closely at the images being discussed. Each one begins with a sustained and intense shot of a single image before opening up to a wide-ranging discussion about Deakin, double exposures, and photography.

  5. John Donne no Brasil

    Directory of Open Access Journals (Sweden)

    Jose Garcez Ghirardi

    2008-04-01

    Full Text Available O leitor fica sem saber a troco do que John Donne lhe surge de repente, num virar de página, e através de períodos que parecem responder a uma pergunta que não foi formulada.(... Ninguém, nem o Sr. Afrânio Coutinho falara, até então, de John Donne,(.... Simplesmente, esse trecho, como inúmeros outros (quase todos do livro, revela que leituras apaixonantes obrigaram o professor Afrânio Coutinho a tomar em seu caderno alguns apontamentos eruditos. (MARTINS 1983 vol.I:621

  6. John Cale avaldas memuaarid

    Index Scriptorium Estoniae

    1999-01-01

    Rockbändi "The Velvet Underground" asutajaliige John Cale avaldas oma autobiograafia "What's Welsh for Zen?". Koos biograafiakirjanik Victor Bockrisiga kirjutatud teos räägib 60ndate lõpu kultuurielust New Yorgis, koostööst Andy Warholiga jm.

  7. John Hennessey, Barrier Breaker

    Science.gov (United States)

    Nelson, Stephen J.

    2018-01-01

    John Hennessey lived a remarkable, full life as a professor, as a leader in his field of management and business, and moral, ethical leadership, and as dean at Dartmouth College's Tuck School of Business and provost at the University of Vermont. He was extraordinary on many fronts, a great man who lived in tumultuous times marked by world war as a…

  8. John Archibald Wheeler

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 1. John Archibald Wheeler - Man with Picturesque Imagination. Jayant V Narlikar. General Article Volume 18 Issue 1 January 2013 pp 22-28. Fulltext. Click here to view fulltext PDF. Permanent link:

  9. John Maynard Smith

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 11. John Maynard Smith (1920-2004). Featured Scientist Volume 10 Issue 11 November 2005 pp 110-110. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/11/0110-0110. Resonance ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  11. Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.

    1995-01-01

    Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...

  13. Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010

    OpenAIRE

    Beaulé, Sophie

    2014-01-01

    With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w

  15. Lepidoptera, Nymphalidae, Heliconiinae, Heliconius sara apseudes (Hübner, 1813: Distribution extension

    Directory of Open Access Journals (Sweden)

    Iserhard, C. A.

    2010-01-01

    Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.

  16. Kelly review

    African Journals Online (AJOL)

    USER

    evidence that vitamin A has benefits for morbidity complexing with cellular retinol .... and direct an antibody-mediated There has been very little work on gut lymphoid ... innate pattern recognition receptors Toll-Like weekly for 8 weeks) given to ...

  17. PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

    Directory of Open Access Journals (Sweden)

    Jorge A. Orrego-Ruiz

    2014-06-01

    Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.

  18. John Donne no Brasil

    Directory of Open Access Journals (Sweden)

    Jose Garcez Ghirardi

    2003-04-01

    Full Text Available http://dx.doi.org/10.5007/2175-8026.2003n45p77 O leitor fica sem saber a troco do que John Donne lhe surge de repente, num virar de página, e através de períodos que parecem responder a uma pergunta que não foi formulada.(... Ninguém, nem o Sr. Afrânio Coutinho falara, até então, de John Donne,(.... Simplesmente, esse trecho, como inúmeros outros (quase todos do livro, revela que leituras apaixonantes obrigaram o professor Afrânio Coutinho a tomar em seu caderno alguns apontamentos eruditos. (MARTINS 1983 vol.I:621

  19. Oliver St John Gogarty.

    Science.gov (United States)

    Clarke, R W

    1997-01-01

    Oliver St John Gogarty--Otolaryngologist to fashionable Edwardian Dublin--was a distinguished poet and a Senator in the fledgling Irish Free State after its establishment in 1922. He numbered amongst his acquaintances the poet William Butler Yeats, the novelist James Joyce and a host of political and literary persona who helped to shape modern Ireland. He was satirised as 'stately plump Buck Mulligan' in Joyce's novel Ulysses.

  20. John Kenneth Hulm

    International Nuclear Information System (INIS)

    Hulm, J.

    1988-01-01

    John Hulm has made profound contributions to the field of superconductivity as a research scientist and as an engineer. He and his colleagues discovered the superconducting materials in commercial use today, and he played a key role in the development of commercial superconducting magnets. Dr. Hulm now serves as Chief Scientist at Westinghouse Electric Corporation. This story describes many milestones in the history of superconductivity and offers personal insight into this distinguished scientist

  1. Sir John Meurig Thomas.

    Science.gov (United States)

    Thomas, John Meurig

    2013-10-11

    "My greatest achievement has been to combine being a teacher, a researcher, and a popularizer of science for over 50 years. My worst nightmare is to find myself dumbstruck when I am about to give a lecture …︁" This and more about Sir John Meurig Thomas can be found on page 10938. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. John Strong (1941 - 2006)

    CERN Multimedia

    Wickens, F

    Our friend and colleague John Strong was cruelly taken from us by a brain tumour on Monday 31st July, a few days before his 65th birthday John started his career working with a group from Westfield College, under the leadership of Ted Bellamy. He obtained his PhD and spent the early part of his career on experiments at Rutherford Appleton Laboratory (RAL), but after the early 1970s his research was focussed on experiments in CERN. Over the years he made a number of notable contributions to experiments in CERN: The Omega spectrometer adopted a system John had originally developed for experiments at RAL using vidicon cameras to record the sparks in the spark chambers; He contributed to the success of NA1 and NA7, where he became heavily involved in the electronic trigger systems; He was responsible for the second level trigger system for the ALEPH detector and spent five years leading a team that designed and built the system, which ran for twelve years with only minor interventions. Following ALEPH he tur...

  3. The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

    Science.gov (United States)

    Wood, M. A.

    2003-12-01

    The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.

  4. Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.

    Science.gov (United States)

    Zhao, Bryan M; Hoffmann, F Michael

    2006-09-01

    Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.

  5. Bookshelf. John Adams biography

    International Nuclear Information System (INIS)

    Billinge, Roy

    1993-01-01

    Full text: When John Bertram Adams died on 3 March 1984, CERN lost one of its principal architects. The late Sir John Adams was a very private person who rarely confided in his colleagues. This made the job of his biographer particularly difficult. Michael Crowley- Milling has succeeded admirably, and has performed a very important service. Is it a potted history of CERN, or the story of the building of the PS, or of the SPS? Yes, all of these, but most of all it is a thoughtful and discerning biography and a fitting tribute to a veritable giant of European science and technology. The sub-title,' Engineer Extraordinary' refers not only to John's outstanding ability as a builder of accelerators, but perhaps even more importantly, as a builder of teams and an 'engineer of opinions'. The book describes how John's attention to detail and intuitive engineering skills developed during the early part of his career, when working in radar research, and how he emerged as a natural leader in the building of the CERN PS. Then later, how his statesmanship enabled him to ''...rescue it (the 300 GeV Programme) from seeming political disaster and nurse it through technical problems to a successful conclusion.'' One crucial part of this process described is the visit to CERN in 1970 by Margaret Thatcher, at that time UK Secretary of State for Education and Science, and her subsequent letters of thanks, not only to Bernard Gregory as Director General, but also to John. It is interesting to speculate to what extent the good impression made on that occasion helped many years later, when as Prime Minister Mrs Thatcher decided that Britain should stay in CERN! After the successful commissioning of the SPS, the book goes on to describe the period when the two CERN Laboratories were merged under two Directors General. Unfortunately I found this part a little too low key, given that John and Leon van Hove presided over what was undoubtedly

  6. Preliminary factor analysis of the O’Kelly Women Beliefs Scale in a US sample

    Directory of Open Access Journals (Sweden)

    Arturo Heman Contreras

    2012-06-01

    Full Text Available Using a Rational Emotive Behavior Therapy framework, the O’Kelly Women Beliefs Scale (O’Kelly, in press was originally constructed in Australia to measure sex-role beliefs women may develop through sex-role stereotyping. Factor analysis of the 92 original items showed that 64 items loaded into a single component that accounted for 18.2% of the variance in a sample of 974 Australian women. The present exploratory study examined the psychometric properties of the OWBS in a sample of 202 women born and living in the US. A varimax rotation with cutoff eigenvalues of 3, showed that 37 items loaded into 3 components which accounted for 58.48% of the variance. The items were subsequently grouped into two factors: Ir- rationality, with a total of 27 items was created by merging component 1 and 3 (Pearson’s r = 0.8 between them, and Rationality, with the 10 items from component 2. Analyses indicated a Cronbach’s alpha of 0.91 for Fac- tor 1, and a Cronbach’s alpha 0.74 for Factor 2. Results indicate that this version of the instrument may be used to evaluate both the rational and irrational content of sex-role beliefs of women born in the US.

  7. A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

    Science.gov (United States)

    Worthen, Helena Harlow

    2012-01-01

    The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…

  8. Hemolytic disease of the fetus and newborn caused by an antibody to a low-prevalence antigen, anti-SARA.

    Science.gov (United States)

    Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy

    2011-09-01

    The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.

  9. John Bertram Adams

    International Nuclear Information System (INIS)

    Stafford, G.H.

    1986-01-01

    This is the biography of a man obviously much liked and respected. It gives some personal details but is mainly concerned with his scientific work and achievements on major projects. Thus, some background information on those projects is also given as a context to the work of John Adams. The biography is written in sections; early years, the creation of CERN, Adams at CERN 1953-61, Adams and thermonuclear research 1958-69, (which includes his Directorship of the Culham Laboratory), Adams and the Ministry of Technology 1965-66, member for research of the UK Atomic Energy Authority 1966-69, Adams at CERN 1969-84 (as Director General of the SPS, as Executive Director-General of CERN 1979-81 and work at CERN up to 1984). (UK)

  10. Filsafat Multikulturalisme John Rawls

    Directory of Open Access Journals (Sweden)

    Rina Rehayati

    2012-12-01

    Full Text Available Terjadinya konflik horizontal yang mengatasnamakan identitas kelompok (etnis, suku, keyakinan dan seterusnya dikarenakan adanya phobia terhadap perbedaan. Padahal perbedaan suatu keniscayaan, karena manusia tidak akan mampu menyeragamkan atau menuntut orang lain untuk sama dengan dirinya, baik pada aspek pemikiran, keyakinan, etnis, suku, budaya, dan sebagainya. Filsafat multikulturalisme John Rawls merupakan alternatif tawaran politik kebudayaan untuk mengatasi konflik horizontal. Menurut Rawls, suatu masyarakat yang adil bukanlah hanya menjamin “the greatest happiness for the greatest number” yang selama ini terkenal dalam prinsip demokrasi. Tetapi, masyarakat yang adil menurutnya adalah adanya pengakuan dan penerimaan terhadap perbedaan dan keberagaman. Pendapatnya ini dia rangkai dalam pokok-pokok pemikirannya tentang keadilan, seperti: Justice as Fairness, Veil of Ignorance, Principle of Equal Liberty, Maximin Rule, Lexical Order dan Reflective Equilibrium.

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

  12. NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r

  17. Escribiendo el silencio: la contemplación poética de Sara Pujol

    Directory of Open Access Journals (Sweden)

    Gala, Candelas

    2005-06-01

    Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.

  18. John Adams Lecture

    CERN Multimedia

    PH Department

    2010-01-01

    13 December 2010 14:30 - Council Chamber, Bldg.503-1-001 Accelerator Breakthroughs, Achievements and Lessons from the Tevatron Collider V. Shiltsev / Fermilab’s Accelerator Physics Centre This year we celebrate the 25th anniversary of the first proton-antiproton collisions in the Tevatron. For two and a half decades the Tevatron at Fermilab (Batavia, IL, USA) was a centerpiece of the US and world’s High Energy Physics as the world’s highest energy particle collider at 1.8 TeV center of mass energy. While funding agencies are deciding on a 3-year extension of the Collider Run II operation through 2014, we – in this 2010 John Adams Lecture - will take a look in exciting story of the Tevatron: the story of long preparations, great expectations, numerous difficulties, years of “blood and sweat”, continuous upgrades, exceeding original goals (by a factor of 400) and high emotions. An accelerator scientist prospective will be given on a wide spectrum o...

  19. 77 FR 9969 - Johnson Controls D/B/A Hoover Universal, Inc. Including On-Site Leased Workers from Kelly...

    Science.gov (United States)

    2012-02-21

    ... Johnson Controls, including on-site leased workers from Kelly Services, Sycamore, Illinois. The notice was... amended notice applicable to TA-W-73,074 is hereby issued as follows: ''All workers of Johnston Controls... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-73,074] Johnson Controls D/B/A...

  20. 75 FR 28295 - Federal-Mogul, Including On-Site Leased Workers From Kelly Services, Summerton, SC; Amended...

    Science.gov (United States)

    2010-05-20

    ... workers were sufficiently under the control of the subject firm to be considered leased workers. Based on... On-Site Leased Workers From Kelly Services, Summerton, SC; Amended Certification Regarding Eligibility To Apply for Worker Adjustment Assistance In accordance with Section 223 of the Trade Act of 1974...

  1. Intravenous immunoglobulin in the management of a rare cause of hemolytic disease of the newborn: Anti-SARA antibodies.

    Science.gov (United States)

    Venkataraman, Rohini; Yusuf, Kamran

    2017-01-01

    Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.

  2. HISTORICAL NOTE JOHN HUNTER (SURGEON) John Hunter FRS ...

    African Journals Online (AJOL)

    JOHN HUNTER (SURGEON). John Hunter FRS (13 February 1728-16 October 1793) was a Scottish surgeon, one of the most distinguished scientists and surgeons of his day. He was an early advocate of careful observation and scientific method in medicine. He was the husband of Anne Hunter, a teacher, friend and ...

  3. Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

    Directory of Open Access Journals (Sweden)

    Tirshem Kumar Kaushik

    2015-05-01

    Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.

  4. Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge

    DEFF Research Database (Denmark)

    Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette

    2017-01-01

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...

  5. Market Feasibility of Burberry and Gucci in Zhang Jiagang City, P.R China : Case: Introduce a New Luxury Brand into Kelly Mall

    OpenAIRE

    Wang, Ning; Wu, Youran

    2012-01-01

    With the rapid development of Chinese economy, wealth has spread from largest coastal cities to smaller cities and luxury stores have started to follow. Kelly Mall is the largest high-end department store situated in Zhang Jiagang City, Jiangsu Province, P.R China. This research aims to figure out if Kelly Mall should introduce a new luxury brand, help-ing Kelly Mall’s board members make decision on taking either Burberry or Gucci or both of them into its luxury department. Theoretical framew...

  6. TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

    Energy Technology Data Exchange (ETDEWEB)

    1989-03-01

    This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.

  7. Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.

    1994-11-01

    The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)

  8. Instructional materials for SARA/OSHA training. Volume 1, General site working training

    Energy Technology Data Exchange (ETDEWEB)

    Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)

    1988-04-01

    This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.

  9. La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli

    Directory of Open Access Journals (Sweden)

    Umberto Fortis

    2014-04-01

    Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.

  10. Reading Sara Pujol Russell’s Poetry of Contemplation and Connection

    Directory of Open Access Journals (Sweden)

    Anita M. Hart

    2012-06-01

    Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.

  11. SAPHIRE technical reference manual: IRRAS/SARA Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.

    1993-01-01

    This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix

  12. "When does making detailed predictions make predictions worse?": Correction to Kelly and Simmons (2016).

    Science.gov (United States)

    2016-10-01

    Reports an error in "When Does Making Detailed Predictions Make Predictions Worse" by Theresa F. Kelly and Joseph P. Simmons ( Journal of Experimental Psychology: General , Advanced Online Publication, Aug 8, 2016, np). In the article, the symbols in Figure 2 were inadvertently altered in production. All versions of this article have been corrected. (The following abstract of the original article appeared in record 2016-37952-001.) In this article, we investigate whether making detailed predictions about an event worsens other predictions of the event. Across 19 experiments, 10,896 participants, and 407,045 predictions about 724 professional sports games, we find that people who made detailed predictions about sporting events (e.g., how many hits each baseball team would get) made worse predictions about more general outcomes (e.g., which team would win). We rule out that this effect is caused by inattention or fatigue, thinking too hard, or a differential reliance on holistic information about the teams. Instead, we find that thinking about game-relevant details before predicting winning teams causes people to give less weight to predictive information, presumably because predicting details makes useless or redundant information more accessible and thus more likely to be incorporated into forecasts. Furthermore, we show that this differential use of information can be used to predict what kinds of events will and will not be susceptible to the negative effect of making detailed predictions. PsycINFO Database Record (c) 2016 APA, all rights reserved

  13. Cinema and the Great War - Andrew Kelly, 1997. History by Hollywood. The use and abuse of the American past - Robert Brant Toplin, 1996

    NARCIS (Netherlands)

    Kester, Bernadette

    1998-01-01

    textabstractReview of: Cinema and the Great War. Andrew Kelly, Londen, New York (Routledge), 1997, 219 p.History by Hollywood. The use and abuse of the American past. Robert Brant Toplin, Chicago (Urbana), 1996, 267 p.

  14. Magic moments with John Bell

    Energy Technology Data Exchange (ETDEWEB)

    Bertlmann, Reinhold A.

    2015-07-15

    John Bell, with whom I had a fruitful collaboration and warm friendship, is best known for his seminal work on the foundations of quantum physics, but he also made outstanding contributions to particle physics and accelerator physics.

  15. Magic moments with John Bell

    International Nuclear Information System (INIS)

    Bertlmann, Reinhold A.

    2015-01-01

    John Bell, with whom I had a fruitful collaboration and warm friendship, is best known for his seminal work on the foundations of quantum physics, but he also made outstanding contributions to particle physics and accelerator physics

  16. John locke on personal identity.

    Science.gov (United States)

    Nimbalkar, Namita

    2011-01-01

    John Locke speaks of personal identity and survival of consciousness after death. A criterion of personal identity through time is given. Such a criterion specifies, insofar as that is possible, the necessary and sufficient conditions for the survival of persons. John Locke holds that personal identity is a matter of psychological continuity. He considered personal identity (or the self) to be founded on consciousness (viz. memory), and not on the substance of either the soul or the body.

  17. John Locke on Personal Identity**

    OpenAIRE

    Nimbalkar, Namita

    2011-01-01

    John Locke speaks of personal identity and survival of consciousness after death. A criterion of personal identity through time is given. Such a criterion specifies, insofar as that is possible, the necessary and sufficient conditions for the survival of persons. John Locke holds that personal identity is a matter of psychological continuity. He considered personal identity (or the self) to be founded on consciousness (viz. memory), and not on the substance of either the soul or the body.

  18. John Leask Lumley: Whither Turbulence?

    Science.gov (United States)

    Leibovich, Sidney; Warhaft, Zellman

    2018-01-01

    John Lumley's contributions to the theory, modeling, and experiments on turbulent flows played a seminal role in the advancement of our understanding of this subject in the second half of the twentieth century. We discuss John's career and his personal style, including his love and deep knowledge of vintage wine and vintage cars. His intellectual contributions range from abstract theory to applied engineering. Here we discuss some of his major advances, focusing on second-order modeling, proper orthogonal decomposition, path-breaking experiments, research on geophysical turbulence, and important contributions to the understanding of drag reduction. John Lumley was also an influential teacher whose books and films have molded generations of students. These and other aspects of his professional career are described.

  19. Titular Tilting in John Ashbery

    DEFF Research Database (Denmark)

    Balle, Søren Hattesen

    2008-01-01

    Among the numerous poems published by the American poet John Ashbery since his debut in 1956 one finds a few that specifically deal with the issue of entitlement. These poems do not appear in one single of his volumes, but are disseminated throughout Ashbery’s career and production. Their occurre......Among the numerous poems published by the American poet John Ashbery since his debut in 1956 one finds a few that specifically deal with the issue of entitlement. These poems do not appear in one single of his volumes, but are disseminated throughout Ashbery’s career and production....... Their occurrence neither follows any particular plan, nor do they form part of a larger poetic or thematic whole in the volumes where they have been published. Rather, they are perhaps better characterized as “typically atypical of Ashbery’s poetry” – to put it in paradoxical terms used by John Shoptaw in his 1994...

  20. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    Directory of Open Access Journals (Sweden)

    Abdullah K. Shehabat

    2016-09-01

    Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.

  1. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0. Volume 5, Systems Analysis and Risk Assessment (SARA) tutorial manual

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities

  2. SARA South Observations and Analysis of the Solar Type, Totally Eclipsing, Over Contact Binary, PY Aquarii

    Science.gov (United States)

    Chamberlain, Heather; Samec, Ronald G.; Caton, Daniel Bruce; Van Hamme, Walter

    2018-01-01

    PY Aqr (GSC 05191-00853) is a solar Type (T ~ 5750K) eclipsing binary. It was observed in July to October, 2017 at Cerro Tololo in remote mode with the 0.6-m SARA South reflector. Two times of minimum light were calculated from our present observations, a primary and a secondary eclipse:HJD Min I = 2457951.7762±0.0006 HJD Min II = 2458019.5295±00.0003. Both weighted as 1.0.In addition, four timings were determined from online data given in IBVS 5600 and five observations at minima were determined from archived All Sky Automated Survey Data:HJD Min I = 2452908.3165, 2452912.33612 HJD Min II = 2452877.5621, 2452913.34465. All weighted as 0.5.ASAS Observations at minima: 2452094.688, 2453478.882, 2453266.576, 2452093.685 and 54729.600. Each weighted as 0.10The following linear and quadratic ephemerides were determined from all available times of minimum light:JD Hel Min I=2452951.7443±0.0008d + 0.402093441±0.000000099 X E {1} JD Hel Min I=2452951.7439±0.0007d + 0.4020912±0.0000007 X E +0.00000000018 ± 0.00000000006 X E2 {2}A BVRI Bessell filtered simultaneous Wilson-Devinney Program (W-D) solution reveals that the system has a mass ratio of ~0.34 and a component temperature difference of only ~40 K. One low luminosity (Tfact ~ 0.94, ~66 degree radius) large cool region of spots was iterated on the primary component in the WD Synthetic Light Curve computations. It appears in the Southern Hemisphere (colatitude 155 degrees). The Roche Lobe fill-out of the binary is ~17%. The inclination is ~86 degrees. An eclipse duration of ~10 minutes was determined for the primary eclipse and the light curve solution. Additional and more detailed information is given in this report.

  3. DETERMINACIÓN DE LAS FRACCIONES SARA DE ASFALTOS COLOMBIANOS ENVEJECIDOS AL MEDIO AMBIENTE EMPLEANDO CROMATOGRAFÍA LÍQUIDA EN COLUMNA DETERMINAÇÃO DAS FRAÇÕES SARA DE ASFALTOS COLOMBIANOS ENVELHECIDOS AO MÉDIO AMBIENTE EMPREGANDO CROMATOGRAFIA LÍQUIDA EM COLUNA DETERMINATION OF SARA FRACTIONS OF ENVIRONMENTALLY AGED COLOMBIAN ASPHALTS USING LIQUID CHROMATOGRAPHY COLUMN

    Directory of Open Access Journals (Sweden)

    Fredy Alberto Reyes

    2012-06-01

    Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p

  4. The Poetry of John Dewey

    Science.gov (United States)

    Williams, Jerry L.

    2016-01-01

    This essay examines the poetry of John Dewey, 101 poems in total. Characteristic of the rhymed and metered poetry of the period, they show a very human side of Dewey. This analysis argues that many of his poems deal with existential themes--love, finitude, and God, for example. On a deeper level these poems are also show connections to Dewey's…

  5. An Interview with John Liontas

    Science.gov (United States)

    Sadeghi, Karim

    2017-01-01

    John I. Liontas, Ph.D. is an associate professor of foreign languages, English for speakers of other languages (ESOL), and technology in education and second language acquisition (TESLA), and director and faculty of the TESLA doctoral program at the University of South Florida. Dr. Liontas is a distinguished thought leader, author, and…

  6. John Dewey, Gothic and Modern

    Science.gov (United States)

    Kaminsky, James S.

    2010-01-01

    It is argued here that understanding John Dewey's thought as that of a prodigal liberal or a fellow traveller does not capture the complexity of his work. It is also important to recognise the portion of his work that is "historie morale." In the very best sense it is epic, encapsulating the hopes and dreams of a history of the American people in…

  7. Rees, Prof. Lord Martin (John)

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 1991 Honorary. Rees, Prof. Lord Martin (John) FRS. Date of birth: 23 June 1942. Address: Emeritus professor of Cosmology & Astrophysics, Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA, U.K.. Contact: Office: (+44-1223) 33 7548

  8. The Art of John Biggers

    Science.gov (United States)

    Coy, Mary

    2010-01-01

    In their 2005 exhibit of John Biggers' work, the New Orleans Museum of Art described it as being inspired by "African art and culture, the injustices of a segregated United States, the stoic women in his own family, and the heroes of everyday survival." In this article, the author describes how her students reinterpreted Biggers' work.…

  9. Dr. John Marburger visits DESY

    CERN Multimedia

    2003-01-01

    Dr. John Marburger, Director of the United States Office of Science and Technology Policy, visited the research center DESY in Hamburg. The American physicist wanted to inform himself about the status of the TESLA X-ray laser and the TESLA linear collider as well as the international collaboration at DESY (1/2 page).

  10. Thomas, Prof. Sir John Meurig

    Indian Academy of Sciences (India)

    Thomas, Prof. Sir John Meurig FRS. Date of birth: 15 December 1932. Address: Department of Materials Science and, Metallurgy, New Museums Site, 27, Babbage ... Theory Of Evolution. Posted on 23 January 2018. Joint Statement by the Three Science Academies of India on the teaching of the theory of evolution more.

  11. John Dalton (1766–1844)

    Indian Academy of Sciences (India)

    IAS Admin

    of matter and the development of science in the world, especially in. Europe. During ... He belonged to a family of Quakers. (Society of ... During this period, Dalton came under the influence of John Gough, who suggested that he maintain a ...

  12. Foreword: Sir John Pendry FRS Sir John Pendry FRS

    Science.gov (United States)

    Inglesfield, John; Echenique, Pedro

    2008-07-01

    John Pendry John Inglesfield and Pedro Echenique write: John Pendry's 65th birthday is on 4 July 2008, and this issue of the Journal of Physics: Condensed Matter is dedicated to him, with articles by friends, colleagues, and former students. By any standards, John Pendry is a great scientist, who has made—and continues to make—an enormous contribution to physics; the wide range of his interests is reflected in the scope of these articles. Not many scientists can establish a completely new and unexpected area of research, but this has been John's achievement in the last few years in the field of metamaterials, materials whose electromagnetic properties depend on their structure rather than the materials of which the structure is built. In this way, structures with effectively negative electrical permittivity and negative magnetic permeability can be constructed, demonstrating negative refraction; through metamaterials scientists now have access to properties not found in nature, and never previously explored experimentally. Never a week goes by without a potential new application of metamaterials, whether it is perfect lensing, or the cloak of invisibility. This has certainly led to tremendous visibility for John himself, with guest lectures all over the world, and radio and television appearances. John Pendry's first paper was published exactly 40 years ago, 'Analytic properties of pseudopotentials' [1], and since then he has published 310 articles at the latest count. But this first paper already reflected something of the way John works. His PhD project, with Volker Heine at the Cavendish Laboratory, was to interpret the scattering of low energy electrons from surfaces, the technique of LEED which was to become the method of choice for determining surface structure. Although the energy of the electrons in LEED is relatively low—say 50 eV—it is much higher than the energy of the conduction electrons, for which pseudopotentials had been devised, and John

  13. John Adams and his times

    International Nuclear Information System (INIS)

    Amaldi, E.

    1986-01-01

    In this first John Adams' Memorial Lecture, an outline is given of his work, especially from the beginning of CERN in 1952 until his death in 1984. The historical survey covers John Adams' technical and managerial contributions to the development of CERN and its accelerators, as well as to fusion research in Britain and Europe. Exemplified by his role as member and president of the International Committee for Future Accelerators (ICFA), Adams' interest in international co-operation is also stressed. In the spirit of this great European, arguments are given for CERN to continue to be the first-rate high-energy physics laboratory which it has been in the past. (orig.)

  14. John von Neumann selected letters

    CERN Document Server

    2005-01-01

    John von Neuman was perhaps the most influential mathematician of the twentieth century, especially if his broad influence outside mathematics is included. Not only did he contribute to almost all branches of mathematics and created new fields, but he also changed post-World War II history with his work on the design of computers and with being a sought-after technical advisor to many figures in the U.S. military-political establishment in the 1940s and 1950s. The present volume is the first substantial collection of (previously mainly unpublished) letters written by von Neumann to colleagues, friends, government officials, and others. The letters give us a glimpse of the thinking of John von Neumann about mathematics, physics, computer science, science management, education, consulting, politics, and war. Readers of quite diverse backgrounds will find much of interest in this fascinating first-hand look at one of the towering figures of twentieth century science.

  15. Is John Locke a democrat?

    DEFF Research Database (Denmark)

    Svensson, Palle

      Over recent years there has been a tendency to present John Locke as an equalitarian democrat (Ashcraft) and being close to the political views of the levellers (Waldron). This is not a completely new interpretation (Kendall, 1941), but contrasts with the prevalent view presented in textbooks (......, criteria for a democratic process, and the institutions of polyarchy. The conclusion has implications for the relationship between political liberalism and constitutionalism on the one hand and democracy on the other....

  16. Charles Darwin and John Herschel

    Science.gov (United States)

    Warner, B.

    2009-11-01

    The influence of John Herschel on the philosophical thoughts of Charles Darwin, both through the former's book, Natural Philosophy, and through their meeting in 1836 at the Cape of Good Hope, is discussed. With Herschel having himself speculated on evolution just a few months before he met Darwin, it is probable that he stimulated at least the beginnings of the latter's lifelong work on the subject.

  17. A Conversation with John Nelder

    OpenAIRE

    Senn, Stephen

    2003-01-01

    John Ashworth Nelder was born in 1924 in Dulverton, Somerset, England. He received his secondary education in nearby Tiverton at Blundell's, a "public" [that is to say, privately funded] school that he attended as a day pupil. In 1942, he entered Sidney Sussex College, Cambridge University, to read mathematics. His studies were interrupted after one year by war service and he trained as an RAF navigator in South Africa. He returned to Cambridge in 1946 and complete his studies, graduating a "...

  18. John Glenn Biomedical Engineering Consortium

    Science.gov (United States)

    Nall, Marsha

    2004-01-01

    The John Glenn Biomedical Engineering Consortium is an inter-institutional research and technology development, beginning with ten projects in FY02 that are aimed at applying GRC expertise in fluid physics and sensor development with local biomedical expertise to mitigate the risks of space flight on the health, safety, and performance of astronauts. It is anticipated that several new technologies will be developed that are applicable to both medical needs in space and on earth.

  19. John Strong - 1941-2006

    CERN Multimedia

    2006-01-01

    Our friend and colleague John Strong was cruelly taken from us by a brain tumour on 31 July, a few days before his 65th birthday. John started his career and obtained his PhD in a group from Westfield College, initially working on experiments at Rutherford Appleton Laboratory (RAL). From the early 1970s onwards, however, his research was focused on experiments in CERN, with several particularly notable contributions. The Omega spectrometer adopted a system John had originally developed for experiments at RAL using vidicon cameras (a type of television camera) to record the sparks in the spark chambers. This highly automated system allowed Omega to be used in a similar way to bubble chambers. He contributed to the success of NA1 and NA7, where he became heavily involved in the electronic trigger systems. In these experiments the Westfield group joined forces with Italian colleagues to measure the form factors of the pion and the kaon, and the lifetime of some of the newly discovered charm particles. Such h...

  20. The Changing Tides of the Type 2 Diabetes Epidemic-Smooth Sailing or Troubled Waters Ahead? Kelly West Award Lecture 2016.

    Science.gov (United States)

    Gregg, Edward W

    2017-10-01

    The Kelly West Award for Outstanding Achievement in Epidemiology is given in memory of Kelly M. West, widely regarded as the "father of diabetes epidemiology," to an individual who has made significant contributions to the field of diabetes epidemiology. Edward W. Gregg, PhD, of the Division of Diabetes Translation, Centers for Disease Control and Prevention, Atlanta, GA, received the prestigious award at the American Diabetes Association's 76th Scientific Sessions, 10-14 June 2016, in New Orleans, LA. He presented the Kelly West Award Lecture, "Changing Tides of the Type 2 Diabetes Epidemic-Smooth Sailing or Troubled Waters Ahead?" on Sunday, 12 June 2016. © 2017 by the American Diabetes Association.

  1. Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia

    Directory of Open Access Journals (Sweden)

    Tjitske F. Lawerman

    2017-12-01

    Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced

  2. sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

    DEFF Research Database (Denmark)

    Christner, Martin; Heinze, Constanze; Busch, Michael

    2012-01-01

    to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...

  3. Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

    Science.gov (United States)

    Godwin, Allison; Potvin, Geoff

    2017-01-01

    This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…

  4. Staphylococcus aureus Quorum Regulator SarA Targeted Compound, 2-[(Methylaminomethyl]phenol Inhibits Biofilm and Down-Regulates Virulence Genes

    Directory of Open Access Journals (Sweden)

    P. Balamurugan

    2017-07-01

    Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.

  5. John W. Daly - An Appreciation

    Science.gov (United States)

    Kirk, Kenneth L.

    2015-01-01

    John W. Daly was engaged in groundbreaking basic research for nearly 50 years at NIH in Bethesda, Maryland. A primary focus of his research included the discovery, structure elucidation, synthesis and pharmacology of alkaloids and other biologically active natural products. However, he earned further acclaim in other areas that included the investigation of the structure-activity relationships for agonists/antagonists at adenosine, adrenergic, histamine, serotonin, and acetylcholine receptors. In addition he was a pioneer in studies of the modulation and functional relationships for systems involving calcium, cyclic nucleotides, ion channels and phospholipids and in the mechanism of actions of caffeine and other xanthines. PMID:26160996

  6. A tribute to John Gibbon.

    Science.gov (United States)

    Church, Russell M.

    2002-04-28

    This article provides an overview of the published research of John Gibbon. It describes his experimental research on scalar timing and his development of scalar timing theory. It also describes his methods of research which included mathematical analysis, conditioning methods, psychophysical methods and secondary data analysis. Finally, it describes his application of scalar timing theory to avoidance and punishment, autoshaping, temporal perception and timed behavior, foraging, circadian rhythms, human timing, and the effect of drugs on timed perception and timed performance of Parkinson's patients. The research of Gibbon has shown the essential role of timing in perception, classical conditioning, instrumental learning, behavior in natural environments and in neuropsychology.

  7. The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters

    International Nuclear Information System (INIS)

    Iazzourene, F.

    1982-01-01

    The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr

  8. Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

    Directory of Open Access Journals (Sweden)

    Helena López

    2013-07-01

    Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.

  9. Os suínos da raça Bísara – oportunidades e desafios

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...

  10. John Donne no Brasil John Donne no Brasil

    Directory of Open Access Journals (Sweden)

    Jose Garcez Ghirardi

    2008-04-01

    Full Text Available O leitor fica sem saber a troco do que John Donne lhe surge de repente, num virar de página, e através de períodos que parecem responder a uma pergunta que não foi formulada.(... Ninguém, nem o Sr. Afrânio Coutinho falara, até então, de John Donne,(.... Simplesmente, esse trecho, como inúmeros outros (quase todos do livro, revela que leituras apaixonantes obrigaram o professor Afrânio Coutinho a tomar em seu caderno alguns apontamentos eruditos. (MARTINS 1983 vol.I: 621 A citação acima, extraída de um artigo de Wilson Martins (in O Estado de São Paulo, 25/02/54, ilustra bem a posição reservada a John Donne, até então, por aqueles que, no Brasil, se dedicavam aos estudos de literatura. “A troco do que” - perguntava o autor - deveria ser o leitor de Correntes Cruzadas confrontado com o nome de Donne? Quem, até aquele momento, dele se ocupara? Ninguém, respondia o erudito articulista (nem mesmo o Sr. Afrânio Coutinho, embora reconhecendo que o nome do poeta pudesse ter sido fonte de algumas “leituras apaixonantes” . Interessava-lhe apontar enfaticamente, porém, que a lembrança de Donne surgia de maneira gratuita, desligada de qualquer argumentação ou contexto que a preparas se ou justificasse. Não apenas Afrânio Coutinho silenciara sobre a obra de Donne em seu livro; ninguém, de fato, havia, até aquele momento, dedicado, ao poeta, qualquer atenção mais demorada. Curiosamente, o próprio artigo, assim como o livro nele discutido, atestava, no entanto, que o esquecimento do nome de Donne estava por findar.

  11. John Strong 1941-2006

    CERN Multimedia

    2006-01-01

    John started his career and obtained his PhD in a group from Westfield College, initially working on experiments at Rutherford Appleton Laboratory (RAL). From the early 1970s onwards, however, his research was focused on experiments in CERN, with several particularly notable contributions. The Omega spectrometer adopted a system John had originally developed for experiments at RAL using vidicon Cameras (a type of television camera) to record the sparks in the spark chambers. This highly automated system allowed Omega to be used in a similar way to bubble chambers.  He contributed to the success of NA1 and NA7, where he became heavily involved in the electronic trigger systems. In these experiments the Westfield group joined forces with Italian colleagues to measure the form factors of the pion and the kaon, and the lifetime of some of the newly discovered charm particles. Such has been the lasting impact of these measurements that the paper on the pion form-factor had been cited 323 times up to the time of J...

  12. John Greenleaf's life of science.

    Science.gov (United States)

    Watenpaugh, Donald E

    2012-12-01

    This article summarizes the life and career of John E. Greenleaf, PhD. It complements an interview of Dr. Greenleaf sponsored by the American Physiological Society Living History Project found on the American Physiological Society website. Dr. Greenleaf is a "thought leader" and internationally renowned physiologist, with extensive contributions in human systems-level environmental physiology. He avoided self-aggrandizement and believed that deeds rather than words define one's legacy. Viewed another way, however, Greenleaf's words define his deeds: 48% of his 185 articles are first author works, which is an unusually high proportion for a scientist of his stature. He found that writing a thorough and thoughtful discussion section often led to novel ideas that drove future research. Beyond Greenleaf's words are the many students, postdocs, and collaborators lucky enough to have worked with him and thus learn and carry on his ways of science. His core principles included the following: avoid research "fads," embrace diversity, be the first subject in your own research, adhere to rules of fiscal responsibility, and respect administrative forces-but never back down from them when you know you are right. Greenleaf's integrity ensured he was usually right. He thrived on the axiom of many successful scientists: avoid falling in love with hypotheses, so that when unexpected findings appear, they arouse curiosity instead of fear. Dr. Greenleaf's legacy will include the John and Carol Greenleaf Award for prolific environmental and exercise-related publication in the Journal of Applied Physiology.

  13. The thermal regime and species composition of fish and invertebrates in Kelly Warm Spring, Grand Teton National Park, Wyoming

    Science.gov (United States)

    Harper, David; Farag, Aida

    2017-01-01

    We evaluated the thermal regime and relative abundance of native and nonnative fish and invertebrates within Kelly Warm Spring and Savage Ditch, Grand Teton National Park, Wyoming. Water temperatures within the system remained relatively warm year-round with mean temperatures >20 °C near the spring source and >5 °C approximately 2 km downstream of the source. A total of 7 nonnative species were collected: Convict/Zebra Cichlid (Cichlasoma nigrofasciatum), Green Swordtail (Xiphophorus hellerii), Tadpole Madtom (Noturus gyrinus), Guppy (Poecilia reticulata), Goldfish (Carassius auratus), red-rimmed melania snail (Melanoides tuberculata), and American bullfrog tadpoles (Lithobates catesbeianus). Nonnative fish (Zebra Cichlids and Green Swordtails), red-rimmed melania snails, and bullfrog tadpoles dominated the upper 2 km of the system. Abundance estimates of the Zebra Cichlid exceeded 12,000 fish/km immediately downstream of the spring source. Relative abundance of native species increased movingdownstream as water temperatures attenuated with distance from the thermally warmed spring source; however, nonnative species were captured 4 km downstream from the spring. Fish diseases were prevalent in both native and nonnative fish from the Kelly Warm Spring pond. Clinostomum marginatum, a trematode parasite, was found in native species samples, and the tapeworm Diphyllobothrium dendriticum was present in samples from nonnative species. Diphyllobothrium dendriticum is rare in Wyoming. Salmonella spp. were also found in some samples of nonnative species. These bacteria are associated with aquarium fish and aquaculture and are generally not found in the wild.

  14. John Tyndall's religion: a fragment

    Science.gov (United States)

    Cantor, Geoffrey

    2015-01-01

    Both contemporaries and historians have focused on the high-profile 1874 Belfast Address in which John Tyndall was widely perceived as promulgating atheism. Although some historians have instead interpreted him as a pantheist or an agnostic, it is clear that any such labels do not accurately capture Tyndall's religious position throughout his life. By contrast, this paper seeks to chart Tyndall's religious journey from 1840 (when he was in his late teens) to the autumn of 1848 when he commenced his scientific studies at Marburg. Although he had been imbued with his father's stern conservative Irish Protestantism and opposition to Catholicism, as a youth he seems for a time to have been attracted to Methodism. Later, however, he questioned and rejected his father's religious views and was increasingly drawn to the more spiritual outlook of Ralph Waldo Emerson and Thomas Carlyle, along with a more radical attitude to politics.

  15. Revisiting fracture gradient: Comments on “A new approaching method to estimate fracture gradient by correcting Matthew–Kelly and Eaton's stress ratio”

    KAUST Repository

    Hakiki, Farizal; Shidqi, Muizzuddin

    2017-01-01

    A study performed by Marbun et al. [1] claimed that “A new methodology to predict fracture pressure from former calculations, Matthew–Kelly and Eaton are proposed.” Also, Marbun et al.'s paper stated that “A new value of Poisson's and a stress ratio

  16. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  17. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Diego O Andrey

    Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  18. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    OpenAIRE

    Abdullah K. Shehabat

    2016-01-01

    This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...

  19. Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests

    International Nuclear Information System (INIS)

    Eifler, W.; Shepherd, I.M.

    1983-01-01

    Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix

  20. Land-use evaluation for sustainable construction in a protected area: A case of Sara mountain national park.

    Science.gov (United States)

    Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena

    2018-01-15

    The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. WIT Diversity Talk with John Ellis

    CERN Multimedia

    CERN. Geneva; Ellis, Jonathan R.

    2017-01-01

    Sudeshna Datta Cockerill, CERN Ombudsperson, will interview John Ellis, a renown British theoretical physicist with a long career both at CERN and externally. John Ellis has also been awarded several prizes for his work in physics. Among many other outstanding roles and positions, he was Division Leader of the Theory Division at CERN from 1988-1994. John Ellis is currently Clerk Maxwell Professor of Theoretical Physics at King's College London.

  2. “If You Don’t Bring No Grits, Don’t Come”: Critiquing a Critique of Patrick Kelly, Golliwogs, And Camp as A Technique of Black Queer Expression

    Directory of Open Access Journals (Sweden)

    Barnes Sequoia

    2017-12-01

    Full Text Available I have written this article in order to establish Patrick Kelly as a black forbearer of fashion. Kelly complicates our sense of fashion through his use of black memorabilia and camp to not only create something consumable but to comment on the black body as a consumable. Therefore, the role I play in acknowledging this black supernova, as Eric Darnell Pritchard calls him, is by critiquing Lewis and Fraley’s critique of Patrick Kelly and questioning why overtly expressing one’s queerness through camp has not been seen as a viable form of black expression in the mainstream narrative of black creativity. Lewis and Fraley’s complete dismissal of Kelly’s use of camp does not happen in a vacuum. Yet, I must remember that there is also the task of establishing a legacy of technique for Patrick Kelly. Who are his forbearers?

  3. John Smithi kaks palet / Johannes Saar

    Index Scriptorium Estoniae

    Saar, Johannes, 1965-

    2003-01-01

    Näitus "John Smith. Marko ja Kaido" Tallinna Kunstihoones. Kaido Ole ja Marko Mäetamm esindavad rühmitusena "John Smith" Eestit 2003. a. Veneetsia biennaalil. Ilmunud ka kogumikus "Päevast päeva", lk. 90-96

  4. John of Salisbury on Aristotelian Science

    DEFF Research Database (Denmark)

    Bloch, David

    The First substantial treatment of John of Salisbury's views on Aristotelian science. Important for our understanding of the reception of Aristotle's works and for the history of theories of science.......The First substantial treatment of John of Salisbury's views on Aristotelian science. Important for our understanding of the reception of Aristotle's works and for the history of theories of science....

  5. John Kotter on Leadership, Management and Change.

    Science.gov (United States)

    Bencivenga, Jim

    2002-01-01

    Excerpts from interview with John Kotter, Konosuke Matsushita Professor of Leadership at the Harvard Business School, about his thoughts on the role of the superintendent as leader and manager. Describes his recent book "John P. Kotter on What Leaders Really Do," 1999. Lists eight-step change process from his book "Leading Change," 1996. (PKP)

  6. Probabilistic model fitting for spatio-temporal variability studies of precipitation: the Sara-Brut system - a case study

    International Nuclear Information System (INIS)

    Dorado Delgado, Jennifer; Burbano Criollo, Juan Carlos; Molina Tabares, Jose Manuel; Carvajal Escobar, Yesid; Aristizabal, Hector Fabio

    2006-01-01

    In this study, space and time variability of monthly and annual rainfall was analyzed for the downstream influence zone of a Colombian supply-regulation reservoir, Sara-Brut, located on the Cauca valley department. Monthly precipitation data from 18 gauge stations and for a 29-year record (1975-2003) were used. These data were processed by means of time series completion, consistency analyses and sample statistics computations. Theoretical probabilistic distribution models such as Gumbel, normal, lognormal and wake by, and other empirical distributions such as Weibull and Landwehr were applied in order to fit the historical precipitation data set. The fit standard error (FSE) was used to test the goodness of fit of the theoretical distribution models and to choose the best of this probabilistic function. The wake by approach showed the best goodness of fit in 89% of the total gauges taken into account. Time variability was analyzed by means of wake by estimated values of monthly and annual precipitation associated with return periods of 1,052, 1,25, 2, 10, 20 and 50 years. Precipitation space variability is presents by means of ArcGis v8.3 and using krigging as interpolation method. In general terms the results obtained from this study show significant distribution variability in precipitation over the whole area, and particularity, the formation of dry and humid nucleus over the northeastern strip and microclimates at the southwestern and central zone of the study area were observed, depending on the season of year. The mentioned distribution pattern is likely caused by the influence of pacific wind streams, which come from the Andean western mountain range. It is expected that the results from this work be helpful for future planning and hydrologic project design

  7. Growth of the pectoral girdle in a sample of juveniles from the kellis 2 cemetery, Dakhleh Oasis, Egypt.

    Science.gov (United States)

    Bleuze, Michele M; Wheeler, Sandra M; Williams, Lana J; Dupras, Tosha L

    2016-09-10

    This study investigates growth patterns in the scapula and clavicle in a cross-sectional juvenile skeletal sample ranging from 20 weeks gestation to 8.5 years of age from the Kellis 2 cemetery, Dakhleh Oasis, Egypt. The primary goal is to quantify growth patterns and growth velocities in the scapula and clavicle to better understand the development of the pectoral girdle. A series of low-order polynomial regression models was used to examine growth curves in clavicle diaphyseal length, scapular height, and scapular width. Incremental growth and relative percent increase were examined among successive age groups as a proxy measure of growth velocity. Scapular body proportions were assessed with the scapular index and compared across age groups using a Kruskal-Wallis test with post-hoc tests. A third-order polynomial best describes growth in clavicle diaphyseal length and scapular height, and a second-order polynomial best describes growth in scapular width. Growth velocity patterns are similar among clavicle diaphyseal length, scapular height, and scapular width particularly from birth until the end of early childhood. Clavicle diaphyseal length decelerates during middle childhood while scapular height and width accelerate during this time. With increasing age, the scapular body proportionately increases more in height than in width. The relatively narrow scapular body characteristic of adult scapulae is first evident during early childhood. Changes in scapular body shape during ontogeny may be a reflection of the greater alterations taking place in the integrated morphology of the pectoral girdle during the biomechanical shift from crawling to bipedalism. Am. J. Hum. Biol. 28:636-645, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  8. The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

    International Nuclear Information System (INIS)

    Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan

    2013-01-01

    Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques

  9. SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-04-01

    The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

  10. A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta

    OpenAIRE

    Carvalho, Marieta

    2014-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...

  11. Johns Hopkins Particulate Matter Research Center

    Data.gov (United States)

    Federal Laboratory Consortium — The Johns Hopkins Particulate Matter Research Center will map health risks of PM across the US based on analyses of national databases on air pollution, mortality,...

  12. 2008 St. Johns County, FL Countywide Lidar

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Airborne terrestrial LiDAR was collected for St. Johns County, FL. System Parameters/Flight Plan. The LiDAR system acquisition parameters were developed based on a...

  13. John Dewey--Philosopher and Educational Reformer

    Science.gov (United States)

    Talebi, Kandan

    2015-01-01

    John Dewey was an American philosopher and educator, founder of the philosophical movement known as pragmatism, a pioneer in functional psychology, and a leader of the progressive movement in education in the United States.

  14. Vähesed head portfellihaldurid / John Mauldin

    Index Scriptorium Estoniae

    Mauldin, John

    2005-01-01

    USA investeerimisnõustaja olulisematest põhimõtetest ja -reeglitest portfellihaldurite valikul. Investeerimissüsteemi analüüsist, minevikutootluse väheolulisusest ja fondimaailmas ellujäämisvõimalustest. Vt. samas: John Maudlin

  15. John Bell and the Identical Twins

    CERN Multimedia

    1984-01-01

    A biographical profile of John S.Bell is presented based on extensive interviews the author had with Bell. Bell’s vierws on the quantum theory are presented along with a simple explanation of his idenity.

  16. Translating The Infinities by John Banville

    OpenAIRE

    Irene Abigail Piccinini

    2015-01-01

    Abstract - John Banville’s talent as a prose stylist is widely recognized. The polished elegance of his phrases constitutes a continuing and fascinating challenge for his translator, due to the intricacies of the source text, its manifold registers and lexical choices. In his novel The Infinities, in Italian Teoria degli Infiniti, John Banville takes cue from Kleist’s Amphytrion to devise a novel where classicality interweaves with science and science fiction through the invention of a world ...

  17. Would John Stuart Mill have regulated pornography?

    OpenAIRE

    McGlynn, C.; Ward, I.

    2014-01-01

    John Stuart Mill dominates contemporary pornography debates where he is routinely invoked as an authoritative defence against regulation. This article, by contrast, argues that a broader understanding of Mill's ethical liberalism, his utilitarianism, and his feminism casts doubt over such an assumption. New insights into Mill's approach to sex, sexual activity, and the regulation of prostitution reveal an altogether more nuanced and activist approach. We conclude that John Stuart Mill would a...

  18. Obituary: John W. Firor (1927-2007)

    Science.gov (United States)

    Gilman, Peter A.

    2009-12-01

    John W. Firor, a former Director of the High Altitude Observatory and the National Center for Atmospheric Research, and a founder of the Solar Physics Division of the American Astronomical Society, died of Alzheimer's disease in Pullman, Washington on November 5, 2007, he was 80. He was born in Athens Georgia on October 18, 1927, where his father was a professor of agricultural economics. John had an unusually diverse scientific career. His interest in physics and astrophysics began while serving in the army, during which time he was assigned to the Los Alamos National Laboratory, where he guarded highly radioactive materials (many have heard him describe how informal the protections were compared to later times). After his service he returned to college and graduated in physics from Georgia Tech in 1949. He received his Ph.D. from the University of Chicago in 1954, writing his thesis on cosmic rays under John Simpson. John Firor would later remark that: "If you needed cosmic rays to actually do anything, you are sunk." That thought, partly in jest, may help explain his motivation for moving to so many new scientific and management pursuits. John moved from cosmic ray physics to radio astronomy (particularly of the Sun) when he began work at the Carnegie Institution of Washington's Department of Terrestrial Magnetism, where he remained until 1961. During this time, he met Walter Orr Roberts, then the Director of the High Altitude Observatory (HAO) in Boulder, Colorado. HAO was then affiliated with the University of Colorado. In 1959, a movement began to upgrade the atmospheric sciences in the United States by establishing a National Center, where the largest, most important atmospheric research problems could be addressed. Roberts became the first Director of NCAR, as well as the first president of the University Corporation for Atmospheric Research (UCAR), the consortium of universities that was commissioned to manage and staff the new Center. HAO became a

  19. Revisiting fracture gradient: Comments on “A new approaching method to estimate fracture gradient by correcting Matthew–Kelly and Eaton's stress ratio”

    KAUST Repository

    Hakiki, Farizal

    2017-07-25

    A study performed by Marbun et al. [1] claimed that “A new methodology to predict fracture pressure from former calculations, Matthew–Kelly and Eaton are proposed.” Also, Marbun et al.\\'s paper stated that “A new value of Poisson\\'s and a stress ratio of the formation were generated and the accuracy of fracture gradient was improved.” We found those all statements are incorrect and some misleading concepts are revealed. An attempt to expose the method of fracture gradient determination from industry practice also appears to solidify that our arguments are acceptable to against improper Marbun et al.\\'s claims.

  20. Obituary: John Louis Perdrix, 1926-2005

    Science.gov (United States)

    Orchiston, D. Wayne

    2006-12-01

    John Perdrix, astronomical historian and co-founder of the Journal of Astronomical History and Heritage, died on 27 June 2005. John Louis Perdrix was born in Adelaide, Australia, on 30 June 1926. After studying chemistry at Melbourne Technical College and working in industry, he joined the Commonwealth Scientific and Industrial Research Organisation's Division of Minerals and Geochemistry. In 1974 the Division relocated to the Western Australian capital, Perth, and John spent the rest of his working life there involved in geochemical research. From his teenage years John had a passion for astronomy, which he fine-tuned through the Astronomical Society of Victoria and the Victorian Branch of the British Astronomical Association. He was very active in both groups, serving as President of the former and Secretary/Treasurer of the latter. He was also an FRAS, and a member of the AAS, the BAA parent body, and the IAU (Commission 41)?no mean feat for an Australian amateur astronomer. Throughout his life, he was a strong advocate of close amateur-professional relations. John's main research interest was history of astronomy, and over the years he wrote a succession of research papers, mainly about aspects of Australian astronomy. His well-researched and neatly-illustrated papers on the Melbourne Observatory and the Great Melbourne Telescope are classics, and when the Observatory's future was in the balance they played a key role in the State Government's decision to convert this unique facility into a museum precinct. To support his research activities, John built up an amazing library that developed its own distinctive personality and quickly took over his house and garage before invading commercial storage facilities! Apart from writing papers, John had an even greater passion for editing and publishing. From 1985 to 1997 he produced the Australian Journal of Astronomy, and in 1998 this was replaced by the Journal of Astronomical History and Heritage (JAH2). Both

  1. Developing a programmatic approach to investigating and remediating many unrelated comprehensive environmental response, compensation, and liability act sites at Kelly Air Force Base

    International Nuclear Information System (INIS)

    Kamp, G.; Regan, P.; Ninesteel, R.; Martin, R.

    1988-01-01

    Kelly Air Force Base (AFB), which was founded in 1917, is involved in logistics and maintenance activities supporting the Air Logistics Command. In addition, Kelly AFB hosts over 50 tenant organizations representing the Air Force, Department of Defense, and other government agencies. Over the years waste disposal from this complex was conducted in a manner that led to the identification of over 30 sites to be included in the Installation Restoration Program (IRP) after the Phase 1 investigation. A methodology was needed to prioritize the Remedial Investigations and Feasibility Study (RI/FS) activities for the sites. A Strategy Plan was developed that involved reviewing and interpreting existing data, identifying data voids relative to site specific RI/FS activities, and developing methodology to prioritize activities. Sites were prioritized, and a comprehensive IRP planning document was developed. One data deficiency was revealed -- the lack of understanding of the Basewide hydrogeologic conditions necessary to establish an effective restoration program. A Hydrogeologic Investigation was initiated to provide this data. This data will allow better interpretation of the interaction of the sites, particularly those in close proximity, and improved planning of remediation activities

  2. Bathymetry (2011) for Fish Bay, St. John

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a LiDAR (Light Detection & Ranging) 0.3x0.3 meter resolution depth surface for Fish Bay, St. John in the U.S. Virgin Islands (USVI). The...

  3. The Bildungsroman in Cameroon Anglophone Literature: John ...

    African Journals Online (AJOL)

    This paper investigates the bildungsroman genre in postcolonial Cameroon Anglophone fiction through a textual analysis of John Nkemngong Nkengasong's Across the Mongolo and Margaret Afuh's Born before Her Time. It seeks to show that these two writers have borrowed a foreign genre and successfully manipulated ...

  4. Capitalism in Six Westerns by John Ford

    Science.gov (United States)

    Braun, Carlos Rodriguez

    2011-01-01

    The economic and institutional analysis of capitalism can be illustrated through John Ford's Westerns. This article focuses on six classics by Ford that show the move toward modern order, the creation of a new society, and the rule of law. Economic features are pervading, from property rights and contracts to markets, money, and trade. Ford has…

  5. John Dewey in the 21st Century

    Science.gov (United States)

    Williams, Morgan K.

    2017-01-01

    John Dewey was a pragmatist, progressivist, educator, philosopher, and social reformer (Gutek, 2014). Dewey's various roles greatly impacted education, and he was perhaps one of the most influential educational philosophers known to date (Theobald, 2009). Dewey's influence on education was evident in his theory about social learning; he believed…

  6. Preparing for Citizenship: Bring Back John Dewey

    Science.gov (United States)

    Pring, Richard

    2016-01-01

    The paper traces the development of citizenship in the curriculum in England since the 1960s, emerging particularly from the Crick report. It argues for lessons to be learnt from John Dewey's "Democracy and education", the centenary of which is being celebrated this year.

  7. We, John Dewey's Audience of Today

    Science.gov (United States)

    da Cunha, Marcus Vinicius

    2016-01-01

    This article suggests that John Dewey's "Democracy and Education" does not describe education in an existing society, but it conveys a utopia, in the sense coined by Mannheim: utopian thought aims at instigating actions towards the transformation of reality, intending to attain a better world in the future. Today's readers of Dewey (his…

  8. Jean Piaget's Debt to John Dewey

    Science.gov (United States)

    Tanner, Daniel

    2016-01-01

    Jean Piaget became a veritable institution unto himself in education and psychology, largely as the result of his developmental-stage theory advanced over the second quarter of the twentieth century. Not until Piaget was 73 did he make mention of John Dewey's work at Dewey's laboratory school, founded in 1894 at the University of Chicago. But here…

  9. John Deweys kritik af liberal education

    DEFF Research Database (Denmark)

    Huggler, Jørgen

    2017-01-01

    The paper deals with John Dewey's aversion against liberal education and his concern about a 'dual track' educational system separating liberal education and vocational education. It investigates the reason why Dewey maintains that the philosophical 'dualisms' culminate in the question on vocation....

  10. Astronaut John Glenn Enters Friendship 7

    Science.gov (United States)

    1962-01-01

    Astronaut John Glenn enters the Mercury spacecraft, Friendship 7, prior to the launch of MA-6 on February 20, 1961 and became the first American who orbited the Earth. The MA-6 mission was the first manned orbital flight boosted by the Mercury-Atlas vehicle, a modified Atlas ICBM (Intercontinental Ballistic Missile), lasted for five hours, and orbited the Earth three times.

  11. The Johns Hopkins Hospital: A Summer Internship

    OpenAIRE

    Smith, Adam

    2016-01-01

    Adam Smith, a native of Richmond, Indiana, is an advanced pharmacy practice student in the College of Pharmacy at Purdue University. In this article, he describes how career exploration through a summer internship with The Johns Hopkins Hospital in Baltimore, Maryland solidified his desire to pursue a career in pharmacy administration.

  12. John R. Commons: Pioneer in Labor Economics.

    Science.gov (United States)

    Barbash, Jack

    1989-01-01

    John R. Commons has contributed in one way or another to pratically every piece of social and labor legislation that has been enacted in the twentieth century. He has made his mark on such diverse aspects of American labor as apprenticeship, vocational education, workers' compensation, and the administration of labor law. (Author/JOW)

  13. John Maynard Smith (1920-2004)

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 11. John Maynard Smith (1920-2004) - “One of the last Grand Evolutionary Theorists of the 20th Century”. Vidyanand Nanjundiah. General Article Volume 10 Issue 11 November 2005 pp 70-78 ...

  14. In Memoriam: Dr. Frank John Fenner

    Centers for Disease Control (CDC) Podcasts

    This podcast reflects on one of the greatest pioneers in virology, Dr. Frank John Fenner. Dr. Frederick Murphy, a member of EID's editorial board and the Institute of Medicine, and professor of Pathology at the University of Texas Medical Branch in Galveston, shares professional and personal stories of Dr. Frank Fenner.

  15. Obituary: John Leroy Climenhaga, 1916-2008

    Science.gov (United States)

    Scarfe, Colin

    2009-01-01

    John Leroy Climenhaga was born on 7 November 1916 on a farm some 10 km from Delisle, a small town on the Canadian prairies, located about 50 km south-west of Saskatoon, Saskatchewan, and died at his home in Victoria, British Columbia, on 27 May 2008. His parents, Reuben and Elizabeth (nee Bert) Climenhaga, were farming folk, and he carried their honest and open attitude to the world throughout his life. John was the seventh born, and last to die, of their ten children. His father also served as an ordained minister of the Brethren in Christ. In early adulthood, John worked on his father's farm, but then attended the University of Saskatchewan, obtaining a B.A. with Honors in Mathematics and Physics and an M.A. in Physics, in 1945 and 1949 respectively. Between these events he worked as a Physics Instructor at Regina College from 1946 to 1948. In 1949 Climenhaga joined the faculty of Victoria College, as one of only two physicists in a small institution that was then part of the University of British Columbia. He remained in Victoria for the rest of his career, playing a major role in the College's growth into a full-fledged university, complete with thriving graduate programs in physics and astronomy as well as in many other fields. He served as Head of the Physics Department during the 1960s, a period which saw the College become the University of Victoria, with a full undergraduate program in Physics, and campaigned successfully for the establishment of a program in Astronomy, which began in 1965. From 1969 until 1972 he held the position of Dean of Arts and Science, and championed the university's participation in the Tri-University Meson Facility, whose high-current medium-energy beam was ideal for the production and study of mesons and their physics. That period was a turbulent one in the university's history, but John's integrity and his balanced and fair-minded approach to conflicts were of immeasurable importance in steering the young institution through it

  16. El último libro de John Strachey

    Directory of Open Access Journals (Sweden)

    Helcías Martán Góngora

    1965-08-01

    Full Text Available Fue muy largo el sendero ideológico que hubo de recorrer el inglés John Strachey en la busqueda íntima de una respuesta a su inquirir constante. En su viaje interior escuchó, a la siniestra, también la voz de las sirenas socialistas.

  17. John Smith - eesti kunstnik / Ants Juske

    Index Scriptorium Estoniae

    Juske, Ants, 1956-2016

    2006-01-01

    Marko Mäetamme ja Kaido Ole kollektiivsest loomingust, mida esitatakse John Smithi autorinime all, mõnda ka salapärase J. Smithi nn. biograafiast. Illustratsiooniks J. Smith'i "Jumalate maailm I (fragment). Õli, lõuend, 2002. Erakogu

  18. John Dewey on Philosophy and Childhood

    Science.gov (United States)

    Gregory, Maughn; Granger, David

    2012-01-01

    John Dewey was not a philosopher of education in the now-traditional sense of a doctor of philosophy who examines educational ends, means, and controversies through the disciplinary lenses of epistemology, ethics, and political theory, or of agenda-driven schools such as existentialism, feminism, and critical theory. Rather, Dewey was both an…

  19. Bathymetry (2011) for Coral Bay, St. John

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a LiDAR (Light Detection & Ranging) 0.3x0.3 meter resolution depth surface for Coral Bay, St. John in the U.S. Virgin Islands (USVI). The...

  20. Obituary: John J. Hillman, 1938-2006

    Science.gov (United States)

    Chanover, Nancy

    2007-12-01

    John J. Hillman, a dedicated NASA civil servant, spectroscopist, astrophysicist, planetary scientist, and mentor, died on February 12, 2006 of ocular melanoma at his home in Columbia, Maryland. His professional and personal interests were wide-reaching and varied, and he devoted his career to the advancement of our understanding of the beauty and wonder in the world around us. His love of nature, art, and science made him a true Renaissance man. John was born in Fort Jay, New York, on November 22, 1938, and was raised in Washington, D.C. He received his B.S., M.S., and Ph.D. degrees in Physics from American University in 1967, 1970, and 1975, respectively. He began working at NASA's Goddard Space Flight Center, then in its infancy, in 1969, juggling a full-time position as a Research Physicist, the completion of his M.S. and Ph.D. degrees, and a young family. His background in molecular spectroscopy enabled him to apply his skills to numerous disciplines within NASA: infrared and radio astronomy; electronic, vibrational, and rotational structure of interstellar molecules; solar and stellar atmospheres; and planetary atmospheres. He published more than 70 journal papers in these disciplines. He was a frequent contributor to the Ohio State University International Symposium on Molecular Spectroscopy, and possessed a rare ability to bridge the gap between laboratory and remote sensing spectroscopy, bringing scientists from different disciplines together to understand our Universe. The last fifteen years of John's career were devoted to the development of acousto-optic tunable filter (AOTF) cameras. He championed this technology as a low-cost, low-power alternative to traditional imaging cameras for in situ or remotely sensed planetary exploration. It was within this context that I got to know John, and eventually worked closely with him on the demonstration and application of this technology for planetary science using ground-based telescopes in New Mexico, California

  1. The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

    Directory of Open Access Journals (Sweden)

    John M Morrison

    2012-03-01

    Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.

  2. A New Reading of Shakespeare's King John.

    Science.gov (United States)

    Usher, Peter D.

    1995-12-01

    Shakespeare wrote King John c.1594, six years after the defeat of the Spanish Armada, and ~ 50 years after publication of the Copernican heliocentric hypothesis. It is said to be the most unhistorical of the History Plays, ``anomalous'', ``puzzling'', and ``odd'', and as such it has engendered far more than the customary range of interpretive opinion. I suggest that the play alerts Elizabethans not just to military and political threats, but to a changing cosmic world view, all especially threatening as they arise in Catholic countries. (a) Personification characterizes the play. John personifies the old order, while Arthur and the Dauphin's armies personify the new. I suggest that Shakespeare decenters King John just as Copernicus decentered the world. (b) Hubert menaces Arthur's eyes for a whole scene (4.1), but the need for such cruelty is not explained and is especially odd as Arthur is already under sentence of death (3.3.65-66). This hitherto unexplained anomaly suggests that the old order fears what the new might see. (c) Eleanor's confession is made only to Heaven and to her son the King (1.1.42-43), yet by echoing and word play the Messenger from France later reveals to John that he is privy to it (4.2.119-124). This circumstance has not been questioned heretofore. I suggest that the Messenger is like the wily Hermes (Mercury), chief communicator of the gods and patron of the sciences; by revealing that he moves in the highest circles, he tells John that he speaks with an authority that transcends even that of a king. The message from on high presages more than political change; it warns of a new cosmic and religious world order (d) Most agree that John is a weak king, so Shakespeare must have suspected flaws in the old ways. He would have known that Tycho Brahe's new star of 1572, the comet of 1577, and the 1576 model of his compatriot Thomas Digges, were shattering old ideas. (e) The tensions of the play are not resolved because in 1594 the new order was

  3. Identification of new proton-rich rare earth nuclei by means of the coupled system helium jet-isotope separator of SARA

    International Nuclear Information System (INIS)

    Ollivier, T.

    1986-01-01

    In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr

  4. Análise SWOT global da exploração dos suínos da raça Bísara

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...

  5. John Holt Stanway: Gone to Texas

    Science.gov (United States)

    Bryan, J.

    2008-01-01

    John Holt Stanway (1799Ð1872) was an amateur astronomer who lived in Manchester, England until 1845. He was in contact with the English Ôgrand amateurÕ astronomer, William Henry Smyth, who supported him for Fellowship of the Royal Astronomical Society and evidently advised him on how to build and equip an observatory. Apparently, Stanway had an observatory at Chorlton-cum-Hardy in 1837. In 1845, Stanway left for the United States in response to serious business problems. En route, he met Ashbel Smith, a representative of the government of the Republic of Texas, who convinced Stanway to go to Texas. There he changed his name to John H. Smythe Stanley and settled in Houston, where he re-established his observatory. He became a commercial photographer and wrote about astronomy and other scientific subjects in Houston newspapers until his death in 1872.

  6. In Memoriam: Dr. Frank John Fenner

    Centers for Disease Control (CDC) Podcasts

    2011-04-22

    This podcast reflects on one of the greatest pioneers in virology, Dr. Frank John Fenner. Dr. Frederick Murphy, a member of EID's editorial board and the Institute of Medicine, and professor of Pathology at the University of Texas Medical Branch in Galveston, shares professional and personal stories of Dr. Frank Fenner.  Created: 4/22/2011 by National Center for Emerging Zoonotic and Infectious Diseases (NCEZID).   Date Released: 4/26/2011.

  7. 65 Year Birthday Celebration's Prof. John Ellis.

    CERN Multimedia

    Benoit Jeannet

    2011-01-01

    On 13 September, physicists from around the world joined John Ellis at a colloquium to celebrate his 65th birthday, and as he ended his long career as a distinguished CERN staff member and joins King’s College London. Here he is in the audience with fellow theorists, Nobel laureate Gerard ’t Hooft and Chris Llewellyn Smith, former director-general of CERN.

  8. John Dewey's Visits to Hawai'i

    Science.gov (United States)

    McEwan, Hunter

    2015-01-01

    John Dewey visited Hawai'i on three separate occasions. Of all three trips, by far the most important, as far as Dewey's influence on education in Hawai'i is concerned, was in 1899 when he came with his wife, Alice Chipman Dewey, to help launch the University Extension program in Honolulu. The Deweys' second trip was a very brief one--twenty years…

  9. Historical Footage of John Glenn Friendship 7

    Science.gov (United States)

    1962-01-01

    The Friendship mission launch on the 20th day of February marked the first time that an American attempts to orbit the Earth. Historical footage of John Glenn's suit up, ride out to the launch pad, countdown, liftoff, booster engine cutoff, and separation of the booster engine escape tower is shown. Views of the Earth, Glenn's manual control of the electrical fly-by wire system, and the recovery of the landing vehicle from the ocean are presented.

  10. Book in three volumes of dr. John Puricha: Theology and pedagogy of St. John Chrysostom

    Directory of Open Access Journals (Sweden)

    Parlić-Božović Jasna Lj.

    2011-01-01

    Full Text Available Before the is latest work of Bishop Dr John Puric, by its importance, analytically decorated works, an impressive and voluminous number of facts happy including pedagogical Serbian public. Specifically, our pedagogical public is missing in this way displayed the Orthodox point of view of observation pedagogical crown and top categories. Episkom John was the there / volume work attempted to provide the interested reader the personality profile of any precise data from the conception of St. John Crisostom by looking at the same time as its pedagogy, and theology. Moreover these two concepts and bringing them to their assence, John episcope them actually connects into one inseparable unity. Therefore, this work has a multiple value and importance esportance especially for educators, who have not tried or had the oppotunality to see and understand the pedagogy of Orthodox theology in general, decorated with the ideas of Saint John Chrysostom special. Mindfullpeace as heir and successor creative Cappadocia 'novonikejske' trijadologije, St. John Chrystom recognizes the statut of Divine pedagogy educational philanthropy and philanthropic saving of pedagogy in each of the three Divine Persons. God the Father is this part, written by Bishop John, and from the perspective of John Chrysostom, is uncreated and unborn educationak philanthropy source of grace of the Holy Trinity. God the Son, and of the Father, uncreated etrinilly born, only begotten Son of God, newborn Logos, Jesus Christ the God/ man, BewAdam is alive and saving, hypostatic Ikonomija God, great mystery of the faith- God is reported in the body, the Divine Krishna- resurrect pedagogy, in which the comic-eschatologiocal Body, Church of Heaven and Earth, The Secret New Substances contain - the salvation of all creation, all creatures animate and inanimate. The salvation of man and the world, in the Divine dispensation and the pedagogy of salvation invation involve all there persons of the Holy

  11. Obituary: John Daniel Kraus, 1910-2004

    Science.gov (United States)

    Kraus, John D., Jr.; Marhefka, Ronald J.

    2005-12-01

    John Daniel Kraus, 94, of Delaware, Ohio, director of the Ohio State University "Big Ear" Radio Observatory, physicist, inventor, and environmentalist died 18 July 2004 at his home in Delaware, Ohio. He was born on 28 June 1910 in Ann Arbor, Michigan. He received a Bachelor of Science in 1930, a Master of Science in 1931, and a PhD in physics in 1933 (at 23 years of age), all from the University of Michigan, Ann Arbor. During the 1930s at Michigan, he was involved in physics projects, antenna consulting, and in atomic-particle-accelerator research using the University of Michigan's premier cyclotron. Throughout the late 1920s and the 1930s, John was an avid radio amateur with call sign W8JK. He was back on the air in the 1970s. In 2001 the amateur radio magazine CQ named him to the inaugural class of its Amateur Radio Hall of Fame. He developed many widely used innovative antennas. The "8JK closely spaced array" and the "corner reflector" were among his early designs. Edwin H. Armstrong wrote John in July 1941 indicating in part, "I have read with interest your article in the Proceedings of the Institute on the corner reflector...Please let me congratulate you on a very fine piece of work." Perhaps John's most famous invention, and a product of his intuitive reasoning process, is the helical antenna, widely used in space communications, on global positioning satellites, and for other applications. During World War II, John was in Washington, DC as a civilian scientist with the U.S. Navy responsible for "degaussing" the electromagnetic fields of steel ships to make them safe from magnetic mines. He also worked on radar countermeasures at Harvard University's Radio Research Laboratory. He received the U.S. Navy Meritorious Civilian Service Award for his war work. In 1946 he took a faculty position at Ohio State University, becoming professor in 1949, and retiring in 1980 as McDougal Professor Emeritus of Electrical Engineering and Astronomy. Even so, he never retired

  12. John Paul College: The Professional Renewal Journey

    Directory of Open Access Journals (Sweden)

    Pauline Mundie

    2014-09-01

    Full Text Available John Paul College, a K-12 School in Queensland, Australia, recognises the centrality of classroom teachers to the ongoing improvement of student outcomes. The college has implemented a multi-tiered professional renewal and assessment process. These changes of emphasis are the result of significant research and subsequent/associated professional discussion and were supported during the EBA decision-making in 2012. The professional renewal process at John Paul College guides teachers through a cycle of goal setting (related to any aspect of teacher practice which aims to improve student learning and achievement; ongoing discussion between the teacher and a mentor which determines actions; directed classroom observations (3 per term and associated pre and post reflection/discussion; leading to application of changed practice toward achieving the criteria of the goals. The principles of the professional renewal program are to:  enhance development along accepted school-wide, team and department goals;  encourage professional pedagogical reflections and conversations with a colleague/mentor;  motivate improved performance and highlight the next steps in a teacher’s development. Through the introduction of professional renewal, attestation and exemplary teacher processes, the leadership and teachers of John Paul College have achieved an appropriate and innovative balance between self-directed, peer supported/directed and college-wide, strategic initiatives. Each member of the teaching team, from graduate to senior leaders are actively engaged in personalised programs of professional growth which is specifically aimed at improved learning and outcomes of the college’s students.

  13. The John Zink Hamworthy combustion handbook

    CERN Document Server

    Baukal, Charles E

    2013-01-01

    Despite the length of time it has been around, its importance, and vast amounts of research, combustion is still far from being completely understood. Issues regarding the environment, cost, and fuel consumption add further complexity, particularly in the process and power generation industries. Dedicated to advancing the art and science of industrial combustion, The John Zink Hamworthy Combustion Handbook, Second Edition: Volume 3 - Applications offers comprehensive, up-to-date coverage of equipment used in the process and power generation industries. Under the leadership of Charles E. Baukal

  14. Suehiro Jurisprudence and John R. Commons

    DEFF Research Database (Denmark)

    Tackney, Charles T.

    This is a comparative history study at the interface of industrial / employment relations and stakeholder theory. The focus concerns decades of post-World War II Japanese and U.S. path dependent national divergence from common labor legislation enactments separated by only 15 years: 1933...... or Suehiro hōgaku) document a dramatic, fascinating historical parting of two nations due to Japanese deep appreciation of the labor law and institutional economics research legacy of John R. Commons, the father of U.S. industrial relations. Understanding this common, shared source opens industrial relations...

  15. Part Twelve. The Voyages of John Matthias

    OpenAIRE

    Printz-Påhlson, Göran

    2013-01-01

    In August 1974, when the Watergate scandal was moving into its last phase, the American poet John Matthias returned to his home, in South Bend, Indiana, after a year’s stay in England, traveling on the Polish ocean-liner Stefan Bathory. In June of 1976 he set out to sea again, this time on a Russian ship, the Mikhail Lermontov, in order to spend another year in England, as a Visiting Fellow in Poetry in Clare Hall, Cambridge. The voyages took approximately nine days each, and on both ships he...

  16. John Locke on persons and personal identity

    OpenAIRE

    Boeker, Ruth

    2013-01-01

    John Locke claims both that ‘person’ is a forensic term and that personal identity consists in sameness of consciousness. The aim of my dissertation is to explain and critically assess how Locke links his moral and legal account of personhood to his account of personal identity in terms of sameness of consciousness. My interpretation of Locke’s account of persons and personal identity is embedded in Locke’s sortal-dependent account of identity. Locke’s sortal-dependent ac...

  17. Remembering John M. Olson (1929-2017).

    Science.gov (United States)

    Blankenship, Robert E; Brune, Daniel C; Olson, Jon C

    2018-02-19

    Here we provide reflections of and a tribute to John M. Olson, a pioneering researcher in photosynthesis. We trace his career, which began at Wesleyan University and the University of Pennsylvania, and continued at Utrech in The Netherlands, Brookhaven National Laboratory, and Odense University in Denmark. He was the world expert on pigment organization in the green photosynthetic bacteria, and discovered and characterized the first chlorophyll-containing protein, which has come to be known as the Fenna-Matthews-Olson (FMO) protein. He also thought and wrote extensively on the origin and early evolution of photosynthesis. We include personal comments from Brian Matthews, Raymond Cox, Paolo Gerola, Beverly Pierson and Jon Olson.

  18. The Trieste Lecture of John Stewart Bell

    International Nuclear Information System (INIS)

    Bassi, Angelo; Ghirardi, GianCarlo

    2007-01-01

    Delivered at Trieste on the occasion of the 25th Anniversary of the International Centre for Theoretical Physics, 2 November 1989. The video of this lecture is available here. Please see the PDF for the transcript of the lecture. General remarks by Angelo Bassi and GianCarlo Ghirardi During the autumn of 1989 the International Centre for Theoretical Physics, Trieste, celebrated the 25th anniversary of its creation. Among the many prestigious speakers, who delivered extremely interesting lectures on that occasion, was the late John Stewart Bell. All lectures have been recorded on tape. We succeeded in getting a copy of John's lecture. In the lecture, many of the arguments that John had lucidly stressed in his writings appear once more, but there are also extremely interesting new remarks which, to our knowledge, have not been presented elsewhere. In particular he decided, as pointed out by the very choice of the title of his lecture, to call attention to the fact that the theory presents two types of difficulties, which Dirac classified as first and second class. The former are those connected with the so-called macro-objectification problem, the latter with the divergences characterizing relativistic quantum field theories. Bell describes the precise position of Dirac on these problems and he stresses appropriately how, contrary to Dirac's hopes, the steps which have led to a partial overcoming of the second class difficulties have not helped in any way whatsoever to overcome those of the first class. He then proceeds to analyse the origin and development of the Dynamical Reduction Program and draws attention to the problems that still affect it, in particular that of a consistent relativistic generalization. When the two meetings Are there quantum jumps? and On the present status of Quantum Mechanics were organized in Trieste and Losinj (Croatia), on 5-10 September 2005, it occurred to us that this lecture, which has never been published, might represent an

  19. MPI Enhancements in John the Ripper

    International Nuclear Information System (INIS)

    Sykes, Edward R; Lin, Michael; Skoczen, Wesley

    2010-01-01

    John the Ripper (JtR) is an open source software package commonly used by system administrators to enforce password policy. JtR is designed to attack (i.e., crack) passwords encrypted in a wide variety of commonly used formats. While parallel implementations of JtR exist, there are several limitations to them. This research reports on two distinct algorithms that enhance this password cracking tool using the Message Passing Interface. The first algorithm is a novel approach that uses numerous processors to crack one password by using an innovative approach to workload distribution. In this algorithm the candidate password is distributed to all participating processors and the word list is divided based on probability so that each processor has the same likelihood of cracking the password while eliminating overlapping operations. The second algorithm developed in this research involves dividing the passwords within a password file equally amongst available processors while ensuring load-balanced and fault-tolerant behavior. This paper describes John the Ripper, the design of these two algorithms and preliminary results. Given the same amount of time, the original JtR can crack 29 passwords, whereas our algorithms 1 and 2 can crack an additional 35 and 45 passwords respectively.

  20. MPI Enhancements in John the Ripper

    Science.gov (United States)

    Sykes, Edward R.; Lin, Michael; Skoczen, Wesley

    2010-11-01

    John the Ripper (JtR) is an open source software package commonly used by system administrators to enforce password policy. JtR is designed to attack (i.e., crack) passwords encrypted in a wide variety of commonly used formats. While parallel implementations of JtR exist, there are several limitations to them. This research reports on two distinct algorithms that enhance this password cracking tool using the Message Passing Interface. The first algorithm is a novel approach that uses numerous processors to crack one password by using an innovative approach to workload distribution. In this algorithm the candidate password is distributed to all participating processors and the word list is divided based on probability so that each processor has the same likelihood of cracking the password while eliminating overlapping operations. The second algorithm developed in this research involves dividing the passwords within a password file equally amongst available processors while ensuring load-balanced and fault-tolerant behavior. This paper describes John the Ripper, the design of these two algorithms and preliminary results. Given the same amount of time, the original JtR can crack 29 passwords, whereas our algorithms 1 and 2 can crack an additional 35 and 45 passwords respectively.

  1. The Trieste Lecture of John Stewart Bell

    Energy Technology Data Exchange (ETDEWEB)

    Bassi, Angelo; Ghirardi, GianCarlo

    2007-03-23

    Delivered at Trieste on the occasion of the 25th Anniversary of the International Centre for Theoretical Physics, 2 November 1989. The video of this lecture is available here. Please see the PDF for the transcript of the lecture. General remarks by Angelo Bassi and GianCarlo Ghirardi During the autumn of 1989 the International Centre for Theoretical Physics, Trieste, celebrated the 25th anniversary of its creation. Among the many prestigious speakers, who delivered extremely interesting lectures on that occasion, was the late John Stewart Bell. All lectures have been recorded on tape. We succeeded in getting a copy of John's lecture. In the lecture, many of the arguments that John had lucidly stressed in his writings appear once more, but there are also extremely interesting new remarks which, to our knowledge, have not been presented elsewhere. In particular he decided, as pointed out by the very choice of the title of his lecture, to call attention to the fact that the theory presents two types of difficulties, which Dirac classified as first and second class. The former are those connected with the so-called macro-objectification problem, the latter with the divergences characterizing relativistic quantum field theories. Bell describes the precise position of Dirac on these problems and he stresses appropriately how, contrary to Dirac's hopes, the steps which have led to a partial overcoming of the second class difficulties have not helped in any way whatsoever to overcome those of the first class. He then proceeds to analyse the origin and development of the Dynamical Reduction Program and draws attention to the problems that still affect it, in particular that of a consistent relativistic generalization. When the two meetings Are there quantum jumps? and On the present status of Quantum Mechanics were organized in Trieste and Losinj (Croatia), on 5-10 September 2005, it occurred to us that this lecture, which has never been published, might represent

  2. John Dewey’s Feminist Legacy

    Directory of Open Access Journals (Sweden)

    Marta Vaamonde Gamo

    2016-07-01

    Full Text Available This article demonstrates how feminism welcomed and was influenced by the pragmatism of John Dewey. While in real terms his impact on European feminism has been minimal, this was not the case in contemporary America. In this article we study both how Dewey’s ideas were received amongst American feminists, as well as certain aspects of his thinking that could be enormously useful in present-day debates between critical and postmodern feminists. We compare the Deweyan and feminist arguments against the traditional dualisms that acted as philosophical support for social inequality, paying particular attention to mind–body dualism, and the consequent undervaluation of physical and emotional wellbeing. We also show that John Dewey’s proposals were, in fact, more radical than those of the feminists of the day. Indeed, democracy has to be understood as a way of life that affects every dimension of experience, and is crucial to the personal and social growth that enables the unjust social inequalities between men and women to be overcome.

  3. John Napier life, logarithms, and legacy

    CERN Document Server

    Havil, Julian

    2014-01-01

    John Napier (1550–1617) is celebrated today as the man who invented logarithms—an enormous intellectual achievement that would soon lead to the development of their mechanical equivalent in the slide rule: the two would serve humanity as the principal means of calculation until the mid-1970s. Yet, despite Napier’s pioneering efforts, his life and work have not attracted detailed modern scrutiny. John Napier is the first contemporary biography to take an in-depth look at the multiple facets of Napier’s story: his privileged position as the eighth Laird of Merchiston and the son of influential Scottish landowners; his reputation as a magician who dabbled in alchemy; his interest in agriculture; his involvement with a notorious outlaw; his staunch anti-Catholic beliefs; his interactions with such peers as Henry Briggs, Johannes Kepler, and Tycho Brahe; and, most notably, his estimable mathematical legacy. Julian Havil explores Napier’s original development of logarithms, the motivations for his approa...

  4. Translating The Infinities by John Banville

    Directory of Open Access Journals (Sweden)

    Irene Abigail Piccinini

    2015-12-01

    Full Text Available Abstract - John Banville’s talent as a prose stylist is widely recognized. The polished elegance of his phrases constitutes a continuing and fascinating challenge for his translator, due to the intricacies of the source text, its manifold registers and lexical choices. In his novel The Infinities, in Italian Teoria degli Infiniti, John Banville takes cue from Kleist’s Amphytrion to devise a novel where classicality interweaves with science and science fiction through the invention of a world where the ancient gods intermingle with the humans while waiting for the death of Adam Godley, a famous mathematician who explained how an infinity of worlds exist and interact with each other. To translate this book I had not only to work extensively on lexis and style, but also to do considerable research to render the many literary and non literary references. Some examples of these struggles with the source text during the translation process are given in the present paper. Riassunto - John Banville, autore irlandese noto per la sua prosa raffinata, scrive in una lingua che rappresenta una sfida continua e affascinante per chi lo traduce. La sua complessità stilistica, che sfrutta molteplici registri linguistici e si avvale di scelte lessicali cui spesso è arduo trovare un traducente italiano soddisfacente, costringe il traduttore a fare ricorso a tutte le sottigliezze del proprio mestiere per restituire quanto più possibile l’eleganza dell’originale nella propria lingua. Nel romanzo The Infinities, tradotto in italiano come Teoria degli infiniti (Guanda, Parma 2011, Banville prende spunto dall’Anfitrione di Kleist per costruire un romanzo che guarda alla classicità sconfinando in un misto di scienza e fantascienza con la concezione di un’infinità di mondi paralleli teorizzata dal matematico Adam Godley, il protagonista morente al cui capezzale si radunano uomini e antichi dei in attesa che il cerchio della vita e della morte si compia

  5. John Hejduk's Pursuit of an Architectural Ethos

    DEFF Research Database (Denmark)

    Søberg, Martin

    2012-01-01

    Reflected, artistic practices and design-based research are drastically expanding fields within architectural academia. However, the interest in uniting theory and practice is not entirely new. Just a few decades ago, before a ‘death of theory’ was proclaimed, questions of architectural epistemol......Reflected, artistic practices and design-based research are drastically expanding fields within architectural academia. However, the interest in uniting theory and practice is not entirely new. Just a few decades ago, before a ‘death of theory’ was proclaimed, questions of architectural...... epistemology, of the language(s) of architecture, were indeed of profound interest to the discipline. This essay returns to and examines the investigatory practices of John Hejduk in an attempt to identify a poetic method asserting difference through repetition and primarily grounded in the medium...

  6. John Lumley's Contributions to Turbulence Modeling

    Science.gov (United States)

    Pope, Stephen

    2015-11-01

    We recall the contributions that John Lumley made to turbulence modeling in the 1970s and 1980s. In these early days, computer power was feeble by today's standards, and eddy-viscosity models were prevalent in CFD. Lumley recognized, however, that second-moment closures represent the simplest level at which the physics of turbulent flows can reasonably be represented. This is especially true when the velocity field is coupled to scalar fields through buoyancy, as in the atmosphere and oceans. While Lumley was not the first to propose second-moment closures, he can be credited with establishing the rational approach to constructing such closures. This includes the application of various invariance principles and tensor representation theorems, imposing the constraints imposed by realizability, and of course appealing to experimental data in simple, canonical flows. These techniques are now well-accepted and have found application far beyond second-moment closures.

  7. John Stuart Mill's Philosophy of Persuasion

    Directory of Open Access Journals (Sweden)

    Helen Ruth McCabe

    2014-02-01

    Full Text Available In his youth, John Stuart Mill followed his father’s philosophy of persuasion but, in 1830, Mill adopted a new philosophy of persuasion, trying to lead people incrementally towards the truth from their original stand-points rather than engage them antagonistically. Understanding this change helps us understand apparent contradictions in Mill’s cannon, as he disguises some of his more radical ideas in order to bring his audience to re-assess and authentically change their opinions. It also suggests a way of re-assessing the relationship between Mill’s public and private works, to which we should look if we are attempting to understand his thought.

  8. El constitucionalismo según John Rawls

    Directory of Open Access Journals (Sweden)

    Roberto Gargarella

    2005-01-01

    Full Text Available El término “democracia” se encuentra completamente ausente del famoso libro de John Rawls, Teoría de la justicia. En Liberalismo político, en cambio, Rawls discute varios de los muchos temas sobre los que el concepto de democracia nos invita a reflexionar. En este escrito concentro mi atención en una de esas discusiones: la tensión entre constitucionalismo y democracia. Más específicamente, procuro examinar de qué modo Rawls trata de afirmar el doble compromiso que toda constitución quiere honrar, esto es, el compromiso con el ideal de la autonomía individual, y el compromiso con el ideal del auto-gobierno colectivo.

  9. What John Browne actually said at Stanford

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    In May 1997, the Chief Executive of BP, John Browne, delivered a speech on global climate change at Stanford University, California. A shortened version of the speech is presented. BP have accepted the possibility of a link between greenhouse gas emissions and climate change and are basing their policies on that acceptance. The company is committed to a step-by-step process, involving both action to develop solutions and continuing research to improve knowledge, that will balance the requirements of economic development and environmental protection. Five specific steps are outlined. These are: the monitoring and controlling of carbon dioxide emissions in all aspects of the company's operations increasing the level of support given to continuing scientific work on climate change; technology transfer and joint implementation with other parties to limit and reduce net emission levels; the development of alternative energy sources, in particular, solar power; contributing to the public policy debate in search of wider global answers to the problem. (Author)

  10. John Adams and CERN: Personal Recollections

    CERN Document Server

    Brianti, Giorgio

    2013-01-01

    By any standards, John Adams had a most remarkable career. He was involved in three important, emerging technologies, radar, particle accelerators and controlled fusion, and had an outstanding impact on the last two. Without a university education, he attained hierarchical positions of the highest level in prestigious national and international organizations. This article covers the CERN part of his career, by offering some personal insights into the different facets of his contributions to major accelerator projects, from the first strong-focusing synchrotron, the PS, to the SPS and its conversion to a proton–antiproton collider. In particular, it outlines his abilities as a leader of an international collaboration, which has served as an example for international initiatives in other disciplines.

  11. John B. Little Center Annual Symposium

    International Nuclear Information System (INIS)

    Demple, Bruce F.

    2007-01-01

    The Annual Symposium of the John B. Little Center for Radiation Sciences and Environmental Health at the Harvard School of Public Health seeks to educate radiobiologists and biomedical scientists in related areas on the leading research related to the effects of ionizing radiation and related environmental agents in biological systems. This effort seeks to further the training of individuals in this field, and to foment productive interactions and collaborations among scientists at Harvard and with other institutions. The Symposium attracts world-class scientists as speakers, and a broad cross-section of attendees from academic, government, and industrial research centers, as well as editorial staff from leading scientific publications. In order to maintain this quality, funding to support the travel and local expenses of invited speakers is sought, along with funds to allow use of appropriate conference facilities.

  12. General Relativity and John Archibald Wheeler

    CERN Document Server

    Ciufolini, Ignazio

    2010-01-01

    Observational and experimental data pertaining to gravity and cosmology are changing our view of the Universe. General relativity is a fundamental key for the understanding of these observations and its theory is undergoing a continuing enhancement of its intersection with observational and experimental data. These data include direct observations and experiments carried out in our solar system, among which there are direct gravitational wave astronomy, frame dragging and tests of gravitational theories from solar system and spacecraft observations. This book explores John Archibald Wheeler's seminal and enduring contributions in relativistic astrophysics and includes: the General Theory of Relativity and Wheeler's influence; recent developments in the confrontation of relativity with experiments; the theory describing gravitational radiation, and its detection in Earth-based and space-based interferometer detectors as well as in Earth-based bar detectors; the mathematical description of the initial value pro...

  13. John B. Little Center Annual Symposium

    Energy Technology Data Exchange (ETDEWEB)

    Demple, Bruce F.

    2007-11-02

    The Annual Symposium of the John B. Little Center for Radiation Sciences and Environmental Health at the Harvard School of Public Health seeks to educate radiobiologists and biomedical scientists in related areas on the leading research related to the effects of ionizing radiation and related environmental agents in biological systems. This effort seeks to further the training of individuals in this field, and to foment productive interactions and collaborations among scientists at Harvard and with other institutions. The Symposium attracts world-class scientists as speakers, and a broad cross-section of attendees from academic, government, and industrial research centers, as well as editorial staff from leading scientific publications. In order to maintain this quality, funding to support the travel and local expenses of invited speakers is sought, along with funds to allow use of appropriate conference facilities.

  14. John Dewey and early Chicago functionalism.

    Science.gov (United States)

    Backe, A

    2001-11-01

    John Dewey and James Angell are regarded respectively as the founder and systematizer of the Chicago school of functional psychology. The early Chicago school traditionally has been portrayed as a unified theoretical approach based primarily on William James's naturalist theory of mental processes. It is argued in this article that although the psychology systematized by Angell bore a close affinity to James's naturalism, Dewey's own psychology was based primarily on the neo-Hegelian philosophy of Thomas Hill Green. Through a review of a number of Dewey's major writings, Green's neo-Hegelian philosophy is shown to have influenced Dewey's views on psychological concepts such as reaction, emotion, and perception during the formative period of the Chicago school. The interpretation of Dewey's psychology developed in this article leads to the conclusion that early Chicago functionalism should not be regarded as a unified theoretical approach.

  15. John Locke and the right to resistance

    Directory of Open Access Journals (Sweden)

    Jovanov Ilija D.

    2015-01-01

    Full Text Available John Locke was a great thinker and many works have been devoted to clear up his theories. One of the most significant, stated in his principal work, Two Treatises of Government, is the theory of the right to resistance. It was a bit revolutionary then, and to a large extent it is today. Domination of legal positivism is negation of that, by Locke, natural right. However, the fact is that in recent times the resistance to the established power occurs in a number of countries and in different forms, so that the idea of the right to resistance becomes live question again. In this regard it is interesting to consider Locke's viewpoint on this important issue and to determine whether his theory on the resistance is applicable in modern societies.

  16. John Ruskin and the Savage Gothic

    Directory of Open Access Journals (Sweden)

    Frances S. Connelly

    2015-06-01

    Full Text Available John Ruskin’s provocative theories concerning Gothic art and architecture bear serious consideration in light of the formative debates concerning “primitive” art and its relation to modern European society. Like many primitivists, Ruskin’s advocacy for the medieval was motivated by a reformist zeal concerning the state of modern industrial Europe. He differs markedly in his ideas concerning the value and uses of the "savage” Gothic for modern audiences. Ruskin rejected the random borrowing of stylistic elements, stressing instead the artisanal process and the communal role of Gothic monuments. It is also significant that Ruskin problematises the relationship between “primitive” and modern by repeatedly acknowledging his position as a modern viewer and emphasising the process through which he makes (artisan-like his interpretive history of the Gothic. Rejecting the mastering gaze, Ruskin constantly reminds readers that their view of this pre-modern work is fragmentary and disjunctive.

  17. Caruso St John y Robert Smithson: Interferencias

    Directory of Open Access Journals (Sweden)

    Emilia Hernández Pezzi

    2016-05-01

    Full Text Available Resumen Los discursos cruzados son el soporte común del presente número de Cuadernos. El cruce que planteamos tiene como protagonistas al artista Robert Smithson y a los arquitectos Adam Caruso y Peter St John. Estos últimos hacen mención del trabajo del artista norteamericano para explicar su proyecto de remodelación de Stortorget, la plaza de la catedral en el centro de Kalmar, Suecia. A partir de aquí, comenzamos una exploración del trabajo y las preocupaciones de ambos que nos permite dibujar convergencias y sintonías procesuales por encima de las diferencias temáticas, ideológicas y estilísticas. Al disponer en paralelo la obra de Smithson y Caruso St John descubrimos vibraciones y resonancias que muestran una interacción productiva de sus preocupaciones. La materia se convierte en sus propuestas en un objeto activo y sensible, un depósito energético con el que operar. El traslado de piedras en Stortorget convoca la memoria de la ciudad del mismo modo que el basalto y la sal del Spiral Jetty, erosionados por el tiempo, nos hablan de procesos abiertos. El tiempo y la memoria pasan a ser soportes estratégicos con los que construyen sus miradas. Los objetos se disuelven en las relaciones que establecen con su entorno produciendo equilibrios frágiles e instantáneos. De esta manera el artículo pretende generar un vórtice de reflexión, una espiral en cuyo recorrido se manifiesten las tensiones parciales del cruce propuesto, sus fijezas momentáneas.

  18. Obituary: John Norris Bahcall, 1934-2005

    Science.gov (United States)

    Striker, Jeremiah P.; Bahcall, Neta A.

    2007-12-01

    John Norris Bahcall, one of the most creative and influential astrophysicists of his generation — a scientist who helped prove what makes the Sun shine and helped make the Hubble Space Telescope a reality — passed away in Pasadena, California, on 17 August 2005. Bahcall died peacefully in his sleep from a rare blood disorder. For the past 35 years, Bahcall was the Richard Black Professor of Natural Sciences at the Institute for Advanced Study in Princeton, New Jersey, where he created one of the leading astrophysics programs in the world. Active and working to the end, Bahcall said that he was always grateful for a full and happy life that exceeded his wildest expectations. Bahcall died as he lived, surrounded by the family he loved, embracing life to its fullest, happy, working and joking to the end. Bahcall's stellar career encompassed seminal contributions in numerous fields of astrophysics as well as extraordinary leadership on behalf of the scientific community, including the American Astronomical Society, the American Physical Society, the National Academy of Sciences, NASA, and Congress. Bahcall's contributions made him one of the scientific leaders of his time. He had been recognized by numerous awards including the 1998 National Medal of Science from President Clinton, the Gold Medal of the Royal Astronomical Society, the Medal of the Swedish Royal Academy, the Dan David Award, the Fermi Award, the first Hans Bethe Prize, the Franklin Medal, the Comstock Prize in physics, NASA's Exceptional Scientific Achievement Medal, NASA's Distinguished Public Service Medal, and the top awards of the American Astronomical Society — including the Russell Award, the Heineman Prize, and the Warner Prize. Bahcall was elected to the National Academy of Sciences in 1976 and to the American Philosophical Society in 2001. He was the recipient of Honorary Degrees from numerous universities around the world. Bahcall's scientific interests and expertise ranged from neutrino

  19. Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973

    Directory of Open Access Journals (Sweden)

    Guillermina Feudal

    2017-12-01

    Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.

  20. Breathing Silence. An interview with John Palmer

    Directory of Open Access Journals (Sweden)

    Cristina Scuderi

    2011-07-01

    Full Text Available The interview focuses on some aspects of the composer’s work with electronics. Palmer, described by the critics as «undoubtedly the most visionary composer of his generation» speaks about the composers and musical works that have had a major impact on him. He also mentions the friendship with John Cage, his numerous travels – with particular emphasis on Japan – and the influence of Eastern culture on his musical mind. The composer discusses the notion of causality explored in Renge-Kyo, the meditative nature of Transient and Inwards, and spirituality as the central theme of both acousmatic works In the Temple and I Am. The electronic medium is also por- trayed as a mirror of an intense and vivid preoccupation for intimacy and perpetual search for timbral qualities that by now characterize most of his music. Another important aspect of Palmer’s work mentioned in the interview is the collaboration with some established performers and its importance for the realization of a musical work.

  1. John Bardeen and the theory of superconductivity

    International Nuclear Information System (INIS)

    Schrieffer, J.R.

    1992-01-01

    Bardeen's knowledge of the experimental data had bounded the theory of superconductivity quite tightly before B, C and S developed their theory. When one speaks with John Bardeen's friends about him, one frequently hears words such as brilliant, quiet, persistent, generous, visionary, athletic, kind, thoughtful and remarkable. It is the author's good fortune to have the chance to recount some incidents from his life that are connected with the theory of superconductivity. This article draws on the author's personal memories; his many other friends and colleagues will set down their own recollections elsewhere. The evolution of the microscopic theory of superconductivity closely parallels the scientific life of Joh Bardeen. Starting with his PhD dissertation, done under the guidance of Eugene Wigner, he spent much of his life developing an understanding of electron interaction effects and transport properties of metals, semiconductors and superconductors. His fascination with the remarkable phenomenon of superconductivity goes back to his graduate student days at Princeton. Although interrupted during the war years and in the late 1940's at Bell Labs, he returned to this perplexing topic when he moved to the University of Illinois in 1951. 20 refs., 7 figs

  2. The life and works of John Napier

    CERN Document Server

    Rice, Brian; Corrigan, Alexander

    2017-01-01

    For the first time, all five of John Napier’s works have been brought together in English in a single volume, making them more accessible than ever before. His four mathematical works were originally published in Latin: two in his lifetime (1550–1617), one shortly after he died, and one over 200 years later. The authors have prepared three introductory chapters, one covering Napier himself, one his mathematical works, and one his religious work. The former has been prepared by one of Napier’s descendants and contains many new findings about Napier’s life to provide the most complete biography of this enigmatic character, whose reputation has previously been overshadowed by rumour and speculation. The latter has been written by an academic who was awarded a PhD for his thesis on Napier at the University of Edinburgh, and it provides the most lucid and coherent coverage available of this abstruse and little understood work. The chapter on Napier’s mathematical texts has been authored by an experienced...

  3. John Dique: dialysis pioneer and political advocate.

    Science.gov (United States)

    George, Charles R P

    2016-02-01

    John Dique (1915-1995) epitomized the internationalism of medicine, the intellectual and manual dexterity of many pioneers of dialysis, and the social concern evinced by many nephrologists. Born in Burma of French, German, British and Indian ancestry; educated in India; an Anglo-Indian who described himself as British without ever having visited Britain; he moved to Australia in 1948 to escape the murderous inter-ethnic conflict that befell multicultural India as it and Pakistan became independent. Settling in Brisbane, he pioneered several novel medical techniques. After inventing some simple equipment to facilitate intravenous therapy, he established a neonatal exchange blood transfusion programme. Then, between 1954 and 1963, he personally constructed and operated two haemodialysis machines with which to treat patients suffering from acute renal failure, the first such treatment performed in Australasia. His patients survival results were, for the era, remarkable. He subsequently helped found the Royal Australasian College of Pathologists and went on to establish a successful private pathology practice. The latter years of his life, however, saw him become a social and political advocate. He fiercely opposed the emerging ideologies of multiculturalism and social liberalism that, he predicted, would seriously damage the national fabric of Western society. Public vilification ensued, his medical achievements disregarded. It does seem likely, however, that in none of the areas that he touched - whether medical, social, or political - has the last word yet been said.

  4. John Stuart Mill on socialism and accountability

    Directory of Open Access Journals (Sweden)

    Francisco José Sales Rocha

    2010-01-01

    Full Text Available http://dx.doi.org/10.5007/1677-2954.2010v9n1p17 Este artigo mostra que o tipo de socialismo proposto por John Stuart Mill é marcado por uma forte preocupação com a controlabilidade do poder econômico e político. Ele rejeitou enfaticamente os modelos centralistas de socialismo por entender que eles levam a uma grande concentração de poder que compromete a liberdade. Para J. S. Mill, o socialismo deve ser implantado lentamente a partir de reformas amplamente discutidas que favoreçam a cidadania econômica dos trabalhadores, promovam a participação deles nas decisões referentes ao processo produtivo e em associações voluntárias. J. S. Mill acreditava que a competição econômica é essencial para o adequado funcionamento de uma economia socialista. Ele não esperava que tal economia se tornasse uma realidade em um futuro próximo.

  5. Open letter to Pope John Paul II.

    Science.gov (United States)

    Sai, F

    1991-01-01

    In an Open Letter to Pope John Paul II, written on World Population Day (July 11) 1991, Dr. Fred Sai, President of International Planned Parenthood Federation (IPPF), called for a dialogue on voluntary family planning as a means of avoiding unwanted pregnancy. A half million women die each year from pregnancy-related causes--a death toll that could be dramatically reduced by universal access to low cost, effective contraception. Family planning further represents the best protection against abortion. The Catholic Church's vehement opposition to abortion and family planning methods other than periodic abstinence is in marked contrast to its support to human rights in other settings. The Church has supported struggles for economic ju stice in and among nations, sided with the poor, and advocated for transitions to democracy. At the same time, the family planning movement--which has as its overall objective the protection of the health and welfare of women, children, and families--is viewed by the Vatican as a vehicle for the enslavement rather than liberation of women. The opening of a sensitive dialogue between the Catholic Church and supporters of voluntary family planning could help couples make sound moral decisions about their families and contribute to saving the lives of millions of women, most of them poor.

  6. Did John B. Watson Really "Found" Behaviorism?

    Science.gov (United States)

    Malone, John C

    2014-05-01

    Developments culminating in the nineteenth century, along with the predictable collapse of introspective psychology, meant that the rise of behavioral psychology was inevitable. In 1913, John B. Watson was an established scientist with impeccable credentials who acted as a strong and combative promoter of a natural science approach to psychology when just such an advocate was needed. He never claimed to have founded "behavior psychology" and, despite the acclaim and criticism attending his portrayal as the original behaviorist, he was more an exemplar of a movement than a founder. Many influential writers had already characterized psychology, including so-called mental activity, as behavior, offered many applications, and rejected metaphysical dualism. Among others, William Carpenter, Alexander Bain, and (early) Sigmund Freud held views compatible with twentieth-century behaviorism. Thus, though Watson was the first to argue specifically for psychology as a natural science, behaviorism in both theory and practice had clear roots long before 1913. If behaviorism really needs a "founder," Edward Thorndike might seem more deserving, because of his great influence and promotion of an objective psychology, but he was not a true behaviorist for several important reasons. Watson deserves the fame he has received, since he first made a strong case for a natural science (behaviorist) approach and, importantly, he made people pay attention to it.

  7. John Wheeler, 1933 - 1959: Particles and Weapons

    Science.gov (United States)

    Ford, Kenneth

    2009-05-01

    During the early part of his career, John Archibald Wheeler made an astonishing number of contributions to nuclear and particle physics, as well as to classical electrodynamics, often in collaboration with another physicist. He was also a major contributor to the Manhattan Project (in Chicago and Hanford rather than Los Alamos), and, following World War II, became an influential scientific cold warrior. His early achievements in physics include the calculated scattering of light by light (with Gregory Breit), the prediction of nuclear rotational states (with Edward Teller), the theory of fission (with Niels Bohr), action-at-a-distance electrodynamics (with Richard Feynman), the theory of positronium, the universal weak interaction (with Jayme Tiomno), and the proposed use of the muon as a nuclear probe particle. He gained modest fame as the person who identified xenon 135 as a reactor poison. His Project Matterhorn contributed significantly to the design of the H bomb, and his Project 137, which he had hoped would flower into a major defense lab, served as the precursor to the Jason group.

  8. PREFACE: John Desmond Bernal: Science and Society

    Science.gov (United States)

    Casey, Vincent

    2007-02-01

    This meeting, held in the Limerick Institute of Technology, on Thursday 1 June 2006, was organised by the Munster Group of the Institute of Physics in Ireland to commemorate the life and work of John Desmond Bernal. Bernal, was born in Nenagh in 1901. Alan Mackay, who worked with Bernal at Birkbeck College coins the word 'Polytropic' to describe Bernal. He was active and hugely influential in a wide range of areas such as science, politics and society, and was instrumental in the creation of whole new areas of intellectual endeavour such as the 'science of science', molecular biology, and operations research. Andrew Brown's analogy for Bernal's mind is that 'it was like a diamond—beautifully structured, multifaceted and dazzling to behold'. In relation to Bernal, Helena Sheehan states that: 'His legacy is complex. All the more so because he was marxist in philosophy, communist in politics, polyamorous in sexuality.'. Like religion, these are areas that conventional scientists tend to shy away from or at the very least consign to very separate and often neglected 'compartments'. According to Sheehan, 'Bernal came to marxism seriously and intelligently. He found in its philosophical framework a structure in which he could live, think, create, pursue science, act politically and develop further. It opened him radically to the world, rather than closing him down or constricting him, as critics imply.'. And his contributions to science and to society are significant and enduring. Just two areas of 'his science' were addressed in some detail at this meeting. Martin Caffrey treats the area of structural biology in the context of modern developments but focusing on Bernal's role in its evolution. John Finney gives an account of Bernal's 'two bouts of activity' on the structure of water and as Bernal's last PhD student he gives unique insights on how Bernal worked and why he 'did science'. Bernal writes in response to a well wisher on his 70th birthday: 'I am sure that

  9. From John Lee to John Gottman: Recognizing Intra- and Interpersonal Differences to Promote Marital Satisfaction

    Directory of Open Access Journals (Sweden)

    Claire Kimberly

    2013-10-01

    Full Text Available Since Extension agents work with a variety of families, there is a desperate need to further our understanding of how to educate diverse communities on a family-related topic. Focused on assisting those teaching marital education to a diverse population, this study attempts to understand how individual differences impact relationship satisfaction and marital communication. Based on John Gottman’s research on marital communication and John Lee’s six loves styles, 653 participants completed a survey to further understanding of the relationship between inter- and intrapersonal variables. Results revealed that marital communication and love styles accounted for 54.6% of the variance in marital satisfaction regardless of difference in demographics. Results of this study provide a resource for educators and practitioners to use with diverse clientele, while also emphasizing the need to understand both intra- and interpersonal variables when working with families.

  10. John Stuart Mill, John Rawls y Amartya Sen, los tres nombres de la equidad

    Directory of Open Access Journals (Sweden)

    María Teresa Lopera

    1997-07-01

    Full Text Available Tres autores como John Stuart Mill, John Rawls y Amartia Sen son objeto de análisis en este artículo que estudia el tema de la equidad en un contexto que se caracteriza por el abandono casi generalizado del estudio de los valores en relación a los grandes problemas económicos; el artículo defiende como necesaria la recuperación de las preocupaciones éticas en la ciencia económica. La segunda parte, presenta una bibliografía reciente presentada como respuesta a la obra de John Rawls a partir de 1985, cuando este autor da el llamado giro desde su teoría de la justicia como equidad hacia un reciente liberalismo político, período de gran interés para comprender las discusiones actuales de la filosofía política y el futuro de la discusión interdisciplinaria con la economía.

  11. La herencia igualitarista de John Rawls

    Directory of Open Access Journals (Sweden)

    Puyol González, Ángel

    2004-12-01

    Full Text Available One of the indisputable achievements of John Rawls work has been the revitalisation of the concept of equality in the ethics and political philosophy of the last few years. He has removed it from the monopoly of the ideologies that have had better or worse luck throughout the entire twentieth century and returned it to the analytical and conceptual rigor of philosophy. Moreover, he has done so with the added virtue of harmonising the value of equality with the values of freedom and efficiency, which is an effort that is not always valued with sufficient understanding. There is no doubt about the influence of Rawls theory of justice on current egalitarian thinking that, in some way, has been, and is still being, built -following -or diverging from the wake opened by the philosopher from Harvard. In this article, I analyse the main debates that are going on about Rawlsian egalitarianism and I point out some possible future orientation. In the first place, I set out the two great egalitarian arguments in Rawls work stemming, respectively, from a person's moral conception and the moral arbitrariness of the individual' s social and natural contingencies. Afterwards, I explore the problems of both arguments insisting, on one hand, on the inadequacy of the Kantian moral personality as a foundation for an egalitarian theory and, on the other hand, on the inconsistency of luck egalitarianism as an egalitarian extension of Rawls theory. In third place, I demonstrate that the main egalitarian problem in Rawls work comes from the concept of equality and equity void of solidarity. I conclude, finally, that justice as fairness should be contrasted with justice as fraternity.

    Uno de los logros indiscutibles de la obra de John Rawls ha sido la revitalización del concepto de igualdad en la ética y la filosofía política de los últimos años, desmonopolizándolo de las ideologías que han recorrido con mejor o peor fortuna todo el siglo xx y devolvi

  12. Lenguaje, realidad social y poder: John Searle

    Directory of Open Access Journals (Sweden)

    Nelson Jair Cuchumbé Holguín

    2012-01-01

    Full Text Available En el artículo se analiza cómo John Searle explica la instauración o la destrucción del poder convencional. El punto de partida es que la explicación de Searle se sustenta en la idea del poder convencional, entendido como un acontecimiento único que hace parte de la realidad social constituida por el lenguaje, lo cual permite expresar que cuando un acto de habla performativo es realizado en circunstancias apropiadas por un agente se sigue la imposición de la función de estatus al acontecimiento, la comprensión de la fuerza explicativa de las reglas constitutivas, la ejecución de poderes deónticos y la creación de un nuevo hecho institucional. No obstante, tal formulación deja por fuera la actitud de riesgo de los participantes en la creación o destrucción de los poderes que componen los hechos institucionales. Para demostrar este punto de partida, en primer lugar, se ubica el aporte filosófico de Searle sobre el lenguaje en términos de la perspectiva pragmática. En segundo lugar, se muestra que desde el lenguaje la intencionalidad colectiva impone funciones de estatus que crean formas de poderes deónticos. Para concluir, se afirma que el mantenimiento o la destrucción del poder convencional no se agota en las reglas constitutivas ni en las funciones de estatus, sino que se complementa con la actitud de riesgo desarrollarla por los participantes en el momento en que hacen uso del lenguaje. El análisis de la información recogida, mediante la reseña crítica, se realizó utilizando herramientas del enfoque metodológico reconstructivo conceptual.

  13. Case definition terminology for paratuberculosis (Johne's disease).

    Science.gov (United States)

    Whittington, R J; Begg, D J; de Silva, K; Purdie, A C; Dhand, N K; Plain, K M

    2017-11-09

    Paratuberculosis (Johne's disease) is an economically significant condition caused by Mycobacterium avium subsp. paratuberculosis. However, difficulties in diagnosis and classification of individual animals with the condition have hampered research and impeded efforts to halt its progressive spread in the global livestock industry. Descriptive terms applied to individual animals and herds such as exposed, infected, diseased, clinical, sub-clinical, infectious and resistant need to be defined so that they can be incorporated consistently into well-understood and reproducible case definitions. These allow for consistent classification of individuals in a population for the purposes of analysis based on accurate counts. The outputs might include the incidence of cases, frequency distributions of the number of cases by age class or more sophisticated analyses involving statistical comparisons of immune responses in vaccine development studies, or gene frequencies or expression data from cases and controls in genomic investigations. It is necessary to have agreed definitions in order to be able to make valid comparisons and meta-analyses of experiments conducted over time by a given researcher, in different laboratories, by different researchers, and in different countries. In this paper, terms are applied systematically in an hierarchical flow chart to enable classification of individual animals. We propose descriptive terms for different stages in the pathogenesis of paratuberculosis to enable their use in different types of studies and to enable an independent assessment of the extent to which accepted definitions for stages of disease have been applied consistently in any given study. This will assist in the general interpretation of data between studies, and will facilitate future meta-analyses.

  14. Aculturación y diferencias en las creencias irracionales sobre el rol femenino tradicional (O'Kelly Women Beliefs Scale en mujeres colombianas residentes en su país de origen y en Estados Unidos

    Directory of Open Access Journals (Sweden)

    LEONOR LEGA

    2009-01-01

    Full Text Available La Escala de Creencias de las Mujeres de O'Kelly (O'Kelly Women Beliefs Scale., O'Kelly, en prensa; Ellis, 1958 fue aplicada a colombianas residentes en Cali, Colombia, colombianas residentes en el noreste de los Estados Unidos y sus contrapartes estadounidenses (20 madres y 20 hijas mayores de 17" años en cada grupo. Se encontró que existen diferencias transcultu- rales en los puntajes totales de los tres grupos. Comparaciones posthoc (LSD indicaron que las diferencias significativas seencuentran en las hijas colombianas residentes en Estados Unidos, comparadas con las madres colombianas residentes en Colombia y las madres e hijas estadounidenses. No existen diferencias entre madres e hijas colombianas residentes en Estados Unidos. Los resultados sugieren que el patrón de aculturación de los colombianos en los Estados Unidos es el de asimilación al país de adopción conservando aspectos de la tradición y la cultura del país de origen.

  15. Acoustic development of a neonatal beluga whale (Delphinapterus leucas) at the John G. Shedd Aquarium

    Science.gov (United States)

    Carneiro, Brooke Elizabeth

    the same adult beluga whales recorded by Melissa Kelly (2009) at the John G. Shedd Aquarium in 2008. The first recorded sound produced by the calf was a low frequency, pulsed signal which was extremely weak in amplitude and almost seven times lower in frequency compared to similar sounds from a male beluga calf born at the Vancouver Aquarium in 2002. As he grew, the calf steadily increased the complexity and adult-like characteristics in all sound types. He decreased the peak frequency of tones, but increased the peak frequency of noise and noise with tones sounds. Using analysis of variance, sounds produced during the younger age class (0 to 6 months) were significantly longer in duration than during the older age class (6 to 12 months). There was no statistical difference in peak frequency of tones or tones with noise between the two age groups. The peak frequencies of both tones and tones with noise were significantly higher during agonistic contexts compared to non-agonistic contexts. Finally, the age at which the calf was first recorded using echolocation was at about five months. Future studies on the underwater acoustic behavior of beluga whale calves are necessary to identify developmental milestones in their repertoire.

  16. Obituary: Michael John Klein, 1940-2005

    Science.gov (United States)

    Gulkis, Samuel

    2006-12-01

    Michael John Klein died on 14 May 2005 at home in South Pasadena, California. The cause of death was tongue cancer that metastasized to the lungs. He was a non-smoker. Mike was a passionate radio astronomer, a trusted astronomical observer, an educator and a family man. Mike was born on 19 January 1940 in Ames, Iowa, the son of Florence Marie (Graf) and Fred Michael Klein. His mother was a homemaker, and his father was a banker. Mike had two older sisters, Lois Jean (Klein) Flauher and Marilyn June (Klein) Griffin. In 1962, Mike married his high school sweetheart Barbara Dahlberg, who survives him along with their three children, Kristin Marie (Klein) Shields, Michael John Klein Jr., Timothy Joel Klein, and six grandchildren. Mike developed a love for astronomy early in his life, and credited an early morning, newspaper-delivery route that he had at age twelve, which took him outside well before sunrise. He told family members that as he walked along his route, he stared into the sky and wondered what everything was. He studied sky charts, located stars, and began to understand how the planets shifted their positions relative to the stars each day. Another big influence in Mike's life was his brother in-law, Jim Griffin. Jim helped Mike understand that his passion for science did not have to remain a hobby, but could and should become a career. Jim's encouragement led Mike to attend Iowa State University in Ames, where he earned a BS in electrical engineering in 1962. Mike then started graduate school in electrical engineering at Michigan State, but after one semester transferred to the University of Michigan, Ann Arbor, where he earned an MS (1966) and PhD (1968) in astronomy. His doctoral dissertation, under the direction of Professor Fred Haddock, was based on extensive observations of the planets and examined the physical and thermal properties of planetary atmospheres and surfaces. Mike was awarded a Resident Research Associate position at JPL by the National

  17. Obituary: Michael John Seaton, 1923-2007

    Science.gov (United States)

    Pradhan, Anil; Nahar, Sultana

    2007-12-01

    Professor Michael John Seaton, hailed as the "Father of Atomic Astrophysics," passed away on May 29, 2007. He was one of the few Honorary Fellows of both the American Astronomical Society and the American Physical Society, so honored for his monumental contributions to both physics and astronomy. Mike Seaton was born on January 16, 1923 in Bristol, England. He attended Wallington County High School. But his leftist political activities, even at that stage, led to his expulsion, though he was eventually allowed to matriculate. He enlisted in the Royal Air Force as a navigator during the Second World War, and flew many dangerous missions. His legendary concentration and precision are reflected in the following anecdote. Once after a bombing mission his aircraft was lost in fog over the Alps. Seaton calculated the position and coordinates in flight to guide the aircraft. When the fog lifted, the crew found themselves flying perilously close to the mountains, but made it safely back. His associates often said, "A Seaton calculation is carried out as if his life depended on it." After the War he was admitted to University College London (UCL) as an undergraduate. Thereafter, he spent all of his professional career at UCL. Seaton received his Batchelor's degree in 1948, and his Ph.D. in 1951. His tenure at UCL coincided with the golden age of atomic astrophysics, for he was largely responsible for it. Seaton was elected Fellow of the Royal Society in 1967, and as President of the Royal Astronomical Society (RAS) in 1978. He was the recipient of an Honorary Doctorate from the Observatoire de Paris, an Honorary D.Sc. from the Queen's University of Belfast, the Gold Medal for Astronomy by the RAS, the Guthrie Medal by the Institute of Physics, the Royal Society Hughes award for lifetime work by the RAS, and several other prestigious awards. Nevertheless, as Alex Dalgarno recently remarked, Seaton was not part of the establishment because he chose not to be. Though rooted in

  18. John Calvin and John Locke on the Sensus Divinitatis and Innatism

    Directory of Open Access Journals (Sweden)

    J. Caleb Clanton

    2017-02-01

    Full Text Available Inheritors of the Calvinist Reformed tradition have long disagreed about whether knowledge of God’s nature and existence can be or need be acquired inferentially by means of the standard arguments of natural theology. Nonetheless, they have traditionally coalesced around the thought that some sense or awareness of God is naturally implanted or innate in human beings. A root of this orientation can be found in John Calvin’s discussion of the sensus divinitatis in the first book of The Institutes of the Christian Religion. This paper outlines a pedagogical strategy for organizing and evaluating Calvin’s treatment of the sensus divinitatis, chiefly by putting it in tension with John Locke’s polemic against innatism in Book I of An Essay concerning Human Understanding. I begin by reconstructing Calvin’s depiction of the sensus divinitatis, as well as his case for thinking that it is innate. I then explain how Locke’s critique of innatism offers a fairly direct response to Calvin and, hence, a useful framework for exploring the limits of Calvin’s treatment of the sensus divinitatis.

  19. NEWS: John Goronwy Jones (1920-1999)

    Science.gov (United States)

    Jennison, Brenda M.

    2000-05-01

    John Goronwy Jones Gron Jones, as he was known to all, was a champion of Physics Education and his death, shortly before his eightieth birthday, robbed physics teachers of a colleague who fought many battles on their behalf. He was not shy of taking issue with anyone in authority who might be putting forward policies which would harm his great love: Physics Education and Physics Teaching. His photograph shows a man with an impish grin, looking friend and foe alike straight in the eye, before delivering the death blow to an argument which was founded on less than common sense. At other times he would listen patiently to the woes of colleagues before offering them fatherly/grandfatherly advice so that whoever was on the receiving end would go away feeling better for the encounter. Gron was born in Swansea and educated at Lewis Boys Grammar School in Glamorgan before entering University College Cardiff first of all as a mathematician before graduating in Physics in 1941. After his war service in the RAF, working on signals and radar development, he returned to do an MSc in X-ray crystallography before completing a PGCE in Bristol. What then passed for teacher training in all institutions left him wary of returning to train teachers himself but after 14 years spent teaching physics in three schools he returned to Cardiff and began a 25 year career in teacher training. He and his two colleagues, Clifford Othen (chemistry) and Douglas Hillier (biology) built up the Cardiff Science Centre as a focus for initial and in-service science teacher training in South Wales. The triumvirate was well known and a power to be reckoned with. They created links between the University Science Departments and the Schools. Gron knew the local schools and their physics teachers intimately. Cardiff became a focus for science education both nationally and internationally. He was a frequent attender at both ICPE (International Commission for Physics Education) and GIREP (International Physics

  20. Tribes of Men: John Joseph Mathews and Indian Internationalism

    Science.gov (United States)

    Lutenski, Emily

    2012-01-01

    In this article, the author discusses John Joseph Mathews and Indian internationalism. As an old man, Osage intellectual, writer, and historian, John Joseph Mathews recalled his expatriation from the United States during the 1920s. After growing up in Pawhuska, Oklahoma, seat of the Osage Nation, where he had been born in 1894 to a white mother…

  1. a speech act analysis of John 9: 35

    African Journals Online (AJOL)

    The significance of Jesus' utterance in relation to the Johannine son of man: a speech act analysis of John 9: 35: research. ... In order to accomplish that, this article will examine the significance of Jesus' utterance in John 9: 35, which contains some difficulty in interpreting the meaning of the title Son of Man.

  2. Celebrating the Life and Legacy of Dr. John Hope Franklin

    Science.gov (United States)

    Harris, Robert L., Jr.; Levering-Lewis, David; French, John D.; Wharton, Clifton R., Jr.

    2009-01-01

    Dr. John Hope Franklin chronicled the experiences of African-Americans like no one before him, forcing America to recognize Black history as American history. His contributions were innumerable and his impact was abiding. In celebration of his life and legacy, the authors profile the celebrated scholar and activist, Dr. John Hope Franklin.

  3. The History of Heart Surgery at The Johns Hopkins Hospital.

    Science.gov (United States)

    Patel, Nishant D; Alejo, Diane E; Cameron, Duke E

    2015-01-01

    Johns Hopkins has made many lasting contributions to cardiac surgery, including the discovery of heparin and the Blalock-Taussig Shunt, which represents the dawn of modern cardiac surgery. Equally important, Johns Hopkins has trained some of the world's leaders in academic cardiac surgery, and is committed to training the future leaders in our specialty. Copyright © 2015. Published by Elsevier Inc.

  4. John Stuart Mill: utilitarismo e liberalismo = John Stuart Mill: utilitarianism and liberalism

    Directory of Open Access Journals (Sweden)

    Simões, Mauro Cardoso

    2013-01-01

    Full Text Available Meu objetivo, neste trabalho, é investigar a compatibilidade das teses utilitaristas e liberais de John Stuart Mill. Apresentarei, inicialmente, os principais críticos da filosofia moral e política de Mill, para os quais o discípulo de Bentham teria abandonado o utilitarismo ou, ainda, não esclarecido suficientemente seu princípio da liberdade, o que o tornaria um pensador assistemático e inconsistente. Minha tese é contrária a tais interpretações, uma vez que sustenta ser Mill consistente. Em seguida, defenderei uma interpretação do princípio da liberdade e da individualidade, procurando demonstrar que seu utilitarismo é compatível com seu liberalismo

  5. Obituary: John P. Oliver (1939-2011)

    Science.gov (United States)

    Cohen, Howard

    2011-12-01

    John P. Oliver, an emeritus professor of astronomy at the University of Florida in Gainesville, passed away Thursday, February 10, 2011, after a courageous and long battle with renal cancer. He left behind memories of a life and career to envy. During his forty years of service to his profession and department, this unique astronomer distinguished himself as a research scientist and instrumentalist, creative software designer, gifted teacher and speaker, a vocal advocate of public outreach, and friend to all who knew him. Oliver was born in New Rochelle, New York, during late fall 1939 on November 24. His father, James P. Oliver, was a naval officer and his mother was the former Dorothy Armstrong Cambell. Oliver's early days were spent in various cities due to his father's military life but he eventually received a high school diploma from Princess Ann High School in Virginia. Oliver subsequently graduated with a bachelor of science degree in physics in 1963 from the prestigious Rensselaer Polytechnic Institute in Troy. Lick Observatory awarded him a graduate assistantship so he moved west to California where he met and, on November 2, 1963, married Barbara Kay McKenna, who became his lifelong love and partner. In California Oliver had the good fortune to work with several eminent astronomers. This included Albert E. Whifford, director of Lick Observatory and known for his work on interstellar reddening, and Merle F. Walker, an expert in photometry, who also helped establish Pluto's rotation period. His close relation with Lawrence H. Aller, one of the 20th century's memorable astronomers, known for his ability to combine observation, theory and education, and for his care and kindness, helped bind Oliver and astronomy together for life. Oliver would also join the technical staff of the Aerospace Corporation, become an acting director of the Pine Mountain Observatory (University of Oregon), and a research assistant at the University of California in Los Angeles

  6. Obituary: John Allen Eddy (1931-2009)

    Science.gov (United States)

    Gingerich, Owen

    2011-12-01

    and eventual impacts of environmental changes of all kinds. In 2004 they moved to Tucson, where Eddy worked for NASA at the National Solar Observatory until the time of his death. Author's Note: A principal source of information is the interview with John A. Eddy by Spencer Weart on 21 April 1999, Niels Bohr Library & Archives, American Institute of Physics, College Park, MD USA, www.aip.org/history/ohilist/22910.html. See also the obituary by Peter Foukal in Physics Today, January 2010, pp. 60-61.

  7. Obituary: John Beverley Oke, 1928-2004

    Science.gov (United States)

    Hesser, James Edward

    2004-12-01

    John Beverley (Bev) Oke passed away of heart failure early on 2 March 2004 at his Victoria, B.C. home. Bev's insatiable scientific curiosity led to fundamental contributions in many areas of stellar and extragalactic astronomy, including the development of advanced instrumentation for the largest optical telescopes and the mentoring of scores of grateful students and colleagues. Bev Oke was born in Sault Ste. Marie, ON, Canada on 23 March 1928, the son of Lyla Parteshuk and the Rev. C. Clare Oke. He entered the University of Toronto in 1945 to study physics with a steadily increasing fraction of astronomy, receiving his BA in 1949. Summer employment at the David Dunlap Observatory (DDO, 1948) and at the Dominion Observatory (Ottawa, 1949, 1950) sealed his interest in astronomy as a career. For his MA thesis (1950, Toronto), performed under theoretician Ralph Williamson, he made interior models of the Sun, and was proud to have proved that the proton-proton cycle was indeed the source of solar energy. Upon entering Princeton University he worked with Martin Schwarzschild on stellar interiors models and Lyman Spitzer on interstellar lines. A lifelong friendship with Alan Sandage began during Bev's second year while Alan was a post-doc at Princeton. During Bev's third year he spent three months in Pasadena with Lyman obtaining data for his thesis on Of stars. While in Pasadena he began a second life-long collaboration with Jesse Greenstein, an astronomer whose approach to science Bev deeply respected. In the small field of astronomy in that era, Bev wrote to DDO Director Jack Heard indicating the nearing completion of his PhD studies and his interest in a position. This led to a lectureship at the University of Toronto (1953-1956), followed by an Assistant Professorship (1956-1958). Bev's interest in instruments began at this time, when he built a device to convert photographic density to intensity, and worked with DDO engineer-machinist Jerry Longworth to implement

  8. Anamnesis and the Silent Narrator in Plato and John

    Directory of Open Access Journals (Sweden)

    George L. Parsenios

    2017-03-01

    Full Text Available The Gospel of John is often compared to the dialogues of Plato by those who connect Johannine theology and Platonic philosophy. The comparison operates on the level of ideas. The present paper does not ignore issues of theology and philosophy but grounds a comparison of John and Plato first and foremost on the literary level. In several key places in John 1, 3, and 14, the Johannine narrator recedes from view and is unexpectedly silent where one would expect a narrator’s comment to organize the conversations and interactions between characters in John. Plato also renders the voice of the narrator silent in a dialogue like the Theaetetus. This paper argues that John and Plato both suppress the narrator’s voice in order to further their anamnetic efforts and to make later generations not only readers but participants in their original conversations.

  9. John Dewey: Su filosofia y filosofia de la educacion (John Dewey: His Philosophy and Philosophy of Education). Working Paper.

    Science.gov (United States)

    Zoreda, Margaret Lee

    This paper forms part of an investigation about how the philosophy of John Dewey (1859-1952) can illuminate the practice of the teaching of English as a foreign language. The paper seeks to interpret and synthesize John Dewey's philosophical works to construct a "Deweyian lens" with which to analyze and evaluate the field of the teaching…

  10. ACULTURACIÓN Y DIFERENCIAS EN LAS CREENCIAS IRRACIONALES SOBRE EL ROL FEMENINO TRADICIONAL (O’ KELLY WOMEN BELIEFS SCALE EN MUJERES COLOMBIANAS RESIDENTES EN SU PAÍS DE ORIGEN Y EN ESTADOS UNIDOS

    Directory of Open Access Journals (Sweden)

    MARÍA TERESA PAREDES

    2009-08-01

    Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 st1:*{behavior:url(#ieooui } /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabla normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman"; mso-ansi-language:#0400; mso-fareast-language:#0400; mso-bidi-language:#0400;} La Escala de Creencias de las Mujeres de O'Kelly (O'Kelly Women Beliefs Scale., O'Kelly, en prensa; Ellis, 1958 fue aplicada a colombianas residentes en Cali, Colombia, colombianas residentes en el noreste de los Estados Unidos y sus contrapartes estadounidenses (20 madres y 20 hijas mayores de 17 años en cada grupo. Se encontró que existen diferencias transculturales en los puntajes totales de los tres grupos. Comparaciones posthoc (LSD indicaron que las diferencias significativas se encuentran en las hijas colombianas residentes en Estados Unidos, comparadas con las madres colombianas residentes en Colombia y las madres e hijas estadounidenses. No existen diferencias entre madres e hijas colombianas residentes en Estados Unidos. Los resultados sugieren que el patrón de aculturación de los colombianos en los Estados Unidos es el de asimilación al país de adopción conservando aspectos de la tradición y la cultura del país de origen.

  11. Sharing AIS Related Anomalies (SARA)

    Science.gov (United States)

    2016-03-01

    78 6.3.7 SQL Versus NoSQL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 6.4 Data Processing...43 6.1 Overview of SQL and NoSQL differences, from [56]. . . . . . . . . . . . . . . . . . 82 A.1 Description of the ship anomaly upload use...constraints must be considered. These requirements, however, can only be defined when lower level implementation decisions, such as SQL versus NoSQL

  12. Severe accident recriticality analyses (SARA)

    DEFF Research Database (Denmark)

    Frid, W.; Højerup, C.F.; Lindholm, I.

    2001-01-01

    with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality-both super-prompt power bursts and quasi steady-state power......Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies......, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g(-1), was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s(-1). In most cases, however, the predicted energy deposition was smaller, below...

  13. Discursive investigation into John's internalised spirit identity and its ...

    African Journals Online (AJOL)

    2016-05-31

    May 31, 2016 ... Learning about John's community from the history and experiences of South Africa reminds us of .... In addition to the illustrated recent views, ..... idenfity in South Africa, Germany and Canada, Sun Press, Stellenbosch.

  14. The Inner Child and Other Conceptualizations of John Bradshaw.

    Science.gov (United States)

    Bordan, Terry

    1994-01-01

    Interviewed John Bradshaw on radio talk show. Bradshaw contributed to a greater understanding of factors that foster and maintain substance abuse and dysfunctional families. Focused on his concept of the inner child. (JBJ)

  15. St. John Shallow-water Ground Validation Sites

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Benthic habitat maps of the nearshore marine environment of St. John, U.S. Virgin Islands were created by visual interpretation of remotely sensed imagery. The...

  16. John Pope - Failure at Second Battle of Bull Run

    National Research Council Canada - National Science Library

    Morio, Daniel

    2002-01-01

    Was the failure of the Army of Virginia at the Second Battle of Bull Run a result of General John Pope being a failure as a leader or were there other circumstances that helped him in his loss? Conclusion...

  17. Festivals, cultural intertextuality, and the Gospel of John's rhetoric of ...

    African Journals Online (AJOL)

    Test

    2011-06-07

    Jun 7, 2011 ... offers a good starting place for exploring their interface with ..... Millar, F., 1977, The Emperor in the Roman World, Duckworth, London. ... Yee, G., 1989, Jewish feasts and the Gospel of John, Michael Glazier, Wilmington.

  18. Biographical Sketch: John Royal Moore, MD 1899–1988

    OpenAIRE

    Brand, Richard A.

    2011-01-01

    This biographical sketch on John R. Moore corresponds to the historic text, The Classic: Cartilaginous-cup Arthroplasty in Ununited Fractures of the Neck of the Femur (1948), available at DOI 10.1007/s11999-011-1974-z.

  19. Exploring the Universe with John Milton and Mary Shelley.

    Science.gov (United States)

    Poston, David

    1989-01-01

    Presents an approach to teaching John Milton's "Paradise Lost" in conjunction with Mary Shelley's "Frankenstein." Notes that a study of these works stimulates vigorous discussions on theological and moral issues, human nature, and the cultural past and future. (MM)

  20. Astronaut John Young in Command Module Simulator during Apollo Simulation

    Science.gov (United States)

    1968-01-01

    Astronaut John W. Young, command module pilot, inside the Command Module Simulator in bldg 5 during an Apollo Simulation. Astronauts Thomas P. Stafford, commander and Eugene A. Cernan, lunar module pilot are out of the view.

  1. John White on Philosophy of Education and Philosophy

    Science.gov (United States)

    Siegel, Harvey

    2014-01-01

    John White offers a provocative characterization of philosophy of education. In this brief reaction, I evaluate the characterization and urge the maintenance of a strong connection between philosophy of education and philosophy.

  2. Reflections on Cambridge: John Maynard Keynes at King's College Cambridge

    OpenAIRE

    Macfarlane, Alan

    2012-01-01

    .mp4 video file The economist John Maynard Keynes spent much of his life in Cambridge, connected to King's College. Alan Macfarlane reflects on a few aspects of his life and work. Filmed by Xu Bei in 2010

  3. John Malkovich ikka oskab / Kätlin Kaldmaa

    Index Scriptorium Estoniae

    Kaldmaa, Kätlin, 1970-

    2006-01-01

    Edinburghi filmifestivalil esilinastus "Colour Me Kubrick" (stsenarist Anthony Frewin, režissöör Brian Cook, peaosas John Malkovich) mehest, kes režissööri eluajal 1996.a. esines Stanley Kubrick'una

  4. Memorial—John A. Washington II, M.D.▿

    OpenAIRE

    2010-01-01

    John A. Washington II, M.D., former Head of Clinical Microbiology at the Mayo Clinic from 1972 to 1986 and Chairman of the Department of Microbiology at the Cleveland Clinic from 1986 to 1992, died on 5 September 2010 at the age of 74. John was an internationally recognized, widely respected leader in the disciplines of clinical microbiology and infectious diseases, authoring more than 450 scientific articles, books, and book chapters and training scores of pathology residents and clinical mi...

  5. First John structure resolved: Exegetical analysis, Part 2

    Directory of Open Access Journals (Sweden)

    Ron J. Bigalke

    2013-11-01

    Full Text Available Numerous attempts have been suggested regarding the structure of First John. The only nearly unanimous agreement amongst commentators is concerning the prologue (1:1–4 and the conclusion (5:13–21. The lack of unanimity can be frustrating for the majority of those who seek to understand the macrostructure of the First Epistle of John. Consequentially, some commentators have opined that it is impossible to determine a notable structure of First John, and the epistle is thus regarded as a relatively imprecise series of various thoughts that were composed on the basis of mere association. Many exegetes have therefore proposed suggested outlines to aid the understanding of First John as opposed to providing genuine efforts to articulate a discernable structure of the epistle. The final part of this exegetical analysis seeks to demonstrate that exegetes need not succumb to such pessimism because there does appear to be a discernable structure to First John. Providing and stating resolve concerning the First John structure is fundamental for understanding the revealed contents of the epistle.

  6. John Hejduk ja tema Wall House 2 = John Hejduk and his Wall House 2 / Vilen Künnapu

    Index Scriptorium Estoniae

    Künnapu, Vilen, 1948-

    2010-01-01

    Ameerika arhitekt John Hejdukist ja tema mõjust 20. sajandi lõpukümnendite arhitektuurimõttele. Ka 1973. aastal projekteeritud eramust Wall House 2, mis valmis alles 2001. aastal Groningenis. Kommentaar Soome arhitektuuriprofessor Juhani Pallasmaalt

  7. Obituary: John Louis Africano III, 1951-2006

    Science.gov (United States)

    Barker, Edwin, S.

    2007-12-01

    The orbital debris, space surveillance, and astronomical communities lost a valued and beloved friend when John L. Africano passed away on July 27, 2006, at the young age of 55. John passed away in Honolulu, Hawaii, from complications following a heart attack suffered while playing racquetball, which was his avocation in life. Born on February 8, 1951, in Saint Louis, Missouri, John graduated with a B.S. in Physics from the University of Missouri at Saint Louis in 1973, and received a Master's degree in Astronomy from Vanderbilt University in 1974. John had a real love for astronomical observing and for conveying his many years of experience to others. He encouraged many young astronomers and mentored them in the basics of photometry and astronomical instrumentation. John was author or co-author on nearly one-hundred refereed publications ranging from analyses of cool stars to the timing of occultations to space surveillance. He was honored for his contributions to minor planet research when the Jet Propulsion Laboratory named Minor Planet 6391 (Africano) after him. John held operational staff positions at several major observatories including McDonald Observatory in Texas, Kitt Peak National Observatory in Arizona, and the Cloudcroft Telescope Facility in New Mexico. He observed at numerous observatories worldwide, including Cerro Tololo Inter-American Observatory (CTIO) in Chile, developing a world-wide network of friends and colleagues. John's ability to build diverse teams through his managerial and technical skills, not to mention his smiling personality, resulted in numerous successes in the observational astronomy and space surveillance arenas. As an astronomer for Boeing LTS Inc., he worked for many years at the Advanced Maui Optical and Space Surveillance site (AMOS) on Maui, Hawaii, where he contributed his operational and instrumental expertise to both the astronomy and space surveillance communities. He was also the co-organizer of the annual AMOS

  8. Geologic setting of the John Day Country, Grant County, Oregon

    Science.gov (United States)

    Thayer, Thomas P.

    1977-01-01

    One of the Pacific Northwest's most notable outdoor recreation areas, the "John Day Country" in northeastern Oregon, is named after a native Virginian who was a member of the Astor expedition to the mouth of the Columbia River in 1812. There is little factual information about John Day except that he was born in Culpeper County, Virginia, about 1770. It is known also that in 1810 this tall pioneer "with an elastic step as if he trod on springs" joined John Jacob Astor's overland expedition under Wilson Price Hunt to establish a vast fur-gathering network in the Western States based on a major trading post at the mouth of the Columbia River.

  9. Geology of St. John, U.S. Virgin Islands

    Science.gov (United States)

    Rankin, Douglas W.

    2002-01-01

    The rocks of St. John, which is located near the eastern end of the Greater Antilles and near the northeastern corner of the Caribbean plate, consist of Cretaceous basalt, andesite, keratophyre, their volcaniclastic and hypabyssal intrusive equivalents, and minor calcareous rocks and chert. These rocks were intruded by Tertiary mafic dikes and tonalitic plutons. The oldest rocks formed in an extensional oceanic environment characterized by abundant keratophyre and sheeted dikes. Subduction-related volcanism of the east-west-trending marine Greater Antilles volcanic arc began on St. John near the transition between the Early and Late Cretaceous. South-directed compression, probably caused by the initial collision between the Greater Antilles arc of the Caribbean plate and the Bahama platform of the North American plate, deformed the Cretaceous strata into east-west-trending folds with axial-plane cleavage. Late Eocene tonalitic intrusions, part of the Greater Antilles arc magmatism, produced a contact aureole that is as much as two kilometers wide and that partly annealed the axial-plane cleavage. East-west compression, possibly related to the relative eastward transport of the Caribbean plate in response to the beginning of spreading at the Cayman Trough, produced long-wavelength, low-amplitude folds whose axes plunge gently north and warp the earlier folds. A broad north-plunging syncline-anticline pair occupies most of St. John. The last tectonic event affecting St. John is recorded by a series of post-late Eocene sinistral strike-slip faults related to the early stages of spreading at the Cayman Trough spreading center and sinistral strike-slip accommodation near the northern border of the Caribbean plate. Central St. John is occupied by a rhomb horst bounded by two of these sinistral faults. Unlike other parts of the Greater Antilles, evidence for recent tectonic movement has not been observed on St. John.

  10. Atmintis ir sielvartas John Banville romane „Jūra“

    OpenAIRE

    Vaičiulaitytė, Giedrė

    2016-01-01

    Memory and Grief in John Banville’s Novel “The Sea” John Banville‘s novel The Sea (2005) details the journey of a retired art historian Max while he navigates through his memories and places from his childhood after the untimely death of his wife. Therefore, the focus of this BA paper is revealing the grief within the narrative and unveiling the relationship between memory, place and identity. The meticulous style of narration, attention to smallest details and the narrator‘s emotional detach...

  11. Process and progress: John Hughlings Jackson's philosophy of science.

    Science.gov (United States)

    Jacyna, L Stephen

    2011-10-01

    Some scepticism has been voiced over whether the work of John Hughlings Jackson possesses any significant philosophical orientation. This article argues that Hughlings Jackson was acquainted with the work of a wide range of philosophers. In particular, certain aspects of the writings of John Stuart Mill are reflected in Hughlings Jackson's own work. From early in his career, Hughlings Jackson adopted a critical stance in his neurological papers, seeking to expose shortcomings in the conventional practices of his peers and urging greater methodological rigour and sophistication in order to advance their science. This critical and 'procedurist' bias endows Hughlings Jackson's writings with a characteristically modern character.

  12. Homenaje póstumo a John Rawls

    Directory of Open Access Journals (Sweden)

    Alútiz, Juan Carlos

    2004-12-01

    Full Text Available This article shows a global vision of the work of John Rawls, describing the evolution of his thought since his initial and original proposal of «Justice as Faimess», to his last contributions about Political Liberalism.

    El presente artículo trata de ofrecer una visión panorámica de la obra de John Rawls, describiendo la evolución de su pensamiento desde su inicial y original propuesta de «Justicia como equidad», hasta sus últimas aportaciones en tomo al Liberalismo político

  13. Notas sobre Feral y las cigüeñas, de Fernando Alonso, y la "Historia del califa cigüeña" (Wilhelm Hauff, Sara Cone Bryant

    Directory of Open Access Journals (Sweden)

    Hans Christian Hagedorn

    2011-01-01

    Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.

  14. Justice John Paul Stevens and the Erotic Boomerang.

    Science.gov (United States)

    Lieberman, Marc

    Justice John Paul Stevens of the United States Supreme Court has ruled on obscenity cases in seven instances since his appointment. His rulings reveal that he regards obscenity as a nuisance rather than as a danger threatening to undermine the nation's morality, that he supports a nationwide standard to adjudicate obscenity cases, and that he…

  15. John Nelson Darby: His Contributions to Evangelical Christian Higher Education

    Science.gov (United States)

    Sutherland, Winston Terrance

    2010-01-01

    The study reported in this article focused on the contributions of John Nelson Derby to biblical hermeneutics and contemporary eschatological thought. Darby continues to exert a great influence on Christianity, particularly conservative evangelical Christianity. This research provides a discussion of Darby's contributions to contemporary…

  16. John Nelson Darby: Scholarship that Influenced the Bible College Movement

    Science.gov (United States)

    Sutherland, Winston Terrance

    2010-01-01

    The study reported in this article focused on the scholastic life of John Nelson Darby and his contributions to the Bible college movement. Darby continues to exert a great influence on Christianity, particularly conservative evangelical Christianity. This research provides a discussion of the forces that conspired to shape the direction of…

  17. Expression, Imagination, and Organic Unity: John Dewey's Aesthetics and Romanticism

    Science.gov (United States)

    Granger, David

    2003-01-01

    We are presently witnessing a renewed interest in the aesthetics of philosopher and educator John Dewey. And it would seem that this interest marks a significant intellectual reorientation and not simply a passing fad. The publications Educational Theory, Studies in Philosophy and Education, The Journal of Aesthetic Education, The Journal of…

  18. John Hick's Philosophy of Religious Pluralism in the Context of ...

    African Journals Online (AJOL)

    This article is an interpretation of John Hick's philosophy of religious pluralism in the context of traditional Yoruba religion. The ultimate goal of the article is pragmatic, viz. to provide a theoretical basis for peaceful coexistence among different religions in Nigeria. The methods adopted to achieve this objective are ...

  19. 'Epistemology models ontology'− In gesprek met John Polkinghorne ...

    African Journals Online (AJOL)

    The famous premise of John Polkinghorne, 'epistemology models ontology', has been assessed in this article. It is interpreted that its logic is based on a linear trajectory of knowledge → being. Polkinghorne places much emphasis on the fact that he pursues a 'bottom-up' approach, that is, an inductive way of going about ...

  20. Linking Past and Present: John Dewey and Assessment for Learning

    Science.gov (United States)

    Kucey, Sharen; Parsons, Jim

    2017-01-01

    This collection of extracts is drawn from an article originally published in the "Journal of Teaching and Learning" (2012). It provides an important reminder to understand Assessment for Learning in depth, by relating some of its key features to aspects of John Dewey's educational and political philosophy of democratic participation.

  1. Why Should Scholars Keep Coming Back to John Dewey?

    Science.gov (United States)

    Gordon, Mordechai

    2016-01-01

    This essay attempts to explain why philosophers, philosophers of education, and scholars of democracy should keep coming back to John Dewey for insights and inspiration on issues related to democracy and education. Mordechai Gordon argues that there are four major reasons that contribute to scholars' need to keep returning to Dewey for inspiration…

  2. Scapegoat: John Dewey and the Character Education Crisis

    Science.gov (United States)

    White, Brian

    2015-01-01

    Many conservatives, including some conservative scholars, blame the ideas and influence of John Dewey for what has frequently been called a crisis of character, a catastrophic decline in moral behavior in the schools and society of North America. Dewey's critics claim that he is responsible for the undermining of the kinds of instruction that…

  3. John Dewey's Democracy and Education: A British Tribute

    Science.gov (United States)

    Higgins, Steve, Ed.; Coffield, Frank, Ed.

    2016-01-01

    In 1916 John Dewey published "Democracy and Education: An introduction to the philosophy of education". In this book some of today's foremost historians, philosophers, psychologists, and sociologists of education mark the anniversary of Dewey's work by reviewing and reflecting, from a British perspective, on Dewey's contribution to our…

  4. John Stuart Mill's Concepts of Quality and Pedagogical Norms.

    Science.gov (United States)

    Kim, Ki Su

    1986-01-01

    Considers the paradoxical relationship between two pervasive educational goals--quality and equality. Sees this paradox embedded in John Stuart Mill's writings on education, which attempted to reconcile the utilitarian pleasure principle (which emphasizes quantitative measures), with a traditional differentiation among levels and kinds of desires…

  5. John Stuart Mill on Freedom, Education, and Social Reform.

    Science.gov (United States)

    Carbone, Peter F.

    1983-01-01

    Examines the social philosophy of John Stuart Mill, emphasizing his views on freedom, education, and social reform. Considers Mill's individualism and reformism, the conflict between freedom and control that characterizes his work, and the importance of freedom and education. Suggests caution in drawing educational implications from his work. (DAB)

  6. Faith of a novelist : religion in John Galsworthy's work

    NARCIS (Netherlands)

    Knoester, Maarten Willem

    2006-01-01

    Most readers are familiar with the British author John Galsworthy (1867-1933) through his The Forsyte Saga (1922), A Modern Comedy (1929) and The End of the Chapter (1934). He wrote many other novels as well, and in his own times he was also known as a leading dramatist. Literary criticism and

  7. Principal Component Surface (2011) for Fish Bay, St. John

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 0.3x0.3 meter principal component analysis (PCA) surface for areas inside Fish Bay, St. John in the U.S. Virgin Islands (USVI). It was...

  8. Principal Component Surface (2011) for Coral Bay, St. John

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 0.3x0.3 meter principal component analysis (PCA) surface for areas inside Coral Bay, St. John in the U.S. Virgin Islands (USVI). It was...

  9. John Knopfmacher, [Abstract] Analytic Number Theory, and the ...

    African Journals Online (AJOL)

    Abstract. In this paper some important contributions of John Knopfmacher to ' Analytic Number Theory' are described. This theory investigates semigroups with countably many generators (generalized 'primes'), with a norm map (or a 'degree map'), and satisfying certain conditions on the number of elements with norm less

  10. Collected works of John Tate part I (1951--1975)

    CERN Document Server

    Tate, John; Serre, Jean-Pierre

    2016-01-01

    In these volumes, a reader will find all of John Tate's published mathematical papers-spanning more than six decades-enriched by new comments made by the author. Included also is a selection of his letters. His letters give us a close view of how he works and of his ideas in process of formation.

  11. Collected works of John Tate part II (1976--2006)

    CERN Document Server

    Tate, John; Serre, Jean-Pierre

    2016-01-01

    In these volumes, a reader will find all of John Tate's published mathematical papers-spanning more than six decades-enriched by new comments made by the author. Included also is a selection of his letters. His letters give us a close view of how he works and of his ideas in process of formation.

  12. Camera aboard 'Friendship 7' photographs John Glenn during spaceflight

    Science.gov (United States)

    1962-01-01

    A camera aboard the 'Friendship 7' Mercury spacecraft photographs Astronaut John H. Glenn Jr. during the Mercury-Atlas 6 spaceflight (00302-3); Photographs Glenn as he uses a photometer to view the sun during sunsent on the MA-6 space flight (00304).

  13. Two Key Theories in Education: Confucius and John Dewey

    Science.gov (United States)

    Bonnie, Michael G.

    2010-01-01

    The following describes the philosophies of Confucius (Confucianism) and John Dewey (pragmatism/instrumentalism/experimentalism) and their views toward vocational, technical, general academic instruction, and the development of morals and values as espoused throughout Asia and America during a span of history from 551 BCE to 1949 CE. This is not…

  14. Festivals, cultural intertextuality, and the Gospel of John's rhetoric of ...

    African Journals Online (AJOL)

    Imperial and civic-religious festivals pervaded the late first-century city of Ephesus where John's Gospel was, if not written, at least read or heard. How did Jesus-believers as likely members of somewhat participationist synagogue communities negotiate such pervasive and public celebration of festivals? Did they participate ...

  15. John Ellis considers cosmology, colloquiums and new collaborations

    CERN Multimedia

    Katarina Anthony

    2011-01-01

    On 13 September, physicists from around the world joined John Ellis in a colloquium to celebrate his 65th birthday. In our last issue, we talked to John about the Higgs, the lack of the Higgs and extra dimensions. In this second part of the interview, John speaks about the colloquium and the wide range of topics it covered, all inspired by his career.   John Ellis in his office (July 2011). How did your birthday colloquium come about? When physicists here at CERN reach a “certain age” – or reach a transition point in their careers – it is traditional to hold some kind of colloquium. I had previously resisted pressure to hold one of these events. But this year, my official duties for the Organization have come to an end.  While it is unlikely you will see any difference in my working habits, it was a milestone that proved too important to not give into requests for an event. Rather than a very long sequence of people talking about what they d...

  16. Huang Zongxi's and John Locke's Rhetoric toward Modernity

    Science.gov (United States)

    Wang, Xiaobo

    2012-01-01

    Huang Zongxi was an influential seventeenth century Chinese political and social theorist who is considered by many to be the inspiration and founding father of democracy and human rights in China. This article examines the many similarities in thought and social influence between Huang and his contemporary, the English philosopher John Locke.…

  17. Orthophoto Mosaic (2012) for Coral Bay, St. John

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This 0.3x0.3 meter imagery mosaic of Coral Bay, St. John in the U.S. Virgin Islands was created by the National Oceanic and Atmospheric Administration (NOAA) using a...

  18. Discursive investigation into John's internalised spirit identity and its ...

    African Journals Online (AJOL)

    What does it mean to live in a society where everything good is located within one ethnicity, and geography? In reading the gospel of John, one gets the impression that faithful disciples, the Holy Spirit and morality are exclusively located within the Johannine community and can only permeate to the outside through the ...

  19. Ruthless reductionism: Review essay of John Bickle - Philosophy and Neuroscience

    NARCIS (Netherlands)

    Looren De Jong, H.

    2005-01-01

    John Bickle's new book on philosophy and neuroscience is aptly subtitled 'a ruthlessly reductive account'. His 'new wave metascience' is a massive attack on the relative autonomy that psychology enjoyed until recently, and goes even beyond his previous (Bickle, J. (1998). Psychoneural reduction: The

  20. Scholarship in Teaching and Learning: An Interview with John Mitterer

    Science.gov (United States)

    Daniel, David B.

    2009-01-01

    John Mitterer earned his PhD in cognitive psychology from McMaster University. Like many teaching professors, his career took an unexpected turn early on when he was hired to teach introductory psychology at Brock University, near Niagara Falls, in Ontario, Canada. It was love at first lecture. He never left the course and now, as a full professor…

  1. "Aesthetic Emotion": An Ambiguous Concept in John Dewey's Aesthetics

    Science.gov (United States)

    Hohr, H.

    2010-01-01

    This article analyses the concept of "aesthetic emotion" in John Dewey's "Art as experience". The analysis shows that Dewey's line of investigation offers valuable insights as to the role of emotion in experience: it shows emotion as an integral part and structuring force, as a cultural and historical category. However, the notion of aesthetic…

  2. A Science of Social Work? Response to John Brekke

    Science.gov (United States)

    Shaw, Ian

    2014-01-01

    I take the opportunity provided by John Brekke's (2012) article to respond to the general assumptions and approaches that may be brought when considering the question of a science of social work. I consider first, what should be our frames of reference, our communities of interest, or our boundaries of inclusion, for such a discussion?…

  3. John C. Mather, the Big Bang, and the COBE

    Science.gov (United States)

    Bang theory and showing that the Big Bang was complete in the first instants, with only a tiny fraction dropdown arrow Site Map A-Z Index Menu Synopsis John C. Mather, the Big Bang, and the COBE Resources with collaborative work on understanding the Big Bang. Mather and Smoot analyzed data from NASA's Cosmic Background

  4. John McArthur | IDRC - International Development Research Centre

    International Development Research Centre (IDRC) Digital Library (Canada)

    John serves as a Senior Fellow at The Brookings Institution and as a Senior Advisor on Sustainable Development to the United Nations Foundation. He previously served as CEO of Millennium Promise Alliance; as faculty member at Columbia University, School of International and Public Affairs; and as Manager and ...

  5. Sir John and Lady Rita Cornforth: a distinguished chemical partnership.

    Science.gov (United States)

    Purchase, Rupert; Hanson, James R

    2015-01-01

    This review describes the life of Sir John Cornforth AC CBE FRS, who was awarded the Nobel Prize for Chemistry in 1975. It covers his early life in Australia, his work in Oxford, the National Institute for Medical Research, the Milstead Laboratory of Chemical Enzymology and the University of Sussex, together with the contributions made by his wife, Lady Rita Cornforth.

  6. Memories of John N. Brady: scientist, mentor and friend

    Directory of Open Access Journals (Sweden)

    Marriott Susan J

    2009-05-01

    Full Text Available Abstract Friends and colleagues remember John N. Brady, Ph.D., Chief of the Virus Tumor Biology Section of the Laboratory of Cellular Oncology, who died much too young at the age of 57 on April 27, 2009 of colon cancer. John grew up in Illinois and received his Ph.D. with Dr. Richard Consigli at Kansas State University studying the molecular structure of polyomavirus. In 1984 John came to the National Institutes of Health as a Staff Fellow in the laboratory of Dr. Norman Salzman, Laboratory of Biology of Viruses NIAID, where he was among the first to analyze SV40 transcription using in vitro transcription systems and to analyze regulatory sequences for SV40 late transcription. He then trained with Dr. George Khoury in the Laboratory of Molecular Virology NCI, where he identified SV40 T-antigen as a transcriptional activator protein. His research interests grew to focus on the human retroviruses: human T-cell lymphotropic virus type I (HTLV-I and human immunodeficiency virus (HIV, analyzing how interactions between these viruses and the host cell influence viral gene regulation, viral pathogenesis and viral transformation. His research also impacted the fields of eukaryotic gene regulation and tumor suppressor proteins. John is survived by his wife, Laraine, and two sons, Matt and Kevin.

  7. Highly Inventive Explorer of Creativity: An Interview with John Baer

    Science.gov (United States)

    Henshon, Suzanna E.

    2009-01-01

    Dr. John Baer is a Professor in the Department of Teacher Education at Rider University. Dr. Baer has published 10 books and scores of research articles and book chapters on creativity, cooperative learning, and other educational psychology topics. His research on the development of creativity and his teaching have both won national awards,…

  8. Orthophoto Mosaic (2012) for Fish Bay, St. John

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This 0.3x0.3 meter imagery mosaic of Fish Bay, St. John in the U.S. Virgin Islands was created by the National Oceanic and Atmospheric Administration (NOAA) using a...

  9. In memoriam: John Warren Aldrich, 1906-1995

    Science.gov (United States)

    Banks, Richard C.

    1997-01-01

    John Aldrich was born in Providence, Rhode Island, on 23 February 1906, and went to the Providence public schools. He developed a broad interest in natural history at an early age, being stimulated by his mother, a kindergarten teacher, who introduced him to nature books. His interest was strengthened by Harold L. Madison, Director of the Park Museum in Providence, an Associate ( = member) of the AOU. As a high school student, John taught nature study at the Rhode Island Boy Scout Camp in summers. John was President of his class at Classical High School, and manager of the school's football team in his senior year. Also in that year, 1923, John published his first paper, a note in Bird-Lore on the occurrence of the Mockingbird in Rhode Island. That paper is a literary gem, showing that his skill in writing developed as early as his knowledge of birds. His early interest in football continued as well; he was a devoted fan of the Washington Redskins in his later years.

  10. Haunting Masculinity and Frightening Femininity: The Novels of John Bellairs

    Science.gov (United States)

    Heinecken, Dawn

    2011-01-01

    While developing scholarship around children's horror fiction has focused on the works of contemporary writers, this essay provides a close reading of the novels of John Bellairs, a leading and early practitioner of the genre. It argues that the first three novels in his Lewis Barnevelt series may be understood as addressing some of the same…

  11. Beyond Talent: John Irving and the Passionate Craft of Creativity.

    Science.gov (United States)

    Amabile, Teresa M.

    2001-01-01

    Uses the thoughts and work of novelist John Irving to illustrate the prominence of non-talent components in the componential model of creativity, explaining that raw talent, clever imagination, and a creative personality are insufficient to ensure creative success and that hard work and love of a craft (intrinsic motivation) are at least as…

  12. SuchThatCast Episode 9: John Dupré

    NARCIS (Netherlands)

    Soraker, Johnny

    2013-01-01

    John Dupré is the director of the ESRC Centre for Genomics in Society and professor of philosophy at the University of Exeter. Dupré was educated at the University of Oxford and the University of Cambridge and taught at Oxford, Stanford University and Birkbeck College of the University of London

  13. Het slavernijverleden van John Locke : Naar een minder wit curriculum?

    NARCIS (Netherlands)

    Veraart, W.J.; Van Beers, Britta; Van Domselaar, Iris

    2017-01-01

    In this contribution I critically address the practical and theoretical attitude of the philosopher John Locke towards the trans-Atlantic slave trade and the colonial system of chattel slavery of people of African descent, in connection with the question how we should deal with the colonial context

  14. The manifesto as genre in Ibsen's John Gabriel Borkman

    Directory of Open Access Journals (Sweden)

    Christine Korte

    2015-02-01

    Full Text Available This article examines John Gabriel Borkman’s neo-aristocratic performance of power and authority in Ibsen’s eponymously titled play (1896. After his downfall, John Gabriel has retreated into his once grand reception hall wherein he has become like a petrified relic from a preceding era. His performance within the “fading glory” of the upstairs hall– a veritable theatre for his delusions of grandeur – is one of an outmoded type of bourgeois “hero” whose flagrantly illicit dealings are no longer tenable as capitalism becomes ever-more “rational” and bureaucratic in its façade. The article focuses on John Gabriel’s performance of a “sovereign” or charismatic authority and examines his future visions as “manifestos”. The manifesto is a form belonging to a feudal era of rule by divine right – one that is necessarily “theatrical” in its performance of a legitimate authority. Assuming the voice of the sovereign, John Gabriel attempts to address the needs of the iron-ore miners – a desiring, albeit latent force in Ibsen’s text. The desires of the workers, however, are continually effaced by the bewitching powers of capitalist abstraction, which account for the alienation of family and individuals in Ibsen’s play.   Comparing John Gabriel’s manifesto with Marx and Engels’ Communist Manifesto not only accounts for the end of an age of neo-aristocratic bourgeois decadence, but also marks labour as the definitive socio-political issue of the late 19th century. Where John Gabriel uses a dramaturgy rooted in past models of rule to address the workers in his vision of a benevolent “kingdom”, the Communist Manifesto heralds the death of his class and replaces the voice of the “sovereign authority” with the self-authorising voice of the workers themselves. Borkman’s fatal flaw then is failing to sufficiently address the plight of the iron-ore miners with whom he claims intimate acquaintance but with whom

  15. John Kjaer : Nõukogude Liitu ja euroliitu seob vaid sõna "liit" / John Kjaer ; interv. Tuuli Koch

    Index Scriptorium Estoniae

    Kjaer, John

    2003-01-01

    Euroopa Komisjoni delegatsiooni juht Eestis John Kjaer vastab küsimustele, mis puudutavad Edgar Savisaare kõnet Keskerakonna kongressil, kus ta võrdles NSV Liitu Euroopa Liiduga; peamisi erinevusi EL-i ja totalitaarriigi vahel, otsuste langetamise põhimõtteid EL-is

  16. Nietzsche, autobiography, history: mourning and Martin and John.

    Science.gov (United States)

    Champagne, J

    1998-01-01

    How might gay and lesbian literature be read not as a mimetic representation of homosexuality, but as an activity linked to problems of subjectivity and historiography? Reading Dale Peck's novel Martin and John alongside passages from Friedrich Nietzsche's "On the Uses and Disadvantages of History for Life" and Sigmund Freud's "Mourning and Melancholia," this essay argues for an understanding of Peck's text as an attempt to link two apparently different processes of import to contemporary gay male subjects in particular: the writing of what Nietzsche terms "critical history," and the mourning of those lost to HIV disease. It concludes by linking Martin and John to feminist critiques of identity and traditional historiography, as well as noting the connection between these two critiques.

  17. John Scott Haldane: The father of oxygen therapy

    Directory of Open Access Journals (Sweden)

    K C Sekhar

    2014-01-01

    Full Text Available John Scott Haldane was a versatile genius who solved several problems of great practical significance. His ability to look beyond the laboratory and investigate theory added crucial findings in the field of respiratory physiology. His work on high altitude physiology, diving physiology, oxygen therapy, and carbon monoxide poisoning led to a sea change in clinical medicine and improved safety and reduced mortality and morbidity in many high risk situations.

  18. Recognizing the Stranger: Recognition Scenes in the Gospel of John

    DEFF Research Database (Denmark)

    Larsen, Kasper Bro

    Recognizing the Stranger is the first monographic study of recognition scenes and motifs in the Gospel of John. The recognition type-scene (anagnōrisis) was a common feature in ancient drama and narrative, highly valued by Aristotle as a touching moment of truth, e.g., in Oedipus’ tragic self...... structures of the type-scene in order to show how Jesus’ true identity can be recognized behind the half-mask of his human appearance....

  19. The Assassination of John F. Kennedy: Revisiting the Medical Data

    OpenAIRE

    Rohrich, Rod J.; Nagarkar, Purushottam; Stokes, Mike; Weinstein, Aaron; Mantik, David W.; Jensen, J. Arthur

    2014-01-01

    Thank you for publishing "The Assassination of John F. Kennedy: Revisiting the Medical Data."1 The central conclusion of this study is that the assassination remains controversial and that some of the controversy must be attributable to the "reporting and handling of the medical evidence." With the greatest respect for you and Dr. Robert McClelland, let me argue that your text and on-line interviews perpetuate the central misunderstanding of the assassination and there...

  20. Meharry-Johns Hopkins Center for Prostate Cancer Research

    Science.gov (United States)

    2015-11-01

    formerly at the Institute for Health, Social, and Community Research (IHSCR) Center for Survey Research ( CSR ) at Shaw University in Raleigh, NC...survey will be conducted at CSR which is now located at Johns Hopkins Bloomberg School of Public Health (JHBSPH) located in Raleigh, NC. The Sons...the strategy to contact sons for whom she had no address or phone number. It was hoped that the father will notify the son to contact the study

  1. Astronaut John W. Young during water egress training

    Science.gov (United States)

    1966-01-01

    Astronaut John W. Young, prime crew command pilot for the Gemini 10 space flight, sits in Static Article 5 during water egress training activity on board the NASA Motor Vessel Retriever. The SA-5 will be placed in the water and he and Astronaut Michael Collins, will then practice egress and water survival techniques. At right is Gordon Harvey, Spacecraft Operations Branch, Flight Crew Support Division.

  2. Gerechtigkeit denken. John Rawls' politische Philosophie aus sozialethischer Perspektive.

    OpenAIRE

    Frühbauer, Johannes J.

    2004-01-01

    John Rawls' "Eine Theorie der Gerechtigkeit" wird grundlegend dargestellt. Zentrale Begriffe und Konzeptionen werden benannt und erläutert; hierzu zählen der Urzustand, der Gerechtigkeitsbegriff, die Gerechtigkeitsgrundsätze, das Differenzprinzip, das Überlegungsgleichgewicht, die wohlgeordnete Gesellschaft, die politische Pflicht und der zivile Ungehorsam. In einem weiteren Schritt werden grundsätzliche Strömungen der Kritik (Libertarianismus, Kommunitarismus, Feminismus) und zwei herausra...

  3. JOHN STUART MILL'İN FAYDACI AHLKI

    OpenAIRE

    Aydın, Metin

    2014-01-01

    Utilitarianism, systematised by Jeremy Bentham (1748–1832) in 18th century, is a theory having strong effects in many different areas from economy and ethics to politic and law especially in England and geopraphies in which anglo-saxon culture reigns. John Stuart Mill (1806 – 1873) reinterpreted Utilitrianism which was inherited from Bentham, in the context of critics of utilitarianism and his own thoughts. In this essay, Mill’s utilitarianism will be examined. In this context, I will discuss...

  4. MANUSIA DAN PENDIDIKAN MENURUT PEMIKIRAN IBN KHALDUN DAN JOHN DEWEY

    Directory of Open Access Journals (Sweden)

    T. Saiful Akbar

    2015-02-01

    Full Text Available This study aims to understand the concept of human and Ibn Khaldun's ideas of education; to understand the concept of human and educational thought of John Dewey; to know the similarities and differences between the ideas of Ibn Khaldun and John Dewey on the concept of human and education. Various problems have been addressed through the library research method. The study produced several findings: First, human beings according to Ibn Khaldun as a creation of God with all the potential fitted to the five senses and intellect become intellect. The purpose of education opens the mind and maturity of the individual to the advancement of religious, industrial and social system. Material teaching is as educational planning. The method is to advocate phasing method, repetition, widya-tours and training (practice. Secondly, according to John Dewey man is a subject that has the ability, strength, personality, and existence who are capable of changing realities. The goal of education is only to gain happiness in the world life. The method of education is including problem solving, learning by doing and discipline. Third, the thought of Ibn Khaldun is much more religious because it is influenced by its control logic in religious knowledge, so that emphazises more on human spirituality in building civilization. While John Dewey is more radical and extreme, He proposed progressive education which strives against traditional teaching authority. Both Ibn Khaldūn dan Dewey are arise from inhuman socio-cultural environment and recognize the existence of human existence with nature and humanity impulse.

  5. The Fundamentals of Civil Disobedience in John Rawls

    Directory of Open Access Journals (Sweden)

    Eduardo Baldissera Carvalho Salles

    2016-11-01

    Full Text Available Investigating civil disobedience from a liberal perspective, the working thread through the thought of John Rawls, exposed in the work A Theory of Justice, presenting the phenomenon as a kind of political resistance as well as the theoretical framework that legitimizes as processing instrument contemporary society and guarantor of individual rights. Thus, discusses the duty to obey unjust laws defining what the justification of civil disobedience, designed to Rawls just almost just, democratic and orderly.

  6. Musica come divenire. Il paesaggio sonoro secondo John cage

    Directory of Open Access Journals (Sweden)

    Francesca Aste

    2008-12-01

    Full Text Available John Cage ha dedicato tutta la sua vita all’indagine delle possibilità di relazione dell’uomo con i suoni che lo circondano, allargando il campo dell’arte musicale a quello dell’etica e dell’ecologia. Cage non si è occupato di soundscape come un genere compositivo specifico, come forse oggi potremmo identificarlo, tuttavia l’ambiente occupa un ruolo centrale in relazione al suo modo di comporre.

  7. John Archibald Wheeler: A study of mentoring in modern physics

    Science.gov (United States)

    Christensen, Terry M.

    This dissertation has two objectives. The first objective is to determine where best to situate the study of mentoring (i.e. the 'making of scientists') on the landscape of the history of science and science studies. This task is accomplished by establishing mentoring studies as a link between the robust body of literature dealing with Research Schools and the emerging scholarship surrounding the development, dispersion, and evolution of pedagogy in the training of twentieth century physicists. The second, and perhaps more significant and novel objective, is to develop a means to quantitatively assess the mentoring workmanship of scientific craftsmen who preside over the final stages of preparation when apprentices are transformed into professional scientists. The project builds upon a 2006 Master's Thesis that examined John Archibald Wheeler's work as a mentor of theoretical physicists at Princeton University in the years 1938--1976. It includes Wheeler's work as a mentor at the University of Texas and is qualitatively and quantitatively enhanced by virtue of the author having access to five separate collections with archival holdings of John Wheeler's papers and correspondence, as well as having access to thirty one tape recorded interviews that feature John Wheeler as either the interviewee or a prominent subject of discussion. The project also benefited from the opportunity to meet with and gather background information from a number of John Wheeler's former colleagues and students. Included in the dissertation is a content analysis of the acknowledgements in 949 Ph.D. dissertations, 122 Master's Theses, and 670 Senior Theses that were submitted during Wheeler's career as an active mentor. By establishing a census of the students of the most active mentors at Princeton and Texas, it is possible to tabulate the publication record of these apprentice groups and obtain objective measures of mentoring efficacy. The dissertation concludes by discussing the wider

  8. Mathematics and Humor: John Allen Paulos and the Numeracy Crusade

    OpenAIRE

    Paul H. Grawe

    2015-01-01

    John Allen Paulos at minimum gave the Numeracy movement a name through his book Innumeracy: Mathematical Illiteracy and Its Consequences. What may not be so obvious was Paulos’ strong interest in the relationship between mathematics and mathematicians on the one hand and humor and stand-up-comedian joke structures on the other. Innumeracy itself could be seen as a typically mathematical Gotcha joke on American culture generally. In this perspective, a Minnesotan acculturated to Minnesota-Nice...

  9. A Cultural Resources Inventory of the John Martin Reservoir, Colorado.

    Science.gov (United States)

    1982-08-31

    Rating (VAR26) .......................................... 117 5.2.20 Upland Game Bird Rating (VAR27) ................................ 118 5 2.21...return the pueblo Indians, who he heard arrived at the Rio Nepestle (Arkansas), which were being held captive by the Apache at El is a very copious and...nor nutrition suffi- called). The other group, led by Captain John cient to nourish timber. These vast plains of Bell, continued east along the Arkansas

  10. JOHN RAWLS’ DIFFERENCE PRINCIPLE: EVIDENCE FROM GUATEMALA

    OpenAIRE

    Brian J. Quarles

    2011-01-01

    While literature indicates that strong intellectual property (IP) protection is needed to attract foreign direct investment (FDI) in developing countries like Guatemala, the literature fails to address adequately the economic, social, and political considerations facing developing nations in the reformation of their IP laws. This article addresses those considerations by applying John Rawls’ Difference Principle. Rawls’ Difference Principle depicts justice as an issue of fairness, which f...

  11. Astronaut John Grunsfeld during EVA training in the WETF

    Science.gov (United States)

    1995-01-01

    Astronaut John M. Grunsfeld, STS-67 mission specialist, gives a salute as he is about to be submerged in a 25-feet deep pool in JSC's Weightless Environment Training Facility (WETF). Wearing a special training version of the Extravehicular Mobility Unit (EMU) space suit and assisted by several JSC SCUBA-equipped divers, Grunsfeld was later using the pool to rehearse contingency space walk chores.

  12. Electromagnetic noise spectrum at John TS [transmission station

    International Nuclear Information System (INIS)

    Hatanaka, G.K.

    1992-01-01

    Canadian National (CN) is proposing the development of a commercial office tower on a site directly south of John Transmission Station (TS). CN is concerned about the potential effects of fields originating from John TS and other nearby sources on the operation of sensitive equipment and occupants of the building. Potential equipment and tenants might include data processing equipment and television and radio broadcasting companies. A study was conducted to characterize the severity of the electromagnetic environment at the site in order to address these concerns. Measurements of the electromagnetic spectrum from 100 kHz to 300 MHz were performed from a mobile test facility that features a 5 kW diesel generator and an extendible antenna mast. Peak measurements were made using a selectable measurement time of 0.05 s. It was found that the highest noise levels result from micro-gap discharges under dry weather conditions. The micro-gap discharges are characteristic of defect noise sources associated with substation hardware. At 0.5 MHz the noise levels are typical of median noise levels expected for the International Radio Consultive Committee (CCIR) defined business environment. At 74 MHz the noise levels are more severe than the expected levels for this type of environment. However, levels more representative of the business environment will be achieved by eliminating the micro-gap noise sources attributed to John TS. 6 refs., 11 figs., 2 tabs

  13. The Urgency for Peace in Teachings of John Paul II

    Directory of Open Access Journals (Sweden)

    Jerzy Lewandowski

    2014-04-01

    Full Text Available Peace has always been a topic of great importance. Its presence is desired by all nations and societies. It brings the world together in unity. John Paul II considered peace to be an integral part in creation of an independent and healthy society. Papal encyclicals and messages, intended to present the response of the teaching Church to problems that arise from time to time, often dwell on the principles that advocate peace. Since freedom and peace are in many cases a privilege for many nations, the mentioned pope commits himself to speak about the cruelty and evilness of wars and national conflicts. Pope John Paul II denounces intolerance as denial of freedom for many people, and consequently a great threat to peace. The pope teaches that peace has its roots in the family. Yet, in many societies, the family is deprived of the utmost importance that it certainly deserves. Without the adequate means for a decent livelihood, families can experience hardship in committing themselves to promote solidarity and a proper social fabric worthy of human dignity. For John Paul II, a nation’s freedom and peace are safeguarded and promoted through particular attention and a much-devoted effort by strong and healthy families.

  14. The ethical implications of 2 John 10�11

    Directory of Open Access Journals (Sweden)

    Jan van der Watt

    2015-03-01

    Full Text Available The imperative in 2 John 10�11 not to receive a visitor with a false doctrine into one�s house is one of the most controversial prohibitions in the New Testament, especially in light of the commandment of love, ancient hospitality conventions, and modern-day expectations of open discussion. This raises the question what this prohibition is specifically about and whether hospitality is really asked for. This question is considered in some detail in this article. A widely held view is that the prohibition in 2 John 10 is not in line with generally accepted Christian ethics, since it militates against the attitude of love, care, and hospitality. This view is dominant in commentaries. This article aims at countering this view by proposing that the issue is not hospitality but endangering the identity and tradition of the group. This should be regarded as a positive Christian value.Intradisciplinary and/or interdisciplinary implications: I challenge theological readings of 2 John 10�11 that regard the text as unchristian in its exhortation. The results of the research show that hospitality is not the communicative centre of the text, but protection of the group, which was a common feature, not only in Christianity, but also in the ancient world in general. The future discourse should now move from focusing on moral issues related to hospitality to issues related to preserving tradition within a religion.

  15. Fossil Flora of the John Day Basin, Oregon

    Science.gov (United States)

    Knowlton, Frank Hall

    1902-01-01

    For a number of years I have been gradually accumulating material for a thorough revision of the Tertiary floras of the Pacific slope. Fossil plants are known to occur at numerous points within this area, and their study and identification has already furnished valuable data bearing on the geological history of the region, and when still further exploited it is confidently expected that they will afford more exact data for the use of geologists. This investigation is progressing satisfactorily, and at no distant day it is hoped to have it in form for final publication. From time to time various members of the United States Geological Survey, as well as others not connected with this organization, have sent in small collections of fossil plants for determination. These have been studied and reported upon as fully as the condition of the problem permitted, so that the determinations could be immediately available to geologists, but with the reservation that none of the questions could be fully settled until all known material had been studied and properly correlated. The rich fossil plant deposits in the John Day Basin, as set forth more fully in the historical account which follows, have been known for a period of nearly fifty years, but their study has been carried on in a more or less desultory manner. There has also been considerable confusion as to the horizons whence these plants came. As various species of plants described originally from the John Day region were detected in various other localities in Oregon, and in surrounding areas, as central Washington, western Idaho, and northern California, it became more than ever apparent that a thorough study of all material obtainable from this type area would be necessary before any definite or satisfactory conclusions could be reached. The immediate incentive for this revision was furnished by the receipt of a considerable collection of plants, made by Dr. John C. Merriam in 1900 while he was in charge of an

  16. Saint John lateral pipeline project: comprehensive study report

    International Nuclear Information System (INIS)

    1999-02-01

    A descripion is given of the results of an environmental impact assessment of the construction of a natural gas pipeline that will bring gas from Maritimes and Northeast Pipeline Management Ltd.'s (M and NP) main transmission pipeline to clients in Lake Utopia and Saint John, NB. It will be 110 km long, and the Saint John lateral will join the mainline approximately 2 km south of Big Kedron Lake, NB. Various institutional, industrial, commercial and residential clients will be able to access the pipeline in the future, and it is intended to be capable of future expansion for markets along its route and for markets that become economically feasible in the future. A matrix was developed that relates environmental resources to Environmental Components of Concern (ECCs), and to the rationale for exclusion/inclusion of the ECC as a Valued Environmental Component (VECs). The positive benefits of the pipeline to clients in the Saint John area include: reduced dependence on foreign oil, fuel switching and price competition, lower air emission pollution, increased energy efficiency, and a source of energy that is secure and reliable. VECs were selected based on: concerns of various stakeholders including the public, community groups, scientific parties, Aboriginal groups, government officials and agencies, relevant regulations; relevant literature; and past evaluation experiences, including future developments of the proposed study area. Further selection of the VECs required an examination of the issues picked out via scoping to determine the ways in which the overall project could affect the ECCs, and included construction, operation, decommissioning/abandonment, malfunctions and accidents of the pipeline. The phases of the project as they impacted residually and cumulatively on the VECs were evaluated, and impacts on Valued Socio-Economic Components (VSCs) were assessed also. The mitigation efforts taken will minimize the potential effects of the project on VECs and VSCs

  17. John S. Bell on the foundations of quantum mechanics

    CERN Document Server

    Bell, John S; Gottfried, Kurt; Veltman, Martinus J G

    2001-01-01

    This book is the most complete collection of John S Bell's research papers, review articles and lecture notes on the foundations of quantum mechanics. Some of this material has hitherto been difficult to access. The book also appears in a paperback edition, aimed at students and young researchers. This volume will be very useful to researchers in the foundations and applications of quantum mechanics. Contents: (1) On the Problem of Hidden Variables in Quantum Mechanics; (2) On the Einstein-Podolsky-Rosen Paradox; (3) The Moral Aspect of Quantum Mechanics; (4) Introduction to the Hidden-Variabl

  18. John Keats——The Nightingale of His Own Life

    Institute of Scientific and Technical Information of China (English)

    刘佳

    2017-01-01

    "Ode to the Nightingale" is one of the masterpieces of John Keats. The great poem has described on hearing of the beautiful songs of nightingale, the melody inspires the poet's internal expectation of freedom and getting rid of al of the miseries and sadness of life. It can be felt in the poem that emotional changes of the poets and his greatness of his soul in the conflict between the beautiful world with the nightingale and the real world. He is the nightingale of his own life.

  19. The John Zink Hamworthy combustion handbook, v.1 fundamentals

    CERN Document Server

    Baukal, Charles E

    2012-01-01

    Despite the length of time it has been around, its importance, and vast amounts of research, combustion is still far from being completely understood. Environmental, cost, and fuel consumption issues add further complexity, particularly in the process and power generation industries. Dedicated to advancing the art and science of industrial combustion, The John Zink Hamworthy Combustion Handbook, Second Edition: Volume One - Fundamentals gives you a strong understanding of the basic concepts and theory. Under the leadership of Charles E. Baukal, Jr., top combustion engineers and technologists f

  20. John Deweys pædagogik som filosofisk livskunst

    DEFF Research Database (Denmark)

    Dræby, Anders

    De senere år har der været forøget fokus på John Deweys slægtskab med antikkens filosofiske tradition. Oplægget stiller i den forbindelse skarpt på spørgsmålet om, hvorvidt og hvordan det giver mening at forstå Deweys pædagogiske filosofi i sammenhæng med Hellenismens og Romerrigets filosofiske...... livskunst. Er det med andre ord muligt at begribe Deweys pædagogik som en særlig form for filosofisk livskunst?...

  1. John Huizenga at the Nuclear Structure Research Lab. (NSRL)

    International Nuclear Information System (INIS)

    Gove, H.E.

    1986-01-01

    The first experiments at the University of Rochester's Nuclear Structure Research Laboratory were carried out in early November of 1966 and the accelerator itself was officially accepted in April of 1967. The laboratory's inception was a result of an idea of Robert Marshack and Bruce French of the Department of Physics and Astronomy at Rochester. A proposal was submitted to three federal agencies in February 1962. The proposal was accepted by the latter organization, the National Science Foundation and NSRL has flourished in nuclear science since that time. This paper presents an overview of John Huizenga's activities at the NSRL

  2. APOLLO 16 COMMANDER JOHN YOUNG ENTERS ALTITUDE CHAMBER FOR TESTS

    Science.gov (United States)

    1971-01-01

    Apollo 16 commander John W. Young prepares to enter the lunar module in an altitude chamber in the Manned Spacecraft Operations Building at the spaceport prior to an altitude run. During the altitude run, in which Apollo 16 lunar module pilot Charles M. Duke also participated, the chamber was pumped down to simulate pressure at an altitude in excess of 200,000 feet. Young, Duke and command module pilot Thomas K. Mattingly II, are training at the Kennedy Space Center for the Apollo 16 mission. Launch is scheduled from Pad 39A, March 17, 1972.

  3. Writing under cover: Cristina Campo as translator of John Donne

    Directory of Open Access Journals (Sweden)

    Maria Panarello

    2009-12-01

    Full Text Available The study of Cristina Campo’s translations offers a precious contribution to those of us who are attempting to investigate the unknown area that lies in the shadowy zone between the source text and its translation. Vittoria Guerrini, a rather solitary and reticent figure in 20th-century Italian literature, wrote under several pen names, of which her favourite was Cristina Campo, the masque she chose for her beautiful and intense translations of a small but significant collection of poems by John Donne. This paper aims at exploring Cristina Campo’s attitude towards translation and the unique relationship she established with the poets she translated. John Donne’s translations reflect a singular solidarity displaying points of affinity between two extremely complex personalities. The dialogic rapport abolishes difference in space and time, as well as difference in language, as author and translator testify the same supreme tension towards beauty, truth and perfection. Translation in this perspective is a sacred gesture of mediation.

  4. John Rawls\\'s Constructivism & the Theory of Constructional Perceptions

    Directory of Open Access Journals (Sweden)

    M Zamani

    2010-03-01

    Full Text Available John Rawls, American contemporary philosopher, has chosen the title of constructivism for his views on philosophy of ethics and politics. The base of his veiws is the same as the theory of social contract which has been discussed before by John Locke and Imanuel Kant. Rawls completes this view by the condition of impartiality and fairness , which is distinguished by ignorance about the position of self (the veil of ignorance in primary situation. Rawls criticises intutionism and utilitarianism and holds an antirealistic approach towards ethics . The theory that has been delivered by Allame Tabatabee (the constructional perception caused agreements and disagreements, but his idea seems to be new and effective in Islamic philosophy. Based on this idea many conceptions are constructive including goodness , badness and justice. The aim of this paper is to analyse and give a comparison between these ideas and studies similarities and differences with regard to topics such as antirealism, objectivity, criteria of justification and separation of science and ethics.

  5. John Rawls's Constructivism & the Theory of Constructional Perceptions

    Directory of Open Access Journals (Sweden)

    M. Zamani

    2010-01-01

    Full Text Available John Rawls, American contemporary philosopher, has chosen the title of constructivism for his views on philosophy of ethics and politics. The base of his veiws is the same as the theory of social contract which has been discussed before by John Locke and Imanuel Kant. Rawls completes this view by the condition of impartiality and fairness , which is distinguished by ignorance about the position of self (the veil of ignorance in primary situation. Rawls criticises intutionism and utilitarianism and holds an antirealistic approach towards ethics . The theory that has been delivered by Allame Tabatabee (the constructional perception caused agreements and disagreements, but his idea seems to be new and effective in Islamic philosophy. Based on this idea many conceptions are constructive including goodness , badness and justice. The aim of this paper is to analyse and give a comparison between these ideas and studies similarities and differences with regard to topics such as antirealism, objectivity, criteria of justification and separation of science and ethics.

  6. Professor John Scott, folate and neural tube defects.

    Science.gov (United States)

    Hoffbrand, A Victor

    2014-02-01

    John Scott (1940-2013) was born in Dublin where he was to spend the rest of his career, both as an undergraduate and subsequently Professor of Biochemistry and Nutrition at Trinity College. His research with the talented group of scientists and clinicians that he led has had a substantial impact on our understanding of folate metabolism, mechanisms of its catabolism and deficiency. His research established the leading theory of folate involvement with vitamin B12 in the pathogenesis of vitamin B12 neuropathy. He helped to establish the normal daily intake of folate and the increased requirements needed either in food or as a supplement before and during pregnancy to prevent neural tube defects. He also suggested a dietary supplement of vitamin B12 before and during pregnancy to reduce the risk of neural tube defects. It would be an appropriate epitaph if fortification of food with folic acid became mandatory in the UK and Ireland, as it is in over 70 other countries. © 2013 John Wiley & Sons Ltd.

  7. John Tweedie and Charles Darwin in Buenos Aires.

    Science.gov (United States)

    Ollerton, Jeff; Chancellor, Gordon; van Wyhe, John

    2012-06-20

    The journey of exploration undertaken by Charles Darwin FRS during the voyage of HMS Beagle has a central place within the historical development of evolutionary theory and has been intensively studied. Despite this, new facts continue to emerge about some of the details of Darwin's activities. Drawing on recently published Darwin material and unpublished letters in the archives of the Royal Botanic Gardens, Kew, we document a hitherto unexamined link between Darwin and John Tweedie (1775-1862), a relatively obscure Scottish gardener turned South American plant collector. All of the available evidence points to a meeting between the two men in Buenos Aires in 1832. Tweedie provided Darwin with information about the geography of the Rio Paraná, including the locality of fossilized wood eroding from the river bank. It also seems likely that Tweedie supplied Darwin with seeds that he later shipped back to John Stevens Henslow in Cambridge. Although this brief meeting was at the time relatively unimportant to either man, echoes of that encounter have resonated with Tweedie's descendants to the present day and have formed the basis for a family story about a written correspondence between Darwin and Tweedie. Local information supplied to Darwin by residents such as Tweedie was clearly important and deserves further attention.

  8. John Rawls: a economia moral da justiça

    Directory of Open Access Journals (Sweden)

    Hermano Roberto Thiry-Cherques

    2011-12-01

    Full Text Available Neste texto, descrevo como o filósofo norte-americano John Rawls reformulou o pensamento moral contemporâneo, ao propor a subordinação da ética à justiça. Resumo a defesa que apresentou para uma moral fundada em um pacto que compensasse, sem tentar anulá-las, as assimetrias econômico-sociais do mundo em que vivemos. Concluo com uma discussão sobre as dificuldades teóricas que encontrou para absorver o pluralismo cultural, filosófico, político e religioso do Ocidente.In this article I describe how the North-American philosopher John Rawls has reformulated contemporary moral thinking in proposing subordination of ethics to justice. I synthesize his defense of a morality based on an agreement that compensates, without attempting to nullify, current socio-economic asymmetries. I conclude with a discussion of the theoretical difficulties he encountered in absorbing cultural, philosophical, political and religious Western pluralism in his theory.

  9. Música y sensación sonora: John Tavener

    Directory of Open Access Journals (Sweden)

    Alvarado, Boris

    2014-12-01

    Full Text Available This article aims to examine the act of sound sensation in John Tavener Work (1944-2013 following the idea of logic of sensation created by Gilles Deleuze (1925-1995 and phenomenology of the body Xavie Zubiri (1898-1983. Through the concepts of from both philosophers it might be possible to draw the sound experience of vibration that proposes the sacred art of minimalism in the Anglo- Saxon composer.Lo que busca este artículo es investigar el bello y difícil acto de la sensación sonora de la obra de John Tavener (1944-2013 a la luz de una lógica de la sensación de Gilles Deleuze (1925-1995 y de la fenomenología del cuerpo de Xavie Zubiri (1898-1983. Creemos que con los conceptos acuñados por ambos filósofos pueden dar cuenta de un modo más acabado de ese estilo único de la experiencia sonora en la vibración que propone el arte sacro de la música minimal del compositor anglosajón.

  10. ARCHETYPES AND MYTHOLOGICAL MOTIFS: JOHN UPDIKE’S LEGACY REVISITED

    Directory of Open Access Journals (Sweden)

    Loreta Ulvydienė

    2018-04-01

    Full Text Available John Updike is widely considered to be one of the greatest, one of the most popular and sometimes most controversial writers concerned with the American small town and middle-class materialism. A lot of literary critics and researchers observe that Updike’s finest work came from his exploration of ordinary America and from his use of elegant prose, rich with metaphor, to portray the public and private feelings of Americans, their daily rounds of life. In addition, discussing Updike’s individual works a lot of literary critics and researchers have observed the writer’s attempts to re-write myth in “the mythical age”1 of the twentieth century. Naturally enough, as the return to myth is assumed to be a certain feature of the Modernist movement, half a century later since Updike’s famous novel Centaur was penned, it is indispensable to re-examine the writer’s fictional intentions in the usage of myth. More importantly, it is needful to determine whether we can see the mythic elements and realistic details as a continuum or as the contrasted opposites in his so called “historical chronicles”. Updike’s novels and stories are filled with mythological motifs and character archetypes. Thus, the study aims at revisiting John Updike’s creation considering mythological elements and archetypal images of his heroes alongside with heroic masculinity, war, terrorism and American perfectionism.

  11. Water in St. John, U.S. Virgin Islands

    Science.gov (United States)

    Cosner, O.J.

    1972-01-01

    Water for domestic and municipal supply on St. John, in the past, has been obtained from rain catchments, dug wells, and barge shipments from St. Thomas and Puerto Rico. As a result of this study, small ground-water supplies have been developed for the Virgin Islands National Park. Ground water occurs in significant but limited quantities in the fractured volcanic rock throughout most of the Island. Yield of wells in this aquifer ranges from less than 100 to about 2,000 gpd (gallons per day). The average long-term yield of the three drilled wells in use by the National Park Service in 1967 was about 1,000 gpd. Yield ofl,000 to 5,000 gpd may be expected in the Coral Bay and the Reef Bay areas. Estimated total recharge of the fractured volcanic rock on St. John, based on a recharge of 1 to 3 inches per year, is 1,000,000 to 3,000,000 gpd. Perhaps as much as a quarter to a third of this water could be developed practically, depending on the rainfall in a given year. The chemical quality of the ground water in the fractured-rock aquifer in areas uncontaminated by sea water ranges from 600 to 2,000 mg/l (milligrams per liter) or more dissolved solids. Water from-formations in the higher altitudes is of better quality than that in the lower formations. Small quantities of ground water are available from beach sand, alluvium, and fractured rock near the sea. However, these sources tend to be brackish and are subject to salt-water encroachment. There are no perennial streams on St. John. There are a few spring-fed pools in stream channels, however, that are sustained, except in severe drought. Storm runoff is estimated to average 1 inch over the island annually, and evaporation from open water surfaces is about 70 inches per year. Ponds can be developed, but because of the high .evaporation they may be unreliable during droughts. Rain water collected in cisterns from roofs and catchments yield about 50 gpd per 1,000 square feet of catch area during an average year of

  12. Le strutture dell'immaginazione. Un disegno di John Hejduk / Structures for the Imagination. A John Hejduk's drawing

    Directory of Open Access Journals (Sweden)

    Lamberto Amistadi

    2014-05-01

    Full Text Available Un disegno di John Hejduk è l'occasione per riflettere sul rapporto tra ideazione, rappresentazione e realizzazione dell'opera di architettura, seguendo i ragionamenti del maestro americano. Attraverso i mezzi che le sono propri, walls, roofs, boundaries, l'immagine architettonica ha la capacità di evocare e richiamare il senso profondo di situazioni inattese, “rinfrescare” la nostra visione delle cose contro il pericolo dell'automatizzazione. Ne esce un quadro in cui, nel circolo creativo che coinvolge artefice e fruitore, la realtà dell'architettura contribuisce per la sua parte al progetto di “fabbricazione del mondo”. / A drawing by John Hejduk is an opportunity to reflect on the relationship between the creation, representation and realisation of a work of architecture, following the reasoning of the American maestro. Through its own means - walls, roofs, boundaries - the architectural image has the capacity to evoke and invoke the profound sense of unexpected situations, to "refresh" our vision of things against the danger of automation. What emerges is a scenario in which, in the creative circle involving maker and spectator, the reality of architecture contributes to its part in the project of "manufacturing the world"

  13. John Milton: Puritan Tradition and Political Languages in XVIIth Century

    Directory of Open Access Journals (Sweden)

    Laura MITAROTONDO

    2015-06-01

    Full Text Available It is not simple to place John Milton in a specific political current of the English historical context of 17th century. In detail, we want to study Milton’s prose works to extract the topics of the English civic and political tradition in the First Revolution age. In these terms, we’ll analyze the Commonplace Book, a collection of commentaries about texts and authors, and about various subjects: the interpretations of Machiavelli in the Old English tradition of the Modern age, the idea of man’s freedom and his relationship with natural law and political authority, according to the general perspective of the Puritan religion, which characterizes Milton’s political language.

  14. John Ambrose Fleming and the Beginning of Electronics

    Energy Technology Data Exchange (ETDEWEB)

    Fred Dylla; Steve Corneliussen

    2004-11-01

    2004 was the centenary of John Ambrose Fleming's momentous patent on the thermionic diode that can be called the birth of electronics. The ''Edison effect'' was discovered in 1882; this was later shown to be the result of thermionic emission of electrons from a heated filament into a vacuum. Edison did not make any significant devices based on this discovery, and the effect was ignored for more than 8 years. In 1890 Fleming explained the effect and showed that the thermionic diode could be used as a rectifier. Fourteen years later Fleming filed his 1904 patent on the thermionic diode. It was the first public announcement of the electron tube; this revolutionized the development of radio and led to the invention of the thermionic triode by Lee de Forest in 1906. The background to these events will be described.

  15. The teacher taught? What Charles Darwin owed to John Lubbock

    Science.gov (United States)

    Pearn, Alison

    2014-01-01

    The period around the publication of John Lubbock's Origin of civilisation in 1870 and Charles Darwin's Descent of man and selection in relation to sex the following year is key to a re-evaluation of the relationship between the two men, usually characterized as that of pupil and master. It is in the making of Descent that Lubbock's role as a scientific collaborator is most easily discerned, a role best understood within the social and political context of the time. Lubbock made Darwin—both the man and his science—acceptable and respectable. Less obvious is Darwin's conscious cultivation of Lubbock's patronage in both his private and public life, and Lubbock's equally conscious bestowal, culminating in his role in Darwin's burial in Westminster Abbey.

  16. John Locke on Inference and Fallacy, A Re-Appraisal

    Directory of Open Access Journals (Sweden)

    Mark Garrett Longaker

    2014-12-01

    Full Text Available John Locke, long associated with the “standard” approach to fallacies and the “logical” approach to valid inference, had both logical and dialectical reasons for favoring certain proofs and denigrating others. While the logical approach to argumentation stands forth in Locke’s philosophical writings (such as the Essay Concerning Human Understanding, a dialectical approach can be found in his contributions to public controversies regarding religion and toleration. Understanding Locke’s dialectical approach to argumentation not only makes his work more relevant to the contemporary discipline of informal logic, but this understanding also prompts a reconsideration of Locke’s rhetorical purpose. He approached argumentation dialectically (and logically because he wanted to appeal to a universal audience of free rational subjects, people not unlike the real historical audience whom Locke addressed: radical Whigs, latitudinarian Anglicans, early-Enlightenment philosophes.

  17. O discurso psicológico de John Dewey

    Directory of Open Access Journals (Sweden)

    ERIKA NATACHA FERNANDES DE ANDRADE

    2013-01-01

    Full Text Available Este artículo analiza el discurso del filósofo y educador norteamericano John Dewey (1859- 1952 sobre el tema “naturaleza humana”, y adopta como referencia el libro Human nature and conduct: an introduction to Social Psychology. En ese libro, publicado en 1922, Dewey discute los conceptos fundamentales de la psicología - el instinto, el hábito, la inteligencia y otros - y propone una nueva ciencia psicológica; sus elaboraciones cubren los campos de la filosofía, la psicología y la educación. La metodología para el análisis del discurso sigue los estudios desarrollados por el Grupo de Investigación “Retórica y argumentación en la Pedagogía” que se basan en las teorías de Chaim Perelman y Stephen Toulmin.

  18. John Stewart Bell and twentieth century physics vision and integrity

    CERN Document Server

    Whitaker, Andrew

    2016-01-01

    John Stewart Bell (1928-1990) was one of the most important figures in twentieth-century physics, famous for his work on the fundamental aspects of the century's most important theory, quantum mechanics. While the debate over quantum theory between the supremely famous physicists, Albert Einstein and Niels Bohr, appeared to have become sterile in the 1930s, Bell was able to revive it and to make crucial advances - Bell's Theorem or Bell's Inequalities. He was able to demonstrate a contradiction between quantum theory and essential elements of pre-quantum theory - locality and causality. The book gives a non-mathematical account of Bell's relatively impoverished upbringing in Belfast and his education. It describes his major contributions to quantum theory, but also his important work in the physics of accelerators, and nuclear and elementary particle physics.

  19. John Hutchinson, 1811-1861: the first respiratory disease epidemiologist.

    Science.gov (United States)

    Speizer, Frank E

    2011-05-01

    In 1844, before a large medical audience in London, John Hutchinson demonstrated the use of measurements of pulmonary function to predict disease. In contrast to standard practice at that time, he conducted an epidemiological investigation that would have been acceptable by today's standards, in which he examined over 2000 people and contrasted healthy and diseased cases. His data clearly indicated how, what he called, "vital capacity" predicted disease. Exploring the history of this young Victorian-era physician is both humbling and instructive for the modern epidemiologist, who has the advantages of the successes of ever more rapid, computer-based, technical approaches to evaluate existing data sources, and fewer opportunities to actually collect primary data from large number of patients using physiologic tools.

  20. John Hewitt: Creating a Canon of Ulster Art’

    Directory of Open Access Journals (Sweden)

    Riann Coulter

    2013-12-01

    Full Text Available This article explores the role of John Hewitt (1907 – 87 in attempting to articulate a distinctive artistic and cultural identity for Ulster from the middle of the twentieth century. Focusing on Hewitt’s interpretation of the visual arts, this essay examines the ways in which he acted as a curator and advocate for particular artists who he felt embodied his sense of a regional style of art for Ulster. Hewitt’s work is contextualised by a broader discussion of ideas of national and regional identity following the Second World War, and also by the increasingly visible avant-garde centres of artistic development in places such as London and New York.

  1. The vacuum system of the Karlsruhe magnetic spectrograph 'Little John'

    International Nuclear Information System (INIS)

    Buschmann, J.; Gils, H.J.; Jelitto, H.; Krisch, J.; Ludwig, G.; Manger, D.; Rebel, H.; Seith, W.; Zagromski, S.

    1985-02-01

    The vacuum equipment of the magnetic spectrograph Little John is described. The system is characterized by the following special features: The sliding exit flange of the target chamber can be moved to the desired angle of observation without affecting the high vacuum. The pressure maintained is less by a factor of ten than the pressure in the incoming beam tubing. The vacuum system is divided into several separate pumping sections. Ground loops are strictly avoided. All actual states of relevance are fed back to the control panels. The vacuum installation is protected by hardware interlocking systems as well as by a real time program written in FORTRAN in cooperation with CAMAC interfacing. (orig.) [de

  2. John Dewey on philosophy of experience and human education

    Directory of Open Access Journals (Sweden)

    Darcísio Natal Muraro

    2017-08-01

    Full Text Available The objective of this study is to investigate the conception of philosophy and its relation to human formation in the thinking of John Dewey. The work aimed at analyzing the concepts in the main works of the author and his interpreters. The paper analyzes the reconstruction of philosophy as a philosophy of experience anchored in the genetic, experimental, reflexive, critical and creative method. The philosophy of experience is opposed to the dualisms and the spectator philosophies of knowledge that maintains the social division into classes. The role of the philosophy of experience is to rationalize through inquiry the possibilities of human experience through the critical reconstruction of the meanings. The philosophy of experience is a condition of possibility for democratic life and for an education based on freedom and human emancipation.

  3. Astronaut John Young displays drawing of Charlie Brown

    Science.gov (United States)

    1969-01-01

    Astronaut John W. Young, Apollo 10 command module pilot, displays drawing of Charlie Brown in this color reproduction taken from the fourth telecast made by the color television camera aboard the Apollo 10 spacecraft. When this picture was made the Apollo 10 spacecraft was about half-way to the moon, or approximately 112,000 nautical miles from the earth. Charlie Brown will be the code name of the Command Module (CM) during Apollo 10 operations when the Lunar Module and CM are separated (34075); Young displays drawing of Snoopy in this reproduction taken from a television transmission. Snoopy will be the code name of the Lunar Module (LM) during Apollo 10 operations when the LM and CM are separated (34076).

  4. John Locke and the case of Anthony Ashley Cooper.

    Science.gov (United States)

    Anstey, Peter R; Principe, Lawrence M

    2011-01-01

    In June 1668 Anthony Ashley Cooper, later to become the 1st Earl of Shaftesbury, underwent abdominal surgery to drain a large abscess above his liver. The case is extraordinary, not simply on account of the eminence of the patient and the danger of the procedure, but also because of the many celebrated figures involved. A trove of manuscripts relating to this famous operation survives amongst the Shaftesbury Papers in the National Archives at Kew. These include case notes in the hand of the philosopher John Locke and advice from leading physicians of the day including Francis Glisson, Sir George Ent and Thomas Sydenham. The majority of this material has never been published before. This article provides complete transcriptions and translations of all of these manuscripts, thus providing for the first time a comprehensive case history. It is prefaced with an extended introduction.

  5. Workshop held at Johns Hopkins University, March 2013

    CERN Document Server

    2013-01-01

    Cyber-physical systems (CPS) involve deeply integrated, tightly coupled computational and physical components. These systems, spanning multiple scientific and technological domains, are highly complex and pose several fundamental challenges. They are also critically important to society’s advancement and security. The design and deployment of the adaptable, reliable CPS of tomorrow requires the development of a basic science foundation, synergistically drawing on various branches of engineering, mathematics, computer science, and domain specific knowledge.   This book brings together 19 invited papers presented at the Workshop on Control of Cyber-Physical Systems, hosted by the Department of Electrical & Computer Engineering at The Johns Hopkins University in March 2013. It highlights the central role of control theory and systems thinking in developing the theory of CPS, in addressing the challenges of cyber-trust and cyber-security, and in advancing emerging cyber-physical applications ranging from s...

  6. John Freind: physician, chemist, Jacobite, and friend of Voltaire's.

    Science.gov (United States)

    Rowlinson, J S

    2007-05-22

    John Freind (1675/76-1728) achieved distinction in several walks of life, first as a classical scholar, then as a physician and as a chemist who advocated Newtonian philosophy. His clinical practice was generally conservative and he was against the newly introduced practice of inoculating the smallpox. His principles were Tory and High Church; his loyalty to the house of Stuart involved him in the Jacobite plot of 1722, and a spell in the Tower of London. His money was part of the foundation of Dr Lee's benefaction to Christ Church, which still survives in name in scientific posts in Oxford. He was among the circle of friends that Voltaire formed during his two-year stay in England and, 50 years later, Voltaire took him and his son as the principal characters in a conte philosophique defending a deistic attitude against both atheism and revealed religion.

  7. Decentred Centre in John Fowles’s The Magus

    Directory of Open Access Journals (Sweden)

    Aleks Matosoğlu

    2015-12-01

    Full Text Available Decentred Centre in John Fowles’sThe Magus Abstract John Fowles’ The Magus (1966 has been the focus of criticism for many years. This study regards the character of Conchis as a decentred “centre” in the structure of the novel and as in the experience of the contemporary humanity. Conchis becomes in the eyes of Nicholas an all-knowing figure, an accumulation of Western thought since the Greek civilization. He produces signs to be read as he himself becomes a body of various signs that construct him as the metaphysical centre that Western thinkers have relied upon. His narration becomes superior to Nicholas’ and he himself becomes only a narrative voice. The voice from the times of Plato has been considered as a direct expression of the thoughts in one’s mind and thus superior to writing that is permeated with the undecidability of meaning in the absence of the speaker and the addressee. In the novel, words as an endless play of metaphors take the place of voice. There is no knowable reality outside the play words or metaphors which is an endless chain of signifiers that lead to other signifiers. Every time Nicholas turns to Conchis to find the centre outside the play of the language, he finds other signifiers. Thus, Conchis as a meaning-making centre is dethroned. He is not the sole operator of the masks that divert from their presumed original target when they are read. Nicholas is just another production of the literary tradition who reads the signs only to produce other signs. Conchis in the beginning of the novel renounces fiction for science but along the course of the novel, we see that words are never reliable whether in fiction or in science.

  8. 17 JOHN 12,20-22 AS A MISSIONARY TEXT: AN EXEGETICAL ...

    African Journals Online (AJOL)

    (John 3,17) and executor of judgement (John 5,27). By this singular act of glorification, other sheep that are not of the fold would be gathered under one Shepherd (John 10,16; 11,49-52). John 12,22 is ladened with the verb of movement ― e;r cetai. First, it is Philip going to Andrew and then both of them going to Jesus.

  9. John B. Watson's Alleged Sex Research: An Appraisal of the Evidence

    Science.gov (United States)

    Benjamin, Ludy T. Jr.; Whitaker, Jodi L.; Ramsey, Russell M.; Zeve, Daniel R.

    2007-01-01

    In 1974, a story was published about clandestine research done by John B. Watson that was judged to be so reprehensible that it was offered as the real reason he was fired from his faculty position at Johns Hopkins University in 1920, at perhaps the peak of his academic career. Watson's dismissal from Johns Hopkins may have been the most important…

  10. 78 FR 76175 - Notice of Public Meeting for the John Day-Snake Resource Advisory Council

    Science.gov (United States)

    2013-12-16

    ...] Notice of Public Meeting for the John Day-Snake Resource Advisory Council AGENCY: Bureau of Land... Interior, Bureau of Land Management (BLM), the John Day-Snake Resource Advisory Council (RAC) will meet as indicated below: DATES: The John Day-Snake RAC will hold a public meeting Thursday and Friday, January 9 and...

  11. 78 FR 64236 - Notice of Public Meeting for the John Day; Snake Resource Advisory Council

    Science.gov (United States)

    2013-10-28

    ...] Notice of Public Meeting for the John Day; Snake Resource Advisory Council AGENCY: Bureau of Land... Interior, Bureau of Land Management (BLM), the John Day--Snake Resource Advisory Council (RAC) will meet as indicated below: DATES: The John Day--Snake RAC will hold a public meeting Thursday and Friday, November 14...

  12. 75 FR 5803 - John Day/Snake Resource Advisory Council; Meetings

    Science.gov (United States)

    2010-02-04

    ...] John Day/Snake Resource Advisory Council; Meetings AGENCY: Bureau of Land Management, Interior. ACTION: Meeting Notice for the John Day/Snake Resource Advisory Council. SUMMARY: Pursuant to the Federal Land..., Bureau of Land Management (BLM) John Day/Snake Resource Advisory Council (JDSRAC) will meet as indicated...

  13. 76 FR 56471 - Meeting of the John H. Chafee Blackstone River Valley National Heritage Corridor Commission

    Science.gov (United States)

    2011-09-13

    ...] Meeting of the John H. Chafee Blackstone River Valley National Heritage Corridor Commission AGENCY: National Heritage Corridor Commission, John H. Chafee Blackstone River Valley, National Park Service... Advisory Committee Act, 5 U.S.C. Appendix, that the John H. Chafee Blackstone River Valley National...

  14. John Dewey, William Wirt and the Gary Schools Plan: A Centennial Reappraisal

    Science.gov (United States)

    Thorburn, Malcolm

    2017-01-01

    A century on from the height of John Dewey's educational writings and the reputation of the Gary Schools Plan as a model of progressive education, the paper reappraises two key matters: the relationship between John Dewey and William Wirt, the first superintendent of the Gary Schools in Gary Indiana, and the coherence between John Dewey's…

  15. 77 FR 2317 - Captain John Smith Chesapeake National Historic Trail Advisory Council

    Science.gov (United States)

    2012-01-17

    ... DEPARTMENT OF THE INTERIOR National Park Service Captain John Smith Chesapeake National Historic... that the Advisory Committee on the Captain John Smith Chesapeake National Historic Trail will hold a... Columbia,'' tracing the 1607-1609 voyages of Captain John Smith to chart the land and waterways of the...

  16. 76 FR 26767 - Captain John Smith Chesapeake National Historic Trail Advisory Council

    Science.gov (United States)

    2011-05-09

    ... DEPARTMENT OF THE INTERIOR National Park Service Captain John Smith Chesapeake National Historic... that the Advisory Committee on the Captain John Smith Chesapeake National Historic Trail will hold a...-1609 voyages of Captain John Smith to chart the land and waterways of the Chesapeake Bay. This meeting...

  17. 77 FR 12324 - Captain John Smith Chesapeake National Historic Trail Advisory Council

    Science.gov (United States)

    2012-02-29

    ... DEPARTMENT OF THE INTERIOR National Park Service Captain John Smith Chesapeake National Historic... that the Advisory Committee on the Captain John Smith Chesapeake National Historic Trail will hold a...-1609 voyages of Captain John Smith to chart the land and waterways of the Chesapeake Bay. This meeting...

  18. 76 FR 52691 - Captain John Smith Chesapeake National Historic Trail Advisory Council

    Science.gov (United States)

    2011-08-23

    ... DEPARTMENT OF THE INTERIOR National Park Service Captain John Smith Chesapeake National Historic... that the Advisory Committee on the Captain John Smith Chesapeake National Historic Trail will hold a...-1609 voyages of Captain John Smith to chart the land and waterways of the Chesapeake Bay. This meeting...

  19. John Leland’s Caer Urfe: Tynemouth or Chepstow?

    Directory of Open Access Journals (Sweden)

    Andrew Breeze

    2017-03-01

    Full Text Available The paper focuses on the problem of identification of Caer Urfe, one of the Twenty-Eight Cities of Britain listed by John Leland (d. 1552 from Henry of Huntingdon (d. 1155 after the ninth-century Historia Brittonum. Many of the twenty-eight have defied identification; but Leland’s proposal of Tynemouth for Caer Urfe is now maintained by archaeologists on Tyneside, in the north of England. The author argues that Caer Urfe is to be associated with St Cynfarch, near Chepstow, in south-east Wales. It is one of ten Welsh religious communities named in the catalogue together with cathedral cities and ancient British hillforts, none of them on Tyneside. The paper also examines the case of Arbeia, recorded by Notitia Dignitatum as the name of the Roman fort at South Shields, Tyneside. The author shows that Arbeia has no link with Caer Urfe, nor does it mean ‘Arabs,’ supposedly relating to the garrisoning there after 300 CE of troops from Iraq. Many Roman forts in Britain were called after streams close to them; Arbeia is hence best understood on the basis of Welsh erfin ‘turnips,’ also the name of a stream near Aberystwyth, as ‘ stream noted for wild turnips’. The article is supplemented with an appendix containing a list of the twenty-eight cities from Leland’s catalogue, with toponyms rectified after the twelfth-century Book of Llandaff and other Welsh documents.

  20. Fab Four: When John and George Play Gravitation and Cosmology

    Directory of Open Access Journals (Sweden)

    J.-P. Bruneton

    2012-01-01

    Full Text Available Scalar-tensor theories of gravitation attract again a great interest since the discovery of the Chameleon mechanism and of the Galileon models. The former allows reconciling the presence of a scalar field with the constraints from Solar System experiments. The latter leads to inflationary models that do not need ad hoc potentials. Further generalizations lead to a tensor-scalar theory, dubbed the “Fab Four,” with only first and second order derivatives of the fields in the equations of motion that self-tune to a vanishing cosmological constant. This model needs to be confronted with experimental data in order to constrain its large parameter space. We present some results regarding a subset of this theory named “John,” which corresponds to a nonminimal derivative coupling between the scalar field and the Einstein tensor in the action. We show that this coupling gives rise to an inflationary model with very unnatural initial conditions. Thus, we include the term named “George,” namely, a nonminimal, but nonderivative, coupling between the scalar field and Ricci scalar. We find a more natural inflationary model, and, by performing a post-Newtonian analysis, we derive the set of equations that constrain the parameter space with data from experiments in the Solar System.

  1. John Woolman and Ethical Progress in Kitcher's Pragmatic Naturalism.

    Science.gov (United States)

    Barresi, John

    2017-01-01

    The development of John Woolman’s views on slavery plays an important evidentiary role in Philip Kitcher’s recent book, The ethical project (Kitcher 2011). In this work Kitcher takes what he calls a “pragmatic naturalist” approach to ethics and claims that the discovery of ethical truth plays no role in the emergence of ethical progress. To support his view, he argues that Woolman’s contribution was not due to his discovery of an ethical truth about slavery, not previously known, but due to his sensitivity to slavery and his influence on others, which contributed to collective progressive change in moral norms involving slavery. While not disputing Kitcher’s ethical theory, I argue that personal discoveries of a moral psychological nature made by Woolman served both as insights and motivations for his contribution. Thus, even if there are no such things as independent ethical truths that can be discovered by individuals, a fully naturalistic approach to ethical progress requires that we make room not only for group-level progressive evolution of norms, but also for individual discoveries of a moral psychological nature that can sometimes cause an individual to play a significant initiating role in progressive ethical transitions that occur at a group level.

  2. John Cage's Aria viewed through the prism of contextual determination

    Directory of Open Access Journals (Sweden)

    Radovanović Bojana

    2017-01-01

    Full Text Available The paper analysis the three contextual layers of creating John Cage's Aria for solo voice performed by Cathy Berberia at the 'big stage' of musical neo-avant-garde in Darmstadt. The layers in question are: (1 the socio-political context of Germany after World War II, where the denazification process was started at the time, (2 the artistic context of neo-avant-garde musical milieu which was being formed in Darmstadt in that period, and (3 the context of a new epoch in the history of vocal art. The thesis presented here is that an encounter occurred between American experimental and European avant-garde musical practice during the accelerated denazification and liberalisation of German society and the establishment of the Cold War relationship between the East and the West. The piece Aria represents an example of a collaborative work between American and European artists, which turned to be an important step in the history of extended vocal techniques in musical performing and composing.

  3. John Stuart Mill, innate differences, and the regulation of reproduction.

    Science.gov (United States)

    Paul, Diane B; Day, Benjamin

    2008-06-01

    In this paper, we show that the question of the relative importance of innate characteristics and institutional arrangements in explaining human difference was vehemently contested in Britain during the first half of the nineteenth century. Thus Sir Francis Galton's work of the 1860s should be seen as an intervention in a pre-existing controversy. The central figure in these earlier debates-as well as many later ones-was the philosopher and economist John Stuart Mill. In Mill's view, human nature was fundamentally shaped by history and culture, factors that accounted for most mental and behavioral differences between men and women and among people of different classes, nationalities, and races. Indeed, Mill's whole program of social reform depended on the assumption that human differences were not fixed by nature. To identify the leading figures in these disputes about difference and the concrete context in which they occurred, we explore three debates in which Mill played a key role: over the capacities and rights of women, the viability of peasant proprietorship in India and Ireland, and the status of black labor in Jamaica. The last two draw our attention to the important colonial context of the nature-nurture debate. We also show that ideas that for us seem of a piece were not always linked for these earlier thinkers, nor did views on innateness necessarily have the political correlates that we now take for granted.

  4. John Zorn: Autonomy and the Avant-Garde (excerpt

    Directory of Open Access Journals (Sweden)

    Ted Gordon

    2012-06-01

    Full Text Available This essay is an excerpt for a larger paper exploring the concept of autonomy as it emerges in the life and work of the composer, performer, record label executive and club-owner John Zorn. Zorn’s activities over his wide-ranging career span from performing at jazz lofts in the 1970s to winning the MacArthur “genius” grant in 2008, while maintaining his status as a prolific composer and producer of avant-garde music. In interviews, documentaries, and in his music, Zorn often comments on his status as an avant-garde producer, specifically within the context of the record industry and within New York City’s so-called “Downtown” scene. Economics take the forefront in determining artistic attitudes towards both production of music and the music itself, as Zorn has, seemingly, been forced by the “mainstream market” to create a parallel, vertically-integrated economic system to support the livelihood of himself and his collaborators. This excerpt, from the first third of the essay, unpacks Zorn’s relationship with Downtown scene, his conception of the avant-garde, and his attitude towards artists who have set precedents for Zorn’s version of autonomous cultural production. It also notes the idiosyncratic way that both Zorn and his critics have placed Zorn’s music both within and without two distinct traditions: Avant-Garde composition and free Jazz.

  5. The neurological legacy of John Russell Reynolds (1828-1896).

    Science.gov (United States)

    Eadie, M J

    2007-04-01

    Sir John Russell Reynolds was an eminent and highly influential physician in the Victorian era who held the Presidencies of the Royal College of Physicians of London, and of the British Medical Association. He was the protégée of the great experimental physiologist, Marshall Hall, who discovered the reflex arc, and succeeded to Hall's clinical practice in London. Reynolds' thought and clinical activities linked the emerging British neurology of the first half of the 19th century with its blossoming, particularly in London, from 1860 onwards. In his writings Reynolds was the first English author to apply the approach to classification of neurological disorders that is still often used, though now in modified form. He was also the first to enunciate the notion of positive and negative symptoms arising from neurological disease and to suggest their pathogenesis, and was arguably the originator of the influential concept that an idiopathic disease, epilepsy, existed, one to be distinguished from 'epileptiform' seizures due to brain pathology.

  6. Economic and social ethics in the work of John Calvin

    Directory of Open Access Journals (Sweden)

    Matthias Freudenberg

    2009-11-01

    Full Text Available John Calvin and Reformed Protestantism interlinked questions of life and death with questions of faith. Not only faith and the church, but life in general call for constant renewal through the word of God. These processes of renewal incorporate society and the economy. In contrast to the popular assertion that Calvin and Calvinism are responsible for capitalism and its aberrations, Calvin in particular shows a deep sensibility for human beings trapped in economic deprivation. In his sermons Calvin exhorts the rich to consider the poor as ‘their’ poor and to thank God by practicing generosity. This appreciation of social questions within an ecumenical context is demonstrated in the Reformed church in a whole array of charitable services. It will be crucial for the current debate on economic ethics to assess economic processes in relation to how they serve life. For it is liberty, justice and fellowship – as gifts of God – that serve as an orientation and an obligation to be aware of human beings suffering from the negative consequences of globalisation.

  7. The Poet as Translator: The Poetic Vision of John Betjeman

    Directory of Open Access Journals (Sweden)

    Wisam Khalid Abdul Jabbar

    2013-12-01

    Full Text Available Rainer Maria Rilke (1989 describes the quest of the poet as that of saying the “unsayable.” Similarly, poets like Ezra Pound and Octavio Paz suggest that when the poetic essence is beyond the words, then the poem enters the realm of the “untranslatable” and invites an act of translation. John Betjeman recognizes the complexity that is inherent to the heritage of the Modernist School which renders poetry to be as incomprehensible as any foreign language. This paper argues that Betjeman diverts from the stylistic density of the Modernist tradition because he discerns a similar unintelligibility in a receding English culture. Hence, translation becomes not only a vocation but an inevitability that looms large considering the social and political upheavals he witnessed. Drawing on Rilke and Paz’s understanding of the act of translation as seeking meaning “beyond the words per se” (Jackson, 2011, this paper explores Betjeman’s attempts to translate a condition which is both “unsayable” and foreign, which afflicted Englishness as a cultural locus.

  8. Lord Byron's physician: John William Polidori on somnambulism.

    Science.gov (United States)

    Finger, Stanley; Stiles, Anne

    2013-01-01

    John William Polidori (1795-1821) was the Edinburgh-trained physician hired by Lord Byron to accompany him to Switzerland, where he participated in the story-telling event proposed by Byron that led, with Polidori's help, to Mary Shelley's Frankenstein. Although those interested in English literature might also remember Polidori as the author of The Vampyre, one of the first extended works of fiction about vampires, his earlier interest in somnambulism and trance states is only beginning to be appreciated. Even more than students of Romantic literature, historians of science and medicine seem little aware of what Polidori had written about oneirodynia, a synonym for somnambulism, and how his thoughts from 1815 about such activities reflected the changing medical zeitgeist at this time. This chapter examines Polidori's medical thesis in a neuroscience context and compares what he wrote to the writings of several other physicians who were fascinated by nocturnal wanderings, their causes, their manifestations, and their possible treatments. © 2013 Elsevier B.V. All rights reserved.

  9. Spiro K. Antiochos Receives 2013 John Adam Fleming Medal: Citation

    Science.gov (United States)

    Klimchuk, James A.

    2014-01-01

    The John Adam Fleming Medal is awarded for "original research and technical leadership in geomagnetism, atmospheric electricity, aeronomy, space physics, and related sciences." Originality and technical leadership are exactly the characteristics that distinguish the research of Spiro K. Antiochos. Spiro possesses a truly unique combination of physical insight, creativity, and mastery of the concepts and mathematical and numerical tools of space physics. These talents have allowed him to develop completely original theories for major observational problems and to test and refine those theories using sophisticated numerical simulation codes that he himself helped to develop. Spiro's physical insight is especially impressive. He has an uncanny ability to identify the fundamental aspects of complex problems and to see physical connections where others do not. This can sometimes involve ideas that may initially seem counterintuitive to those with less creativity. Many of Spiro's revolutionary advances have opened up whole new areas of study and shaped the course of space physics. Examples include the breakout model for coronal mass ejections (CMEs), the S-web model for the slow solar wind, and the thermal nonequilibrium model for solar prominences. The breakout model is of special significance to AGU as it strives to promote science for the betterment of humanity. CMEs are enormous explosions on the Sun that can have major "space weather" impacts here on Earth. They affect technologies ranging from communication and navigation systems to electrical power grids. Breakout is the leading theory for why CMEs occur and may one day be the foundation for more accurate space weather forecasting.

  10. AIDS: just the facts from specialists at Johns Hopkins.

    Science.gov (United States)

    Finkbeiner, A

    1985-12-01

    This article, based on information from specialists at Johns Hopkins, poses and then answers 3 broad questions about the acquired immunodeficiency syndrome (AIDS). 1st, it is asked, "What is AIDS and how serious is it?" It is noted that AIDS is only 1 of several forms taken by infection with the human T-lymphotropic virus type III/lymphadenopathy-associated virus (HTLV-III/LAV). The earliest form of infection is believed to occur within a few weeks of exposure to the virus, and some patients develop an acute syndrome that resembles infectious mononucleosis. These symptoms disappear after 4-6 weeks, by which time the patient has developed antibodies to the virus. About 2-4%/year of asymptomatic carriers go on to develop AIDS-related complex (ARC), and 15-30% of ARC patients develop AIDS within 5 years. The 2nd question posed is, "How do you catch AIDS?" To cause infection, the virus must go directly into the blood, although the virus alone may not be enough to cause sickness. Previous viral infections such as hepatitis B, herpes, cytomegalovirus, and intestinal parasites have been suggested as co-factors of AIDS. Promiscuity increases the chances of contracting AIDS. Observations of the families of AIDS patients and health care personnel who work with AIDS patients suggest that AIDS cannot be caught by casual contact. Finally, it is asked, "What is being done about AIDS?" 4 strategies are outlined: 1) as a result of donor screening for antibodies to HTLV-III/LAV, AIDS has been completely removed from the blood banks; 2) virologists are attempting to understand the virus so that it can be attacked, and understanding has been advanced by the theory that HTLV-III might be what is called a "slow virus;" 3) education about AIDS is changing the sexual practices that transmit AIDS; and 4) epidemiologists are carefully following those who are at risk, have been exposed, or are already sick.

  11. Mathematics and Humor: John Allen Paulos and the Numeracy Crusade

    Directory of Open Access Journals (Sweden)

    Paul H. Grawe

    2015-07-01

    Full Text Available John Allen Paulos at minimum gave the Numeracy movement a name through his book Innumeracy: Mathematical Illiteracy and Its Consequences. What may not be so obvious was Paulos’ strong interest in the relationship between mathematics and mathematicians on the one hand and humor and stand-up-comedian joke structures on the other. Innumeracy itself could be seen as a typically mathematical Gotcha joke on American culture generally. In this perspective, a Minnesotan acculturated to Minnesota-Nice Humor of Self-Immolation Proclivities (SImP looks at the more raw-boned, take-no-prisoners humor style Paulos outlined in Mathematics and Humor and implemented in Innumeracy. Despite the difference in humor styles, there is much to applaud in Paulos’ analysis of the relationship between certain types of humor and professional interests of mathematicians in Mathematics and Humor. Much humor relies on the sense of incongruity which Paulos’ claims to be central to all humor and key to mathematical reductio ad absurdum. Mathematics is rightfully famous for a sense of combinatorial playfulness in its most elegant proofs, as humor often relies on clashing combinations of word play. And a great range of mathematical lore is best understood within a concept of a sudden drop from one sense of certainty to another (essentially a Gotcha on the audience. Innumeracy repeatedly exemplifies Gotchas on the great unwashed and unmathematical majority. Extensive empirical evidence over the last quarter century allows us to synthesize these Paulos observations into the idea that inculcated mathematical humor has strong propensities to complex Intellectual, Advocate, and Crusader humor forms. However, the Paulos humors do not include the Sympathetic Pain humor form, the inclusion of which may increase teaching effectiveness.

  12. Pope John Paul II apologizes for church's oppression of women.

    Science.gov (United States)

    1995-01-01

    In a 16-page letter which is widely viewed by women's groups as an effort to win support for the Vatican's position at the upcoming UN Conference on Women in Beijing, Pope John Paul II apologizes to women throughout the world for the church's historic complicity in their oppression. Although phrased in general terms, the letter contains language and ideas of a far more feminist tone than any previous statements or declarations made by the Pontiff. Calling for increased respect for women and sensitivity to their needs, the letter also claims that "there is an urgent need to achieve real equality in every area: equal pay for equal work, protection for working mothers, fairness in career advancements, equality of spouses with regard to family rights and recognition of everything that is part of the rights and duties of citizens in a democratic state." Recognizing women's significant achievements and sacrifices inside and outside of the home, the Pope expressed admiration for "those women of good will who have devoted their lives to defending the dignity of womanhood by fighting for their basic social, economic and political rights, demonstrating courageous initiative at a time when this was considered extremely inappropriate, the sign of a lack of femininity, a manifestation of exhibitionism, and even a sin." Although the letter heralds a new awareness in the Vatican of women's views, concerns and grievances, the Pope has not signaled any dramatic changes in official church policy: women's ordination, divorce, abortion and birth control are still considered beyond the pale of acceptability. full text

  13. Perbandingan Konsepsi Epistemologi Empirisisme Ibnu Taymiyyah dan John Locke

    Directory of Open Access Journals (Sweden)

    Rido Kurnianto

    2014-05-01

    Full Text Available This paper examined the epistemological empiricism conception of Ibn Taimiyyah and John Locke based on the comparative analysis to obtain the complete description of epistemological empiricism thought of both, as well as its implications and consequences for the development of science and religious thought. To obtain the detailed answer about the two figures thought, it would be revealed the similarities and differences of epistemological empiricism of each by showing the elements that became the focus of both studies. Furthermore, from those, it will be sought the strange and weaknesses, and possible relevance of the two thought to find a new alternative as a reflective systematic model for the development of science and religious thought in the present and future. Comparing the empirical thought of both figures above is important to do, due to the empirical tradition in the two mens’ world have a very extreme differences. In the west, Empiricism had contributed significantly to the epistemological assets or legacy and had led to the development of science and technology. In contrast, empiricism in the east, was suspected as a harmful tradition to the Islamic ideology. It was considered as the seed that gave birth to atheism. Based on the two thinkers empiricism, will appear the strategic idea that can be synthesized to developed modern science as well as Islamic thought. Bot of epistemology thought can be combine to reconstruct the Islamic epistemology which is more open and more mature, because in that context will emerge the theories of knowledge without eliminating the metaphysical and ethical authority. In the context of combination, the natural tendency of foundation of Islamic teaching should be the bases of policy as descript by Ibnu Taimiyyah, that human nature becomes the foundation of the human responsibility in the end after and imposition of responsibility or duty, are the necessities to obey Allah order and to leave the Allah

  14. Transcultural adaptation of the Johns Hopkins Fall Risk Assessment Tool.

    Science.gov (United States)

    Martinez, Maria Carmen; Iwamoto, Viviane Ernesto; Latorre, Maria do Rosário Dias de Oliveira; Noronha, Adriana Moreira; Oliveira, Ana Paula de Sousa; Cardoso, Carlos Eduardo Alves; Marques, Ifigenia Augusta Braga; Vendramim, Patrícia; Lopes, Paula Cristina; Sant'Ana, Thais Helena Saes de

    2016-08-29

    to perform the transcultural adaptation and content validity analysis of the Johns Hopkins Fall Risk Assessment Tool to assess both fall risk and fall-related injury risk for hospitalized elderly in Brazil. the transcultural adaptation consisted of translating the scale to Portuguese (Brazil), back-translating it into its language of origin, establishing a consensus version, and having an expert committee verify its transcultural equivalence. Content assessment was conducted by a committee of judges, ending with the calculation of the items and scales' content validity index. Nurses tested the tool. the scale's translated version went through two evaluation rounds by the judges, based on which, the items with unsatisfactory performance were changed. The content validity index for the items was ≥80.0% and the global index 97.1%. The experimental application showed the scale is user-friendly. the scale presents valid content for the assessment of fall risk and risk of fall-related injuries and is easy to use, with the potential to contribute to the proper identification of risks and the establishment of care actions. realizar a adaptação transcultural para uso no Brasil e a avaliação da validade de conteúdo da Johns Hopkins Fall Risk Assessment Tool para avaliação de risco de quedas e de danos por quedas em pacientes adultos hospitalizados. adaptação transcultural consistiu na tradução da escala para a língua portuguesa (Brasil), retrotradução para a língua de origem, versão de consenso e análise da equivalência transcultural por um comitê de especialistas. A avaliação do conteúdo foi realizada por meio de um comitê de juízes, finalizando com o cálculo do índice de validade de conteúdo dos itens e da escala. Foi realizada a aplicação experimental do instrumento por enfermeiros. a versão traduzida da escala passou por duas rodadas de avaliação pelos juízes, a partir das quais os itens com desempenho insatisfatório foram modificados

  15. Phenotypic effects of subclinical paratuberculosis (Johne's disease) in dairy cattle.

    Science.gov (United States)

    Pritchard, Tracey C; Coffey, Mike P; Bond, Karen S; Hutchings, Mike R; Wall, Eileen

    2017-01-01

    The effect of subclinical paratuberculosis (or Johne's disease) risk status on performance, health, and fertility was studied in 58,096 UK Holstein-Friesian cows with 156,837 lactations across lactations 1 to 3. Low-, medium-, and high-risk group categories were allocated to cows determined by a minimum of 4 ELISA milk tests taken at any time during their lactating life. Lactation curves of daily milk, protein, and fat yields and protein and fat percentage, together with log e -transformed somatic cell count, were estimated using a random regression model to quantify differences between risk groups. The effect of subclinical paratuberculosis risk groups on fertility, lactation-average somatic cell count, and mastitis were analyzed using linear regression fitting risk group as a fixed effect. Milk yield losses associated with high-risk cows compared with low-risk cows in lactations 1, 2, and 3 for mean daily yield were 0.34, 1.05, and 1.61kg; likewise, accumulated 305-d yields were 103, 316, and 485kg, respectively. The total loss was 904kg over the first 3 lactations. Protein and fat yield losses associated with high-risk cows were significant, but primarily a feature of decreasing milk yield. Similar trends were observed for both test-day and lactation-average somatic cell count measures with higher somatic cell counts from medium- and high-risk cows compared with low-risk cows, and differences were in almost all cases significant. Likewise, mastitis incidence was significantly higher in high-risk cows compared with low-risk cows in lactations 2 and 3. Whereas the few significant differences between risk groups among fertility traits were inconsistent with no clear trend. These results are expected to be conservative, as some animals that were considered negative may become positive after the timeframe of this study, particularly if the animal was tested when relatively young. However, the magnitude of milk yield losses together with higher somatic cell counts and

  16. John P. Peters and the committee of 430 physicians.

    Science.gov (United States)

    Lundberg, George D

    2002-01-01

    John Peters and his committee had a few basic goals. One was that local, state, and federal governments needed to provide money to construct facilities, support medical research and education, and care for the poor. And they wanted experts to call the shots. Over time, Peters and the committee got what they wanted for the most part: Hill-Burton money for building the hospitals, the rise of the National Institutes of Health, Medicare, Medicaid, a Veterans Administration system, and new and expanded medical schools. The experts calling the shots included David Kessler at the Food and Drug Administration and Surgeon General C. Everett Koop. In the halcyon days of American health system reform, back in 1993, Yale's Paul Beeson wrote about the Committee of 430 Physicians and its goals in the Pharos of Alpha Omega Alpha. Beeson was optimistic and he quoted from my 1991 JAMA health system reform editorial as a sharp contrast to what Fishbein had written - although coincidentally, we both quote Lincoln. My editorial began, "'with malice toward none, with charity for all...' so spoke Abraham Lincoln in his second inaugural address recognizing that he had no political consensus regarding either the constitutionality of states seceding or the morality of slavery being abolished. Nonetheless, he knew what was right and was able, through persuasive, often inspiring rhetoric, to conclude a bloody and decisive Civil War and constitute the foundation for this great republic.... Yet access to basic medical care for all of our inhabitants is still not a reality in this country. There are many reasons for this, not the least of which is a long-standing, systematic, institutionalized racial discrimination.... An aura of inevitablitiy is upon us. It is not acceptable morally, ethically, or economically for so many of our people to be medically uninsured or seriously underinsured. We can solve this problem. We have the knowledge and the resources, the skills, the time, and the moral

  17. Review: John S. Saul, Liberation Lite: The Roots of Recolonization in Southern Africa (2011 Buchbesprechung: John S. Saul, Liberation Lite: The Roots of Recolonization in Southern Africa (2011

    Directory of Open Access Journals (Sweden)

    Henning Melber

    2012-01-01

    Full Text Available Review of the monograph: John S. Saul, Liberation Lite: The Roots of Recolonization in Southern Africa, Trenton, N.J.: Africa World Press, 2011, ISBN 978-1-59221-835-6, 133 pagesBesprechung der Monographie: John S. Saul, Liberation Lite: The Roots of Recolonization in Southern Africa, Trenton, N.J.: Africa World Press, 2011, ISBN 978-1-59221-835-6, 133 Seiten

  18. Video of Christian Skau and Martin Raussen's interview with the Abel Prize Winner John Milnor

    DEFF Research Database (Denmark)

    Skau, Christian

    2011-01-01

    The television interview with Abel Laureate John Milnor that was broadcasted on Norwegian television in June is now available on the Abel Prize multimedia page. John Milnor received the Abel Prize «for pioneering discoveries in topology, geometry and algebra» to quote the Abel Committee. King...... Harald presented the Abel Prize to John Milnor at the award ceremony in Oslo, Norway on 24 May. Before the interview there is a short presentation of the award ceremony. John Milnor is interviewed by Martin Raussen and Christian Skau. The Abel Prize that carries a cash award of NOK 6 million (about EUR...

  19. JOHN STUART MILL’İN FAYDACI AHLÂKI

    Directory of Open Access Journals (Sweden)

    Metin Aydın

    2013-12-01

    Full Text Available 18.yy.'da Jeremy Bentham (1748–1832 tarafından sistemleştirilmiş olan faydacılık, günümüzde özellikle  İngiltere  başta  olmak  üzere  Anglo-Sakson  geleneğin  hüküm  sürdüğü  coğrafyalarda, ekonomiden  siyasete,  ahlaktan  hukuka  birçok  alanda  oldukça  büyük  etkiye  sahip  bir  teoridir. John Stuart Mill (1806–1873, Bentham'ın ortaya koyduğu faydacılık anlayışını  bu teoriye gelen eleştiriler  ve  kendi  düşünceleri  ekseninde  yeniden  yorumlamıştır.  Bu  makalede  Mill'in  faydacı ahlak  anlayışı  incelenecektir.  Bu  bağlamda  faydacı  ahlak  anlayışının  hazcı  çizgiden  mutlulukçu çizgiye  nasıl  evrildiği  ele  alınacaktır.  Bu  amaçla  öncelikle  Mill'in  faydacı  ahlak  anlayışı  genel yönleriyle  ele  alınacak,  ardından  fayda  ilkesinin  Mill'in  faydacı  ahlak  anlayışı  içindeki  konumu, bu  ilke  temelinde  geliştirdiği  mutluluk  kavramı,  mutluluk  kavramına  katkı  yaptığı  ölçüde  bir değer  ifade  ettiğini  savunduğu  haz,  değer,  özgürlük,  karakter  gelişimi,  devlet,  yaptırım  ve adalet kavramları incelenecektir.

  20. 1980 Annual status report: super-SARA

    International Nuclear Information System (INIS)

    1981-01-01

    The essential tasks of the JRC for the SUPERSARA project during 1980 were therefore twofold: 1. Actuation of an international Task Force with which to: a. discuss in depth the test objectives and the relationships between the SSTP and the world mosaic of activities in the field of LWR fuel behaviour; b. establish a consensus test matrix; c. identify and discuss the major technological problems affecting the feasibility of attaining the consensus test objectives, especially for the boil-down SFD tests. A Task Force with these objectives was necessary in order to provide the elements for a Council decision on phase II. 2. Conservation of the rythm of the main contractor (UKAEA-Harwell) and subcontractors for the timely fabrication of loop components and the timely design of those new aspects of the plant necessary for the boil-down SFD tests

  1. John Dewey's Influence on Turkish Education System in the Early Republic Era

    Science.gov (United States)

    Sahin, Mustafa

    2017-01-01

    In this research, the influence of John Dewey's visit to Turkey in 1924, his report on Turkish education system and its influence on Turkish education system in the early republic era were discussed. John Dewey was invited by Ministry of Education in 1924. He made investigations concerning the education system, participated in interviews, and…

  2. Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy

    DEFF Research Database (Denmark)

    Strange, Michael Stewart

    2009-01-01

    Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009......Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009...

  3. Of Curriculum Conceptions, Orientations, and Cultures: A Rejoinder to John E. Hull

    Science.gov (United States)

    Van Brummelen, Harro

    2009-01-01

    In this article, the author presents a rejoinder to John E. Hull. Van Brummelen first states his appreciation of John Hull's thoughtful evaluation of his views of curriculum, views in which many Christian educators have played a part. It has been several decades since the author spelled out what Hull calls an "education for discipleship"…

  4. From Diagnosis, to Life Saving Therapy, to Hollywood: The Journey of John Crowley

    Science.gov (United States)

    Apel, Laura

    2010-01-01

    In February of 2000, "Exceptional Parent" introduced readers to the Crowley family. The author profiled John, Aileen, and their three children: Megan, Patrick, and John Jr. They told "Exceptional Parent" that in 1998 both Megan and Patrick were diagnosed with Pompe disease, a progressive, multisystemic, debilitating, and often fatal muscular…

  5. Does John 17:11b, 21−23 refer to church unity? | Malan | HTS ...

    African Journals Online (AJOL)

    Read as a text of an antisociety, John 17:11b, 21–23 legitimises the unity of the separatist Johannine community, which could have comprised several such communities. This community opposed the Judean religion, Gnosticism, the followers of John the Baptist and three major groups in early Christianity. As text from the ...

  6. Kuus kirja / John Keats ; tlk. Märt Väljataga

    Index Scriptorium Estoniae

    Keats, John

    2004-01-01

    Sisu: Benjamin Bailey'le, 22. novembril 1817 ; George ja Tom Keatsile, 21., 27. (?) detsembril 1817 ; John Taylorile, 27. veebruaril 1818 ; John Hamilton Reynoldsile, 3. mail 1818 ; Richard Woodhouse'ile, 27. oktoobril 1818 ; George ja Georgiana Keatsile, 14. veebruar-3. mai 1819. Saatesõna lk. 84

  7. 76 FR 67206 - Notice of Public Meeting, John Day-Snake Resource Advisory Council

    Science.gov (United States)

    2011-10-31

    ... DEPARTMENT OF THE INTERIOR Bureau of Land Management [LLORV00000.L10200000.DD0000; HAG 12-0022] Notice of Public Meeting, John Day-Snake Resource Advisory Council AGENCY: Bureau of Land Management... (BLM) John Day-Snake Resource Advisory Council (RAC) will meet as indicated below: DATES: The meeting...

  8. 77 FR 16257 - Notice of Public Meeting, John Day-Snake Resource Advisory Council

    Science.gov (United States)

    2012-03-20

    ... DEPARTMENT OF THE INTERIOR Bureau of Land Management [LLORV00000.L10200000.DD0000; HAG 12-0117] Notice of Public Meeting, John Day-Snake Resource Advisory Council AGENCY: Bureau of Land Management... (BLM) John Day-Snake Resource Advisory Council (RAC) will meet as indicated below: DATES: The business...

  9. 76 FR 78691 - Notice of Public Meeting, John Day-Snake Resource Advisory Council

    Science.gov (United States)

    2011-12-19

    ... DEPARTMENT OF THE INTERIOR Bureau of Land Management [LLORV00000.L10200000.DD0000; HAG 12-0056] Notice of Public Meeting, John Day-Snake Resource Advisory Council AGENCY: Bureau of Land Management... (BLM) John Day-Snake Resource Advisory Council (RAC) will meet as indicated below: DATES: The meeting...

  10. Disability in the Family: John and Alice Dewey Raising Their Son Sabino

    Science.gov (United States)

    Danforth, Scot

    2018-01-01

    Background/Context: The current biographic understanding of John Dewey's experience adopting and raising an Italian boy named Sabino emphasizes the theme of finding an emotional replacement for Morris and Gordon, two young sons who had tragically died on family trips to Europe. Lacking is substantive attention to the fact that John Dewey's son had…

  11. Jesus, moral regeneration and crime in the Gospel of John | Ras ...

    African Journals Online (AJOL)

    A structural and text-immanent approach to the Gospel of John reveals that ... regeneration, is, anthropologically-speaking, according to the rational-choice ... In terms of the explicatio-applicatio model, the intended kerygmatic message of John ...

  12. Development of the Dutch Johne's disease control program supported by a simulation model

    NARCIS (Netherlands)

    Groenendaal, H.; Nielen, M.; Hesselink, J.W.

    2003-01-01

    The development of a simulation model, "JohneSSim", was part of a research program aimed at designing a national Johne's disease control program for The Netherlands. Initially, the focus was mainly directed towards different compulsory "test-and-cull" strategies. However, the results from the

  13. Läänemere kallastel / John Allyne Gade ; tõlk. Jonatan Heinap

    Index Scriptorium Estoniae

    Gade, John Allyne

    2008-01-01

    USA erivoliniku John Allyne Gade mälestused 1919. aasta külaskäigust Eestisse. Siin tegutses ta USA valitsuse vahemehena uue Eesti valitsuse, Eesti sõjaväe ning Vene valgete loodearmee vahel. Eestile osutatud teenete eest on ta autasustatud Eesti Vabadusristiga. - Lisa: Eric A. Johnson. John Allyne Gade. Lk. 300-301

  14. 33 CFR 165.720 - Safety/Security Zone: St. Johns River, Jacksonville, FL.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety/Security Zone: St. Johns... OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED... § 165.720 Safety/Security Zone: St. Johns River, Jacksonville, FL. (a) Location. The water and the land...

  15. 76 FR 39890 - St. Johns National Wildlife Refuge, FL; Draft Comprehensive Conservation Plan and Environmental...

    Science.gov (United States)

    2011-07-07

    ... DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R4-R-2011-N053; 40136-1265-0000-S3] St... conservation plan and environmental assessment (Draft CCP/EA) for St. Johns National Wildlife Refuge (NWR) in... Complex, P.O. Box 2683, Titusville, FL 32781, or via e-mail at [email protected] , or St. Johns CCP...

  16. John Smith iz Stuttgarta pereselilsja v Rapla. Sledujushtshaja stantsija - Veneetsia / Ilja Sundelevitsh

    Index Scriptorium Estoniae

    Sundelevitsh, Ilja

    2003-01-01

    John Smithi (Marko Mäetamm ja Kaido Ole) näitusest Tallinna Kunstihoones. John Smithi biograafia. Sirje Helme koostatud näitusest "Leidlaps" galeriis 008 (Tallinna Viru keskuses kaupluse Sity Sokos tühjaksjäänud ruumides). Esile tõstetud Jüri Kase töid

  17. 78 FR 70027 - Senior Executive Service; Performance Review Board

    Science.gov (United States)

    2013-11-22

    ..., WILLIAM N. BURROWS, CHARLES W. BUTTRESS, LARRY D. CADIEUX, GENA E. CALBOS, PHILIP T. CALLAHAN, SAMUEL N..., LARRY N. BELL, MELODY C. BESTANI, ROBERT M. BIENIAWSKI, ANDREW J. BIERBOWER, WILLIAM J. BINKLEY, JOHN S..., STAN M. KEARNEY, JAMES H. KELLY, HENRY C. KELLY, JOHN E. KELLY, LARRY C. KENCHINGTON, HENRY S. KENDELL...

  18. Prostate Cancer Research Trial Helps John Spencer Treat His Cancer | NIH MedlinePlus the Magazine

    Science.gov (United States)

    ... of this page please turn Javascript on. Feature: Prostate Cancer Prostate Cancer Research Trial Helps John Spencer Treat His Cancer ... because of timely detection and treatment of his prostate cancer. He participated in an NIH-sponsored clinical trial. ...

  19. Development of a novel oral vaccine against Mycobacterium avium paratuberculosis and Johne disease

    Science.gov (United States)

    Johnston, C; Coffey, A; Sleator, RD

    2010-01-01

    Mycobacterium avium subsp. paratuberculosis (MAP) is the etiological agent of Johne disease, a granulomatous enteritis of cattle and other domesticated and wild ruminant species. Johne disease is prevalent worldwide and has a significant impact on the global agricultural economy. Current vaccines against Johne are insufficient in stemming its spread, and associated side-effects prevent their widespread use in control programs. Effective and safe vaccine strategies are needed. The main purpose of this paper is to propose and evaluate the development of a novel oral subunit-vaccine using a patho-biotechnological approach. This novel strategy, which harnesses patho-genetic elements from the intracellular pathogen Listeria monocytogenes, may provide a realistic route towards developing an effective next generation subunit vaccine against Johne disease and paratuberculosis. PMID:21326921

  20. The John Milner Nutrition and Cancer Prevention Research Practicum | Division of Cancer Prevention

    Science.gov (United States)

    Attendee Testimonial Plenty of Food for Thought Served Up at the John Milner Nutrition and Cancer Prevention Research Practicum by Julia Tobacyk Media Folder: research_groupView the Testimonial (PDF, 790 KB) Date: March 12-16, 2018 |

  1. Logic, mathematics, philosophy, vintage enthusiasms essays in honour of John L. Bell

    CERN Document Server

    DeVidi, David; Clark, Peter

    2011-01-01

    This book collects papers presented in honor of John L. Bell's 60th birthday. Includes contributions to current philosophical debate, new mathematical results, important historical surveys, and a translation by Wilfrid Hodges of a key work of arabic logic.

  2. Graduate Management Project: An Evaluation of the Johns Hopkins Outpatient Surgery Center Patient Satisfaction Survey

    National Research Council Canada - National Science Library

    Evan, Barry

    1999-01-01

    .... Customer or patient satisfaction is a widely accepted measure of quality. Numerous organizations use satisfaction surveys as the foundation for organizational improvement and the Johns Hopkins Health System is no different...

  3. Astrobiology in an Urban New York City High School: John Dewey High School's Space Science Academy

    Science.gov (United States)

    Fried, B.; Dash, H. B.

    2010-04-01

    John Dewey High School's participation in NASA's MESDT and DLN projects and other partnerships provide opportunities for our diverse population, focusing particular attention to under-represented and under-served groups in the field of Space Science.

  4. Canada as an Immigrant Nation: Implications for Educators Excerpts from an Interview with John Ralston Saul

    Science.gov (United States)

    Education Canada, 2011

    2011-01-01

    This article presents an interview with John Ralston Saul, one of Canada's pre-eminent thinkers. In the interview, Mr. Saul shares his provocative and compelling thoughts on the state of Canada's public education systems.

  5. Children's Rights, "die Antipadagogen," and the Paternalism of John Stuart Mill.

    Science.gov (United States)

    Nordenbo, Sven Erik

    1989-01-01

    Examines how John Stuart Mill would have viewed present-day educational liberalists' claims that children should be included in Mill's principle of individual liberty. Concludes that educational liberalists cannot rightly claim Mill as spokesman for their views. (KO)

  6. John Stuart Mill's "On Liberty": Implications for the Epistemology of the New Rhetoric.

    Science.gov (United States)

    Cherwitz, Richard A.; Hikins, James W.

    1979-01-01

    Discusses John Stuart Mill's nineteenth century treatise and reveals that it embodies the tenets of a sophisticated theory of argument. Makes clear the implications of that theory for contemporary rhetoric. (JMF)

  7. Data collection and evaluation of continuity detail for John James Audubon Bridge No. 61390613004101.

    Science.gov (United States)

    2014-10-01

    This report summarizes findings from monitoring data that was collected over a two-year period from Bridge No. : 61390613004101 in the John James Audubon Project, which was formerly designated as Bridge #2 prior to : construction completion. The brid...

  8. John Sidney McCain III. Elukaptenist sirgus sõjakangelane / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 15. veebr. lk. 9. USA presidendivalimiste vabariiklaste kandidaadi John Sidney McCain III osalemisest Vietnami sõjas ning tegevusest poliitiku ja senati liikmena

  9. Structural Molecular Biology-A Personal Reflection on the Occasion of John Kendrew's 100th Birthday.

    Science.gov (United States)

    Cramer, Patrick

    2017-08-18

    Here, I discuss the development and future of structural molecular biology, concentrating on the eukaryotic transcription machinery and reflecting on John Kendrew's legacy from a personal perspective. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Navigation Study of Lower Lock Approach, John Day Lock and Dam, Columbia River, Oregon

    National Research Council Canada - National Science Library

    Wilson, Donald

    2001-01-01

    Representatives of the Columbia River Towing Association reported recent structural and/or operational changes at John Day Lock and Dam have created difficult navigation conditions for tows entering...

  11. "Issi, sa piat ise usguma et sa osgad!" / John Whitmore ; intervjueerinud Endrik Randoja

    Index Scriptorium Estoniae

    Whitmore, John

    2010-01-01

    Juhtiva coaching'u-eksperdi ja Tartus toimuva personalijuhtimise konverentsi "Uuenev organisatsioon" peaesineja sir John Whitmore'i hinnangul on coaching viis mõista ja toetada inimesi ning tõsta nende eneseusku

  12. Astronaut John Young during final suiting operations for Apollo 10 mission

    Science.gov (United States)

    1969-01-01

    A technician attaches hose from test stand to spacesuit of Astronaut John W. Young, Apollo 10 command module pilot, during final suiting operations for the Apollo 10 lunar orbit mission. Another technician makes adjustment behind Young.

  13. Remembering John Herbert Beynon 29th December 1923 to 24th August 2015

    Czech Academy of Sciences Publication Activity Database

    Boyd, B.; Brenton, G.; Clayton, E.; Curtis, R. M.; Elliot, R. M.; Errock, G. A.; Green, B. N.; Bateman, R. H.; Gaskel, S. J.; Griffiths, I.; Herman, Zdeněk; Jonathan, P.; Kondrat, O.; Lauševič, M.; Lock, Ch.; Mathur, D.; Todd, J.F.J.; Vékey, K.

    2016-01-01

    Roč. 30, č. 11 (2016), s. 1253-1264 ISSN 0951-4198 Institutional support: RVO:61388955 Keywords : John Herbert Beynon * editorial * physical chemistry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.998, year: 2016

  14. Shallow-water Benthic Habitat Map (2013) for Coral Bay, St. John

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This shapefile contains information about the shallow-water (<40 meters) geology and biology of the seafloor in Coral Bay, St. John in the U.S. Virgin Islands...

  15. Võitlev raamatukogutöötaja ja radikaalne uuendaja John Cotton Dana / Eda Pihu

    Index Scriptorium Estoniae

    Pihu, Eda

    2010-01-01

    Dana on ajalukku läinud avariiulite loojana, laste- ja äriraamatukogudele alusepanijana, reklaami kasutajana raamatukogude propageerimisel ühiskonnas ja lugemisharjumuste edendajana. Lisa: John Cotton Dana 12 kuulsat lugemise reeglit

  16. Human radiation studies: Remembering the early years. Oral history of John W. Healy, November 28, 1994

    International Nuclear Information System (INIS)

    1995-05-01

    This document provides a transcript of an interview with John W. Healy concerning his recollections of measuring radioactive effluents at Hanford. Included are comments concerning the 'Green Run', other radioiodine releases, and a release of radioruthenium

  17. Kablilt Casablancasse : Eesti suurim seikleja John Robert Ignace Lepp 100 / Vello Salo

    Index Scriptorium Estoniae

    Salo, Vello, 1925-

    2009-01-01

    Eesti päritolu seikleja John Robert Lepp, Prantsusmaal tuntud kui katoliku kiriku preester Ignace Lepp, avaldas prantsuse ja saksa keeles hulgaliselt raamatuid psühholoogia, filosoofia ja religiooni valdkonnast

  18. SIR JOHN CRAWFORD MEMORIAL ADDRESS: Agriculture: The challenges of the 21st century

    OpenAIRE

    Beddington, Sir John

    2012-01-01

    The Sir John Crawford Memorial Address has been presented since 1985, in honour of the distinguished Australian civil servant, educator and agriculturalist in whose name the Crawford Fund was established. Sir John Crawford was a remarkable Australian who contributed at the highest levels, and was a passionate supporter of international agricultural research for development. This talk draws attention to four current and interrelated trends that suggest the world will be rather different by 202...

  19. Secrets of Thomas Hardy’s Biography: The Attempt of Reading in John Fowles’ Works

    OpenAIRE

    Levytska, Oksana

    2014-01-01

    Hardy’s personality as a writer and a man invariably accompanies John Fowles’ texts, he repeatedly clearly and sometimes with hints and allusions appeals to the creativity of this outstanding writer of the Victorian era, uses as an epigraph quotes from his texts, reveals little known facts of his biography, conducts the biographical analysis of his works, etc. John Fowles’ permanent appeal to Thomas Hardy’s personality the author himself explains by close proximity and affinity of writer's wo...

  20. Review: John S. Saul, Liberation Lite: The Roots of Recolonization in Southern Africa (2011)

    OpenAIRE

    Henning Melber; Dag Hammarskjöld Foundation

    2012-01-01

    Review of the monograph: John S. Saul, Liberation Lite: The Roots of Recolonization in Southern Africa, Trenton, N.J.: Africa World Press, 2011, ISBN 978-1-59221-835-6, 133 pages Besprechung der Monographie: John S. Saul, Liberation Lite: The Roots of Recolonization in Southern Africa, Trenton, N.J.: Africa World Press, 2011, ISBN 978-1-59221-835-6, 133 Seiten