WorldWideScience

Sample records for sara hlupekile longwe

  1. using SARA analysis

    Directory of Open Access Journals (Sweden)

    Oscar Ramirez

    2015-01-01

    Full Text Available La solubilidad del CO2 en un crudo pesado colombiano fue calculada usando la ecuación cúbica de estado de Peng-Robinson y la correlación de Lee-Kesler. El crudo fue representado como una mezcla de pseudo-componentes y para cada uno de ellos se calcularon las propiedades termodinámicas y críticas. Los resultados obtenidos en la representación del crudo con cuatro, cinco y seis pseudocomponentes muestran que todas las representaciones producen resultados similares y por lo tanto el uso de cuatro pseudo-componentes es suficiente y tiene un costo computacional más bajo. Fueron obtenidos excelentes resultados al comparar los datos experimentales y calculados. Para este sistema es suficiente tener una completa caracterización del análisis SARA y usar cuatro pseudo-componentes para modelar adecuadamente el equilibrio líquido-vapor de CO2-crudo pesado.

  2. 2012 SARA Students Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

    2012-07-30

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the

  3. Sharing AIS Related Anomalies (SARA)

    Science.gov (United States)

    2016-03-01

    misconfiguration and intentional misuse. These unintended behaviours generate an abundance of anomalies that the security community has an interest in monitoring...Lastly, the feedback loop formed with clients is essential to SARA’s advancement. The more SARA is exposed, the better and faster it can be adapted...to end-user needs and thus be adopted by them. This section is organised as follows : • Section 2.1 describes the strategy used to identify potential

  4. The SARA REU Site Program

    Science.gov (United States)

    Wood, M. A.; Oswalt, T. D.; SARA Collaboration

    2000-12-01

    We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.

  5. Exon: CBRC-SARA-01-0866 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CCAGGGGGTCACCGGTGTCTGGGTCAGTGGGAccatctctggagtcatgcatACGGCAGTTACTTATCCCATTCACTTCTGTGCCCCCCGcatcattcaccagttcttctgtgacatcCTCCAAGTCCTCCTGCTCTAG ... ...CBRC-SARA-01-0866 atgctcatcatcaccaccacttccctggatgacagtctccagtcccccatgtatttcttcctgaa

  6. Exon: CBRC-SARA-01-0862 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CCAGGGGGTCACCGGTGTCTGGGTCAGTGGGAccatctctggagtcatgcatACGGCAGTTACTTATCCCATTCACTTCTGTGCCCCCCGcatcattcaccagttcttctgtgacatcCTCCAAGTCCTCCTGCTCTAG ... ...CBRC-SARA-01-0862 atgctcatcatcaccaccacttccctggatgacagtctccagtcccccatgtatttcttcctgaa

  7. Experience with the SARA OSL method

    DEFF Research Database (Denmark)

    Mejdahl, V.; Bøtter-Jensen, L.

    1997-01-01

    on the added dose is shown. Advantages of the SARA method is discussed and results obtained using this method for 15 archaeological samples are compared with TL results. A correlation coefficient of 0.967 was found. The test also included comparison of a SARA dare with an archaeomagnetic date for a brick kiln....... Identical results were obtained (1795 +/- 20 AD and 1800 +/- 20 AD, respectively). Similarly. SARA results for 14 sediments are compared with results obtained by TL and IRSL (multiple aliquots)and here the resulting correlation coefficient was 0.983. (C) 1997 Elsevier Science Ltd....

  8. Severe Accident Recriticality Analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  9. Expression, purification, and functional characterization of recombinant PTD-SARA

    Institute of Scientific and Technical Information of China (English)

    Chen Huang; Rui Du; Peng Zhang; Hua Meng; Huiwei Jia; Yang Song; Man Li; Yingqi Zhang; Shiren Sun

    2011-01-01

    The Smad anchor for receptor activation (SARA) protein is a binding partner for Smad2/3 that plays an important role in the fibrotic promoting signaling pathway initiated by transforming growth factor-β1 (TGF-β1). The C-terminal 665-750 aa of SARA comprises the Smad-binding domain (SBD). By direct interaction through the SBD, SARA inhibits Smad2/3 phosphorylation and blocks the interaction between Smad2/3 and Smad4, thereby restrains the process of fibrosis.In this study, we constructed a SARA peptide aptamer based on the SBD sequence. The recombinant SARA aptamer,fused with a protein transduction domain (PTD-SARA), was cloned, purified from E. coli, and characterized for the first time. The full-length PTD-SARA coding sequence, created with E. coli favored codons, was cloned into a pQE-30 vector,and the recombinant plasmid was transformed into an M15 strain. After Isopropyl β-D-1-Thiogalactopyranoside (IPTG) induction and Ni2+ affinity purification, recombinant PTD-SARA was further identified by immunobiotting and protein N-terminal sequencing. Epifluorescence microscopy revealed that the recombinant PTD-SARA was transferred into the cytoplasm and nucleus more efficiently than SARA.Moreover, the recombinant PTD-SARA was found to up-regulate the level of E-cadherin and down-regulate the levels of α-SMA and phospho-Smad3 more efficiently than SARA (P< 0.05). Our work explored a method to obtain recombinant PTD-SARA protein. The recombinant PTDSARA fusion protein could enter HK2 cells (an immortalized proximal tubule epithelial cell line) more efficiently than the SARA protein and reverse the renal epithelial-to-mesenchymal transdifferentiation process that was induced by TGF-β1 more effectively than the SARA protein. Recombinant PDT-SARA is likely to be a potential candidate for clinical prevention and treatment of renal fibrosis.

  10. Exon: CBRC-SARA-01-1228 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1228 ATGTGgttttgctgttgttcttttctactgtggggatcaagcctgggtctccTATATGCAAGCCA...TAATATGCCCCGCCCTGCAGCTgtgtttttccctccctccctcccagctttccttccttccttccttccttccttccttccttccttccttccttccttccttccttccttccttccttccttccttccttcc...ttccttccttccttccttccttccttccttcctgccttccttcctgccttcctgccttccttcctccctcccttcctcccttccttcctgccttccttcctccctcc...cttcctcccttccttcctccctcccttccttccttccttccttccttccttccttccttccttccttccttccttccttcc...ttccttccttccttccttccttccttcctcccttcctgccttcctgccttttttccttttttctttttcttcctgtctgtctgt

  11. Aqueous SARA ATRP using Inorganic Sulfites.

    Science.gov (United States)

    Abreu, Carlos M R; Fu, Liye; Carmali, Sheiliza; Serra, Arménio C; Matyjaszewski, Krzysztof; Coelho, Jorge F J

    2017-01-14

    Aqueous supplemental activator and reducing agent atom transfer radical polymerization (SARA ATRP) using inorganic sulfites was successfully carried out for the first time. Under optimized conditions, a well-controlled poly[oligo(ethylene oxide) methyl ether acrylate] (POEOA) was obtained with sulfites (e.g. Na2S2O4) were continuously fed into the reaction mixture. The mechanistic studies proved that these salts can activate alkyl halides directly and regenerate the activator complex. The effects of the feeding rate of the SARA agent (inorganic sulfites), ligand and its concentration, halide salt and its concentration, sulfite used, and copper concentration, were systematically studied to afford fast polymerizations rates while maintaining the control over polymerization. The kinetic data showed linear first-order kinetics, linear evolution of molecular weights with conversion, and polymers with narrow molecular weight distributions (Đ ~1.2) during polymerization even at relatively high monomer conversions (~80%). "One-pot" chain extension and "one-pot" block copolymerization experiments proved the high chain-end functionality. The polymerization could be directly regulated by starting or stopping the continuous feeding of the SARA agent. Under biologically relevant conditions, the aqueous SARA ATRP using inorganic sulfites was used to synthesize a well-defined protein-polymer hybrid by grafting of P(OEOA480) from BSA-O-[iBBr]30.

  12. SARA: a server for function annotation of RNA structures.

    Science.gov (United States)

    Capriotti, Emidio; Marti-Renom, Marc A

    2009-07-01

    Recent interest in non-coding RNA transcripts has resulted in a rapid increase of deposited RNA structures in the Protein Data Bank. However, a characterization and functional classification of the RNA structure and function space have only been partially addressed. Here, we introduce the SARA program for pair-wise alignment of RNA structures as a web server for structure-based RNA function assignment. The SARA server relies on the SARA program, which aligns two RNA structures based on a unit-vector root-mean-square approach. The likely accuracy of the SARA alignments is assessed by three different P-values estimating the statistical significance of the sequence, secondary structure and tertiary structure identity scores, respectively. Our benchmarks, which relied on a set of 419 RNA structures with known SCOR structural class, indicate that at a negative logarithm of mean P-value higher or equal than 2.5, SARA can assign the correct or a similar SCOR class to 81.4% and 95.3% of the benchmark set, respectively. The SARA server is freely accessible via the World Wide Web at http://sgu.bioinfo.cipf.es/services/SARA/.

  13. Sara endosomes and the asymmetric division of intestinal stem cells.

    Science.gov (United States)

    Montagne, Chrystelle; Gonzalez-Gaitan, Marcos

    2014-05-01

    Tissue homeostasis is maintained by adult stem cells, which self-renew and give rise to differentiating cells. The generation of daughter cells with different fates is mediated by signalling molecules coming from an external niche or being asymmetrically dispatched between the two daughters upon stem cell mitosis. In the adult Drosophila midgut, the intestinal stem cell (ISC) divides to generate a new ISC and an enteroblast (EB) differentiating daughter. Notch signalling activity restricted to the EB regulates intestinal cell fate decision. Here, we show that ISCs divide asymmetrically, and Sara endosomes in ISCs are specifically dispatched to the presumptive EB. During ISC mitosis, Notch and Delta traffic through Sara endosomes, thereby contributing to Notch signalling bias, as revealed in Sara mutants: Sara itself contributes to the control of the ISC asymmetric division. Our data uncover an intrinsic endosomal mechanism during ISC mitosis, which participates in the maintenance of the adult intestinal lineage.

  14. Sensor Activation and Radius Adaptation (SARA) in Heterogeneous Sensor Networks

    CERN Document Server

    Bartolini, Novella; la Porta, Thomas; Petrioli, Chiara; Silvestri, Simone

    2010-01-01

    In this paper we address the problem of prolonging the lifetime of wireless sensor networks (WSNs) deployed to monitor an area of interest. In this scenario, a helpful approach is to reduce coverage redundancy and therefore the energy expenditure due to coverage. We introduce the first algorithm which reduces coverage redundancy by means of Sensor Activation and sensing Radius Adaptation (SARA)in a general applicative scenario with two classes of devices: sensors that can adapt their sensing range (adjustable sensors) and sensors that cannot (fixed sensors). In particular, SARA activates only a subset of all the available sensors and reduces the sensing range of the adjustable sensors that have been activated. In doing so, SARA also takes possible heterogeneous coverage capabilities of sensors belonging to the same class into account. It specifically addresses device heterogeneity by modeling the coverage problem in the Laguerre geometry through Voronoi-Laguerre diagrams. SARA executes quickly and is guarante...

  15. Gene : CBRC-SARA-01-1782 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1782 Novel UN A Family fz/smo receptors FZD6_CANFA 0.0 88% ref|XP_0014...GTSAIAITSHDYLGQETATEMQTSPDTSARDMRTEGVSTPNKLREQEGVEPASSPAASSVRLCGDQADRPGRAGTVHDKISLSGSARSEGRATPRSEVADSGPAPGNLLQVPSSSKPSSLKGSASLLPQSASEAREEQGAGT ...

  16. Gene : CBRC-SARA-01-1760 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1760 Novel UN C UNKNOWN ZNFX1_HUMAN 1e-17 95% ref|XP_589621.3| PREDICT...VCGQNVLSQDMVESAAASLASIVPWFLPCFARLRVFRSVLTLGVILLRLCSLYFISAAYLQFFPACQTSSSHAVPLPRICFFSPLCFSPNPSILSARSPPFRPTLLITFTQ ...

  17. UCLA SARA (System Architect's Apprentice) demonstration

    Energy Technology Data Exchange (ETDEWEB)

    Fenchel, R.S.; Razouk, R.R.

    1978-06-01

    A sample session with the SARA system is given. The system is a set of design and modeling tools which are implemented on the MIT-Multics computer system. This demonstration is intended to acquaint all interested persons with the state of implementation of the SARA system and the flavor of its use. The system is currently under implementation; however, all the demonstrated tools are available to any user with access to the MIT-Multics system. Additional tools will soon be available.

  18. The relationship between SARA fractions and crude oil stability

    Directory of Open Access Journals (Sweden)

    Siavash Ashoori

    2017-03-01

    Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.

  19. Det udstødtes poesi hos Sara Stridsberg

    DEFF Research Database (Denmark)

    Rösing, Lilian Munk

    2014-01-01

    Det synes at være et gennemgående projekt i Sara Stridsbergs forfatterskab at genoprejse en række upopulære, eller i hvert fald tvivlsomme og angribelige, kvindeskikkelser – hvad enten vi taler om historiske personer eller fiktive karakterer: Sally Bauer, Valerie Solanas, Medea, Lolita. Artiklen...

  20. Gene : CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 UN A Cannabinoids receptors CNR1_RAT 0.0 97% ref|XP_001503797.1| ...PREDICTED: similar to central cannabinoid receptor isoform 1 [Equus caballus] 0.0 98% MKSILDGLADTTFRTITTDLLY...IHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL ...

  1. Det udstødtes poesi hos Sara Stridsberg

    DEFF Research Database (Denmark)

    Rösing, Lilian Munk

    2014-01-01

    Det synes at være et gennemgående projekt i Sara Stridsbergs forfatterskab at genoprejse en række upopulære, eller i hvert fald tvivlsomme og angribelige, kvindeskikkelser – hvad enten vi taler om historiske personer eller fiktive karakterer: Sally Bauer, Valerie Solanas, Medea, Lolita. Artiklen...

  2. Apocalipsis XX di Sara de Ibáñez

    Directory of Open Access Journals (Sweden)

    Stefano Tedeschi

    2013-06-01

    Full Text Available Rewriting the text of Saint John, Sara de Ibáñez uses a kind of style innovative and away from schools and trends in vogue: is thus able able to evoke the tragic experiences of the twentieth century, but the date of publication of the book (1970 reveals that it advances in themes and forms the concrete apocalypse lived by Uruguay and Latin America in the seventies. However, far from political themes and motifs, Sara de Ibáñez is able to express the absolute horror of contemporary tragedies and to propose a poetic reflection of great quality. This article suggests a rediscovery of this twentieth-century poetic voice, unjustly forgotten, through her 'apocalyptic' text.

  3. Placeres, amores y viajes en Demasiado amor de Sara Sefchovich

    Directory of Open Access Journals (Sweden)

    Paula Daniela Bianchi

    2012-06-01

    Full Text Available The purpose of this paper is to investigate the construction of the prostitute female body where we analyze some strands of the circulation of pleasure, bodies, money and sexual intercourse in Demasiado amor (1990, Agustín Yáñez by Mexican writer Sara Sefchovich. Starting from a journey, of the protagonist of the novel, as nomadism and as a geographical corporal and internal displacement, the journey is seen as a deterritorialization of the body and the subjectivity.

  4. Placeres, amores y viajes en Demasiado amor de Sara Sefchovich

    OpenAIRE

    Paula Daniela Bianchi

    2012-01-01

    The purpose of this paper is to investigate the construction of the prostitute female body where we analyze some strands of the circulation of pleasure, bodies, money and sexual intercourse in Demasiado amor (1990, Agustín Yáñez) by Mexican writer Sara Sefchovich. Starting from a journey, of the protagonist of the novel, as nomadism and as a geographical corporal and internal displacement, the journey is seen as a deterritorialization of the body and the subjectivity.

  5. Subacute ruminal acidosis (SARA) challenge, ruminal condition and cellular immunity in cattle.

    Science.gov (United States)

    Sato, Shigeru

    2015-02-01

    Subacute ruminal acidosis (SARA) is characterized by repeated bouts of low ruminal pH. Cows with SARA often develop complications or other diseases, and associate physiologically with immunosuppression and inflammation. Ruminal free lipopolysaccharide (LPS) increases during SARA and translocates into the blood circulation activating an inflammatory response. Ruminal fermentation and cellular immunity are encouraged by supplementing hay with calf starter during weaning. SARA calves given a 5-day repeated administration of a bacteria-based probiotic had stable ruminal pH levels (6.6-6.8). The repeated administration of probiotics enhance cellular immune function and encourage recovery from diarrhea in pre-weaning calves. Furthermore, the ruminal fermentation could guard against acute and short-term feeding changes, and changes in the rumen microbial composition of SARA cattle might occur following changes in ruminal pH. The repeated bouts of low ruminal pH in SARA cattle might be associated with depression of cellular immunity.

  6. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.;

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers...... for the diagnosis of SARA are needed. The goal of this study was to evaluate clinical signs of SARA and to investigate the use of blood, faecal and urinary parameters as indicators of SARA. Six lactating, rumen cannulated, Danish Holstein cows were used in a cross-over study with three periods. The first and second...... periods included two cows on control diet and two cows on nutritional SARA challenge. The third period only included two cows on SARA challenge. Control diet was a conventional total mixed ration [45.5% dry matter (DM), 17.8% crude protein, 43.8% neutral detergent fibre, and 22.5% acid detergent fibre (DM...

  7. Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

    Directory of Open Access Journals (Sweden)

    M. Sidi Ritau'din

    2017-06-01

    Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.

  8. SarA positively controls bap-dependent biofilm formation in Staphylococcus aureus.

    Science.gov (United States)

    Trotonda, María Pilar; Manna, Adhar C; Cheung, Ambrose L; Lasa, Iñigo; Penadés, José R

    2005-08-01

    The biofilm-associated protein Bap is a staphylococcal surface protein involved in biofilm formation. We investigated the influence of the global regulatory locus sarA on bap expression and Bap-dependent biofilm formation in three unrelated Staphylococcus aureus strains. The results showed that Bap-dependent biofilm formation was diminished in the sarA mutants by an agr-independent mechanism. Complementation studies using a sarA clone confirmed that the defect in biofilm formation was due to the sarA mutation. As expected, the diminished capacity to form biofilms in the sarA mutants correlated with the decreased presence of Bap in the bacterial surface. Using transcriptional fusion and Northern analysis data, we demonstrated that the sarA gene product acts as an activator of bap expression. Finally, the bap promoter was characterized and the transcriptional start point was mapped by the rapid amplification of cDNA ends technique. As expected, we showed that purified SarA protein binds specifically to the bap promoter, as determined by gel shift and DNase I footprinting assays. Based on the previous studies of others as well as our work demonstrating the role for SarA in icaADBC and bap expression, we propose that SarA is an essential regulator controlling biofilm formation in S. aureus.

  9. Gene : CBRC-SARA-01-1167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ctin receptor 1 isoform 3 [Macaca mulatta] ref|XP_001105751.1| PREDICTED: similar to adiponectin... receptor 1 isoform 4 [Macaca mulatta] ref|XP_001105805.1| PREDICTED: similar to adiponectin re...ceptor 1 isoform 5 [Macaca mulatta] ref|XP_001105878.1| PREDICTED: similar to adiponectin... receptor 1 isoform 6 [Macaca mulatta] ref|XP_001105957.1| PREDICTED: similar to adiponectin recepto...CBRC-SARA-01-1167 Novel UN B UNKNOWN ADR1_HUMAN 1e-139 67% ref|XP_001105680.1| PREDICTED: similar to adipone

  10. Factors contributing to the biofilm-deficient phenotype of Staphylococcus aureus sarA mutants.

    Directory of Open Access Journals (Sweden)

    Laura H Tsang

    Full Text Available Mutation of sarA in Staphylococcus aureus results in a reduced capacity to form a biofilm, but the mechanistic basis for this remains unknown. Previous transcriptional profiling experiments identified a number of genes that are differentially expressed both in a biofilm and in a sarA mutant. This included genes involved in acid tolerance and the production of nucleolytic and proteolytic exoenzymes. Based on this we generated mutations in alsSD, nuc and sspA in the S. aureus clinical isolate UAMS-1 and its isogenic sarA mutant and assessed the impact on biofilm formation. Because expression of alsSD was increased in a biofilm but decreased in a sarA mutant, we also generated a plasmid construct that allowed expression of alsSD in a sarA mutant. Mutation of alsSD limited biofilm formation, but not to the degree observed with the corresponding sarA mutant, and restoration of alsSD expression did not restore the ability to form a biofilm. In contrast, concomitant mutation of sarA and nuc significantly enhanced biofilm formation by comparison to the sarA mutant. Although mutation of sspA had no significant impact on the ability of a sarA mutant to form a biofilm, a combination of protease inhibitors (E-64, 1-10-phenanthroline, and dichloroisocoumarin that was shown to inhibit the production of multiple extracellular proteases without inhibiting growth was also shown to enhance the ability of a sarA mutant to form a biofilm. This effect was evident only when all three inhibitors were used concurrently. This suggests that the reduced capacity of a sarA mutant to form a biofilm involves extracellular proteases of all three classes (serine, cysteine and metalloproteases. Inclusion of protease inhibitors also enhanced biofilm formation in a sarA/nuc mutant, with the combined effect of mutating nuc and adding protease inhibitors resulting in a level of biofilm formation with the sarA mutant that approached that of the UAMS-1 parent strain. These results

  11. Low energy neutral atom imaging on the Moon with the SARA instrument aboard Chandrayaan-1 mission

    Indian Academy of Sciences (India)

    Anil Bhardwaj; Stas Barabash; Yoshifumi Futaana; Yoichi Kazama; Kazushi Asamura; David McCann; R Sridharan; Mats Holmstrom; Peter Wurz; Rickard Lundin

    2005-12-01

    This paper reports on the Sub-keV Atom Reflecting Analyzer (SARA)experiment that will be flown on the first Indian lunar mission Chandrayaan-1.The SARA is a low energy neutral atom (LENA)imaging mass spectrometer,which will perform remote sensing of the lunar surface via detection of neutral atoms in the energy range from 10 eV to 3 keV from a 100 km polar orbit.In this report we present the basic design of the SARA experiment and discuss various scientific issues that will be addressed.The SARA instrument consists of three major subsystems:a LENA sensor (CENA),a solar wind monitor (SWIM),and a digital processing unit (DPU).SARA will be used to image the solar wind –surface interaction to study primarily the surface composition and surface magnetic anomalies and associated mini-magnetospheres.Studies of lunar exosphere sources and space weathering on the Moon will also be attempted.SARA is the first LENA imaging mass spectrometer of its kind to be flown on a space mission.A replica of SARA is planned to fly to Mercury onboard the BepiColombo mission.

  12. Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

    Directory of Open Access Journals (Sweden)

    Jessica N Snowden

    Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.

  13. System Analysis and Risk Assessment system (SARA) Version 4.0

    Energy Technology Data Exchange (ETDEWEB)

    Sattison, M B; Russell, K D; Skinner, N L [EG and G Idaho, Inc., Idaho Falls, ID (United States)

    1992-01-01

    This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family (i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed). A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis.

  14. SarA influences the sporulation and secondary metabolism in Streptomyces coelicolor M145

    Institute of Scientific and Technical Information of China (English)

    Xijun Ou; Bo Zhang; Lin Zhang; Kai Dong; Chun Liu; Guoping Zhao; Xiaoming Ding

    2008-01-01

    The filamentous bacteria Streptomyces exhibit a complex life cycle involving morphological differentiation and secondary metabolism. A putative membrane protein gene sarA (sco4069), sporulation and antibiotic production related gene A, was partially characterized in Streptomyces coelicolor M145. The gene product had no characterized functional domains and was highly conserved in Streptomyces. Compared with the wild-type M145, the sarA mutant accelerated sporulation and dramatically decreased the production of actinorhodin and undecylprodigiosin.Reverse transcription-polymerase chain reaction analysis showed that SarA influenced antibiotic production by controlling the abundance of actll-orf4 and redZ messenger RNA.

  15. Sara, a patient with borderline personality structure: A "crisis" management

    Directory of Open Access Journals (Sweden)

    Paola Marinelli

    2015-05-01

    Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma. 

  16. PDB: CBRC-SARA-01-0838 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0838 3ODU,3OE0,3OE6,3OE8,3OE9, Region:8-324(Identity=89%) PDB:3ODU Chain:A (X-ray Resolution...=2.5),Region:8-324(Identity=89%) PDB:3OE0 Chain:A (X-ray Resolution=2.9),Region:8-330(...Identity=90%) PDB:3OE6 Chain:A (X-ray Resolution=3.2),Region:8-324(Identity=89%) PDB:3OE8 Chain:A (X-ray Resolution...=3.1),Region:8-324(Identity=89%) PDB:3OE9 Chain:A (X-ray Resolution=3.1), ...

  17. Depression of biofilm formation and antibiotic resistance by sarA disruption in Staphylococcus epidermidis

    Institute of Scientific and Technical Information of China (English)

    Ju-Hong Tao; Chang-Sheng Fan; Shan-E Gao; Hai-Jiao Wang; Guo-Xin Liang; Qing Zhang

    2006-01-01

    AIM: To study the effects of disruption of sarA gene on biofilm formation and antibiotic resistance of Staphylococcus epidermidis (S. epidermidis ).METHODS: In order to disrupt sarA gene, the doublecrossover homologous recombination was applied in S. epidermidis RP62A, and tetracycline resistance gene (tet) was used as the selective marker which was amplified by PCR from the pBR322 and inserted into the locus between sarA upstream and downstream,resulting in pBT2△sarA. By electroporation, the plasmid pBT2△sarA was transformed into S. epidermidis.Gene transcription was detected by real-time reverse transcription-PCR (RT-PCR). Determination of biofilm was performed in 96-well flat-bottomed culture plates, and antibiotic resistance was analyzed with test tube culture by spectrophotometry at 570 nm respectively.RESULTS: A sarA disrupted strain named S. epidermidis RP62A△sarA was constructed, which was completely defective in biofilm formation, while the sarA complement strain RP62A△sarA (pHPS9sarA) restored the biofilm formation phenotype. Additionally, the knockout of sarA resulted in decreased erythromycin and kanamycin resistance of S. epidermidis RP62A. Compared to the original strain, S. epidermidis RP62A△sarA had an increase of the sensitivity to erythromycin at 200-400 μg/mL and kanamycin at 200-800 μg/mL respectively.CONCLUSION: The knockout of sarA can result in the defect in biofilm formation and the decreased erythromycin and kanamycin resistance in S. epidermidis RP62A.

  18. SarA and not sigmaB is essential for biofilm development by Staphylococcus aureus.

    Science.gov (United States)

    Valle, Jaione; Toledo-Arana, Alejandro; Berasain, Carmen; Ghigo, Jean-Marc; Amorena, Beatriz; Penadés, José R; Lasa, Iñigo

    2003-05-01

    Staphylococcus aureus biofilm formation is associated with the production of the polysaccharide intercellular adhesin (PIA/PNAG), the product of the ica operon. The staphylococcal accessory regulator, SarA, is a central regulatory element that controls the production of S. aureus virulence factors. By screening a library of Tn917 insertions in a clinical S. aureus strain, we identified SarA as being essential for biofilm development. Non-polar mutations of sarA in four genetically unrelated S. aureus strains decreased PIA/PNAG production and completely impaired biofilm development, both in steady state and flow conditions via an agr-independent mechanism. Accordingly, real-time PCR showed that the mutation in the sarA gene resulted in downregulation of the ica operon transcription. We also demonstrated that complete deletion of sigmaB did not affect PIA/PNAG production and biofilm formation, although it slightly decreased ica operon transcription. Furthermore, the sarA-sigmaB double mutant showed a significant decrease of ica expression but an increase of PIA/PNAG production and biofilm formation compared to the sarA single mutant. We propose that SarA activates S. aureus development of biofilm by both enhancing the ica operon transcription and suppressing the transcription of either a protein involved in the turnover of PIA/PNAG or a repressor of its synthesis, whose expression would be sigmaB-dependent.

  19. Single-access retroperitoneoscopic adrenalectomy (SARA) versus conventional retroperitoneoscopic adrenalectomy (CORA): a case-control study.

    Science.gov (United States)

    Walz, Martin K; Groeben, Harald; Alesina, Piero F

    2010-06-01

    Stimulated by the concept of Natural Orifice Transluminal Endoscopic Surgery (NOTES), minimizing the access even further has become a new trend in minimally invasive surgery. We compare our recently described new method of endoscopic single-access adrenalectomy with the conventional retroperitoneoscopic approach in a matched-pairs study. Fifty single-access retroperitoneoscopic adrenalectomies (SARA) were performed in 47 selected patients suffering from Conn's adenomas (n = 20), pheochromocytomas (n = 15), Cushing's adenomas (n = 6), and other diseases (n = 6). For SARA, a single 2-cm skin incision beneath the 12th rib was used. Following creation of the retroperitoneal space with the rigid endoscope, dissection was carried out single-handed. Another 47 patients served as control group; they were treated by the traditional retroperitoneoscopic three-port approach (CORA). Patients were matched with respect to gender, body mass index, diagnoses, tumor size, and tumor site. Mortality was zero and no major complications occurred in both groups. SARA was completed in 41 cases (86%). The overall complication rate was 8.5% in SARA and 6.4% in CORA. Operative time was longer for SARA (56 +/- 28 min) than for CORA (40 +/- 12 min) (P CORA patients (P = 0.01). Mean hospital stay was 2.4 +/- 0.7 days (SARA) and 3.1 +/- 1.2 days (CORA) (P < 0.01). Because feasibility and safety of SARA could be demonstrated in a large group of selected patients, this surgical technique may represent a new milestone in minimally invasive endocrine surgery.

  20. Directional Notch trafficking in Sara endosomes during asymmetric cell division in the spinal cord.

    Science.gov (United States)

    Kressmann, Sabine; Campos, Claudia; Castanon, Irinka; Fürthauer, Maximilian; González-Gaitán, Marcos

    2015-03-01

    Asymmetric division of neural precursor cells contributes to the generation of a variety of neuronal types. Asymmetric division is mediated by the asymmetric inheritance of fate determinants by the two daughter cells. In vertebrates, asymmetric fate determinants, such as Par3 and Mib, are only now starting to be identified. Here we show that, during mitosis of neural precursors in zebrafish, directional trafficking of Sara endosomes to one of the daughters can function as such a determinant. In asymmetric lineages, where one daughter cell becomes a neuron (n cell) whereas the other divides again to give rise to two neurons (p cell), we found that the daughter that inherits most of the Sara endosomes acquires the p fate. Sara endosomes carry an endocytosed pool of the Notch ligand DeltaD, which is thereby itself distributed asymmetrically. Sara and Notch are both essential for cell fate assignation within asymmetric lineages. Therefore, the Sara endosome system determines the fate decision between neuronal differentiation and mitosis in asymmetric lineages and thereby contributes to controlling the number of neural precursors and differentiated neurons during neurogenesis in a vertebrate.

  1. ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

    Directory of Open Access Journals (Sweden)

    Sulistyastuti Sutomo

    2015-01-01

    Full Text Available Not only does art   have   self-fullfillment, but  it also has axiological  benefits both socially, culturally, religiously, and economiclally.  So does Sara Douda dance.  Sara Douda aesthetics  is first contained  in its whole dance movements. In addition, it  can also be found in the whole dance equipments.  Moreover,  this dance aesthetics  may  also be contained in the verbal symbols in the speech forms  prior to the dance performance. However,  both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and  religious values in the Loli community about  their honoring their ancestors,  having social harmony, and  highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance.   Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1986 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1986 ref|YP_001391163.1| hypothetical protein CLI_1905 [Clostridium botulinum F str. Langel...and] gb|ABS40017.1| hypothetical protein CLI_1905 [Clostridium botulinum F str. Langeland] YP_001391163.1 3.1 34% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1177 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1177 ref|XP_592012.3| PREDICTED: similar to Sphingomyelin phosphodiest...erase 3 (Neutral sphingomyelinase 2) (Neutral sphingomyelinase II) (nSMase2) (nSMase-2) (Confluent 3Y1 cell-associated protein 1) isoform 1 [Bos taurus] XP_592012.3 7.4 33% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-2020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-2020 ref|YP_857334.1| exopolyphosphatase [Aeromonas hydrophila subsp. hydrop...hila ATCC 7966] gb|ABK35937.1| exopolyphosphatase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] YP_857334.1 5.5 42% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1116 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1116 gb|AAC62470.1| chemokine receptor CCR5 [Cercocebus torquatus torq...uatus] gb|AAC62473.1| chemokine receptor CCR5 [Cercocebus torquatus torquatus] AAC62470.1 3e-72 86% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-0200 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0200 ref|NP_036900.1| dopamine receptor D5 [Rattus norvegicus] sp|P25115|DRD5_RAT D(1B) dopamin...e receptor (D(5) dopamine receptor) gb|AAA41072.1| dopamine D1B receptor NP_036900.1 3e-47 59% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-0834 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0834 ref|NP_036900.1| dopamine receptor D5 [Rattus norvegicus] sp|P25115|DRD5_RAT D(1B) dopamin...e receptor (D(5) dopamine receptor) gb|AAA41072.1| dopamine D1B receptor NP_036900.1 3e-47 59% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1766 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1766 ref|NP_776833.1| opioid receptor, mu 1 [Bos taurus] sp|P79350|OPRM_BOVIN Mu-type opioid... receptor (MOR-1) gb|AAB49477.2| mu opioid receptor [Bos taurus] NP_776833.1 0.0 91% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1766 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1766 ref|NP_001029087.1| opioid receptor, mu 1 [Pan troglodytes] sp|Q5...IS39|OPRM_PANTR Mu-type opioid receptor (MOR-1) gb|AAV74327.1| opioid receptor MU-1 [Pan troglodytes] NP_001029087.1 0.0 90% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0854 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0854 gb|EAW79490.1| calcium-sensing receptor (hypocalciuric hypercalcemia 1, severe neonatal...eptor (hypocalciuric hypercalcemia 1, severe neonatal hyperparathyroidism), isoform CRA_c [Homo sapiens] EAW79490.1 0.0 90% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|NP_965427.1| hypothetical protein LJ1621 [Lactobacillus johnson...ii NCC 533] gb|AAS09393.1| hypothetical protein LJ_1621 [Lactobacillus johnsonii NCC 533] NP_965427.1 0.12 24% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1366 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1366 gb|AAI40135.1| Olfactory receptor 1239 [synthetic construct] gb|A...AI40175.1| Olfactory receptor 1239 [synthetic construct] gb|AAI43150.1| Olfactory receptor 1239 [synthetic construct] AAI40135.1 2e-80 82% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Roseo...varius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0832 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0832 ref|ZP_01585795.1| Polyphosphate kinase [Dinoroseobacter shibae D...FL 12] gb|ABV92485.1| Polyphosphate kinase [Dinoroseobacter shibae DFL 12] ZP_01585795.1 1.8 28% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-0832 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0832 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Roseo...varius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01585795.1| Polyphosphate kinase [Dinoroseobacter shibae D...FL 12] gb|ABV92485.1| Polyphosphate kinase [Dinoroseobacter shibae DFL 12] ZP_01585795.1 1.8 28% ...

  19. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.;

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0590 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0590 ref|NP_297344.1| hypothetical protein XF0051 [Xylella fastidiosa ...9a5c] gb|AAF82864.1|AE003859_5 hypothetical protein XF_0051 [Xylella fastidiosa 9a5c] NP_297344.1 8e-19 51% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0430 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0430 ref|NP_878187.1| NADH dehydrogenase subunit 1 [Fejervarya limnoch...aris] gb|AAO12107.1| NADH dehydrogenase subunit 1 [Fejervarya limnocharis] NP_878187.1 2.5 29% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1095 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1095 ref|XP_001231930.1| PREDICTED: similar to claudin 14b [Gallus gal...lus] ref|XP_001231960.1| PREDICTED: similar to claudin 14b [Gallus gallus] XP_001231930.1 6e-34 37% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1648 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1648 ref|NP_694727.1| histamine H4 receptor [Mus musculus] gb|AAK97380.1|AF358859_1 histamine... H4 receptor [Mus musculus] gb|EDL01579.1| histamine H4 receptor [Mus musculus] NP_694727.1 1e-129 61% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...

  5. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    day of the control period, and first and last day of full SARA-feeding. DNA was extracted and V4 region of bacterial 16S rRNA amplified and subjected to Illumina sequencing. Data was analyzed using QIIME pipelines and resultant operational taxonomic units (OTUs) were aligned to Greengenes database...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...

  8. The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    Descriptions of two new sepcies Anchialina labatus and Gastrosaccus sarae, are give. A. lobatus is distinguished from the other species of the genus by the presence of a hairy lobe on the first segment of the antennule, by the modified setae...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1922 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1922 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-126 73% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1922 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1922 ref|NP_001038074.1| putative melanin concentrating hormone recept...or 2 [Sus scrofa] emb|CAJ55683.1| putative melanin concentrating hormone receptor 2 [Sus scrofa] NP_001038074.1 1e-129 73% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-0303 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0303 ref|YP_001109469.1| valine-pyruvate aminotransferase [Saccharopol...yspora erythraea NRRL 2338] emb|CAM06544.1| valine-pyruvate aminotransferase [Saccharopolyspora erythraea NRRL 2338] YP_001109469.1 5.0 33% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-0991 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0991 ref|YP_873218.1| chitinase. Glycosyl Hydrolase family 18. [Acidot...hermus cellulolyticus 11B] gb|ABK53232.1| chitinase. Glycosyl Hydrolase family 18. [Acidothermus cellulolyticus 11B] YP_873218.1 9.3 29% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-0775 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0775 ref|ZP_01788010.1| multidrug resistance protein [Haemophilus influenza...e 3655] gb|EDJ93712.1| multidrug resistance protein [Haemophilus influenzae 3655] ZP_01788010.1 0.22 27% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-0775 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0775 ref|ZP_01792636.1| multidrug resistance protein [Haemophilus influenza...e PittHH] gb|EDK09769.1| multidrug resistance protein [Haemophilus influenzae PittHH] ZP_01792636.1 0.22 27% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0775 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0775 ref|ZP_01797490.1| multidrug resistance protein [Haemophilus influenza...e R3021] gb|EDK13267.1| multidrug resistance protein [Haemophilus influenzae 22.4-21] ZP_01797490.1 0.22 27% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-0775 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0775 ref|ZP_01785759.1| multidrug resistance protein [Haemophilus influenza...e 22.4-21] gb|EDJ91681.1| multidrug resistance protein [Haemophilus influenzae R3021] ZP_01785759.1 0.22 27% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-0775 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0775 ref|ZP_01789776.1| multidrug resistance protein [Haemophilus influenza...e PittAA] gb|EDK08502.1| multidrug resistance protein [Haemophilus influenzae PittAA] ZP_01789776.1 0.22 27% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-0775 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0775 ref|YP_248596.1| multidrug resistance protein [Haemophilus influenza...e 86-028NP] gb|AAX87936.1| multidrug resistance protein [Haemophilus influenzae 86-028NP] YP_248596.1 0.22 27% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_026098.1| NADH dehydrogenase subunit 5 [Habronattus oregon...ensis] gb|AAT02495.1| NADH dehydrogenase subunit 5 [Habronattus oregonensis] YP_026098.1 0.032 22% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0491 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0491 ref|YP_001517065.1| hypothetical protein AM1_2749 [Acaryochloris marina... MBIC11017] gb|ABW27749.1| conserved hypothetical protein [Acaryochloris marina MBIC11017] YP_001517065.1 2e-13 45% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1485 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1485 ref|YP_001518234.1| pentapeptide repeat domain protein [Acaryochloris marina... MBIC11017] gb|ABW28917.1| pentapeptide repeat domain protein [Acaryochloris marina MBIC11017] YP_001518234.1 1.9 43% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-0594 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0594 ref|NP_937902.1| NADH dehydrogenase subunit 5 [Strongyloides stercoral...is] emb|CAD90562.1| NADH dehydrogenase subunit 5 [Strongyloides stercoralis] NP_937902.1 3e-10 35% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1392 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1392 sp|Q9BDS7|GPR15_MACFA G-protein coupled receptor 15 gb|AAK25741.1...|AF291670_1 orphan seven transmembrane receptor GPR15 [Macaca fascicularis] Q9BDS7 1e-169 81% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-2020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-2020 ref|ZP_01666375.1| conserved hypothetical protein 374 [Thermosinus... carboxydivorans Nor1] gb|EAX47725.1| conserved hypothetical protein 374 [Thermosinus carboxydivorans Nor1] ZP_01666375.1 0.86 31% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1560 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1560 ref|YP_984227.1| filamentous haemagglutinin family outer membrane... protein [Polaromonas naphthalenivorans CJ2] gb|ABM39306.1| filamentous haemagglutinin family outer membrane protein [Polaromonas naphthalenivorans CJ2] YP_984227.1 2.9 30% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-0844 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0844 ref|NP_949451.1| putative conjugal transfer protein trbI [Rhodopseudomonas... palustris CGA009] emb|CAE29556.1| putative conjugal transfer protein trbI [Rhodopseudomonas palustris CGA009] NP_949451.1 0.38 29% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1393 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1393 ref|NP_946691.1| hypothetical protein RPA1341 [Rhodopseudomonas p...alustris CGA009] emb|CAE26784.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009] NP_946691.1 2.4 28% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1960 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1960 ref|YP_687145.1| hypothetical protein RRC34 [uncultured methanogen...ic archaeon RC-I] emb|CAJ37819.1| hypothetical protein [uncultured methanogenic archaeon RC-I] YP_687145.1 9e-19 40% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1960 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1960 ref|YP_687144.1| hypothetical protein RRC32 [uncultured methanogen...ic archaeon RC-I] emb|CAJ37818.1| hypothetical protein [uncultured methanogenic archaeon RC-I] YP_687144.1 7e-22 39% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1273 ref|YP_001111321.1| hypothetical protein GrBNV_gp54 [Gryllus bima...culatus nudivirus] gb|ABO45387.1| unknown [Gryllus bimaculatus nudivirus] YP_001111321.1 0.001 35% ...

  14. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    Science.gov (United States)

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1167 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 1e-138 67% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1030 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1030 ref|NP_001015581.1| chemokine binding protein 2 [Bos taurus] gb|A...AX46341.1| chemokine binding protein 2 [Bos taurus] gb|AAX46675.1| chemokine binding protein 2 [Bos taurus] NP_001015581.1 1e-170 79% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1688 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1688 emb|CAH72617.1| chromosome 10 open reading frame 18 [Homo sapiens...] emb|CAI13368.1| chromosome 10 open reading frame 18 [Homo sapiens] CAH72617.1 1e-103 49% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ensis HTE831] sp|Q8EQA1|PRSW_OCEIH Protease prsW (Protease responsible for activating sigma-W) dbj|BAC13763....CBRC-SARA-01-0522 ref|NP_692728.1| hypothetical protein OB1807 [Oceanobacillus ihey

  19. NCBI nr-aa BLAST: CBRC-SARA-01-0991 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0991 ref|YP_574775.1| transcriptional regulator, LysR family [Chromohalobacter salex...igens DSM 3043] gb|ABE60076.1| transcriptional regulator, LysR family [Chromohalobacter salexigens DSM 3043] YP_574775.1 9.3 31% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0831 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0831 ref|XP_001526559.1| hypothetical protein LELG_01387 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK43209.1| hypothetical protein LELG_01387 [Lodderomyces elongisporus NRRL YB-4239] XP_001526559.1 2.8 51% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0106 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0106 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 3e-17 39% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0566 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0566 sp|Q91ZI0|CELR3_MOUSE Cadherin EGF LAG seven-pass G-type receptor... 3 precursor gb|AAL25099.1|AF427498_1 cadherin EGF LAG seven-pass G-type receptor [Mus musculus] Q91ZI0 0.0 74% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thail...andensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-0383 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0383 ref|XP_361721.2| hypothetical protein MGG_04195 [Magnaporthe gris...ea 70-15] gb|EDJ99501.1| hypothetical protein MGG_04195 [Magnaporthe grisea 70-15] XP_361721.2 1.4 24% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_001009331.1| cannabinoid receptor 1 [Felis catus] sp|O02777|CNR1_FELCA Canna...binoid receptor 1 (CB1) (CB-R) gb|AAB53440.1| CB1 cannabinoid receptor [Felis catus] NP_001009331.1 0.0 96% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-0175 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0175 ref|NP_603288.1| hypothetical protein FN0384 [Fusobacterium nucle...atum subsp. nucleatum ATCC 25586] gb|AAL94587.1| Hypothetical protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] NP_603288.1 9.0 32% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-0415 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0415 ref|YP_547770.1| NADH dehydrogenase (quinone) [Polaromonas sp. JS...666] gb|ABE42872.1| NADH dehydrogenase (quinone) [Polaromonas sp. JS666] YP_547770.1 4.6 26% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1012 ref|YP_468056.1| phosphate ABC transporter, permease protein [Rhizobium... etli CFN 42] gb|ABC89329.1| phosphate ABC transporter, permease protein [Rhizobium etli CFN 42] YP_468056.1 1.1 27% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1549 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1549 ref|YP_001101288.1| twin-arginine translocase subunit, sec-indepe...ndent protein export [Herminiimonas arsenicoxydans] emb|CAL63167.1| twin-arginine translocase subunit, sec-i

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1142 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1142 ref|NP_787448.1| twin-arginine translocase TatC component [Trophe...ryma whipplei str. Twist] gb|AAO44417.1| twin-arginine translocase TatC component [Tropheryma whipplei str. Twist] NP_787448.1 0.17 24% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0268 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0268 ref|XP_566600.1| hypothetical protein [Cryptococcus neoformans var. neo...formans JEC21] gb|AAW40781.1| expressed protein [Cryptococcus neoformans var. neoformans JEC21] XP_566600.1 0.017 30% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|XP_572921.1| hypothetical protein CNI03200 [Cryptococcus neoformans var. neo...formans JEC21] gb|AAW45614.1| hypothetical protein CNI03200 [Cryptococcus neoformans var. neoformans JEC21] XP_572921.1 0.90 26% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-0348 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0348 ref|XP_001586881.1| predicted protein [Sclerotinia sclerotiorum 1...980] gb|EDN97385.1| predicted protein [Sclerotinia sclerotiorum 1980] XP_001586881.1 2.4 28% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|XP_001588188.1| predicted protein [Sclerotinia sclerotiorum 1...980] gb|EDN94760.1| predicted protein [Sclerotinia sclerotiorum 1980] XP_001588188.1 4.6 34% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1986 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1986 ref|NP_223335.1| INTEGRASE-RECOMBINASE PROTEIN (XERCD FAMILY) [Helicobacter... pylori J99] gb|AAD06197.1| INTEGRASE-RECOMBINASE PROTEIN (XERCD FAMILY) [Helicobacter pylori J99] NP_223335.1 5.2 32% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1253 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1253 ref|YP_264377.1| hypothetical protein Psyc_1092 [Psychrobacter arctic...us 273-4] gb|AAZ18943.1| conserved hypothetical protein [Psychrobacter arcticus 273-4] YP_264377.1 1.2 25% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-0873 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0873 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.36 25% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_708759.1| hypothetical protein RHA1_ro10412 [Rhodococcus s...p. RHA1] gb|ABH00601.1| conserved hypothetical protein [Rhodococcus sp. RHA1] YP_708759.1 2.7 25% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsalien...sis RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0033 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 1e-113 86% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0378 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0378 ref|YP_001302962.1| putative flippase [Parabacteroides distasonis... ATCC 8503] gb|ABR43340.1| putative flippase [Parabacteroides distasonis ATCC 8503] YP_001302962.1 5.1 26% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-0459 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0459 ref|YP_001297164.1| hypothetical protein FP2308 [Flavobacterium p...sychrophilum JIP02/86] emb|CAL44363.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86] YP_001297164.1 7.3 30% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1901 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1901 ref|ZP_01733372.1| hypothetical protein FBBAL38_03440 [Flavobacte...ria bacterium BAL38] gb|EAZ96441.1| hypothetical protein FBBAL38_03440 [Flavobacteria bacterium BAL38] ZP_01733372.1 4.4 19% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-0253 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0253 ref|NP_001038089.1| G protein-coupled receptor 54 [Sus scrofa] gb...|ABE73452.1| G protein-coupled receptor 54 [Sus scrofa] gb|ABE73453.1| G protein-coupled receptor 54 [Sus scrofa] NP_001038089.1 3e-51 67% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-0420 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0420 ref|ZP_00588106.1| Bile acid:sodium symporter [Pelodictyon phaeocl...athratiforme BU-1] gb|EAN26387.1| Bile acid:sodium symporter [Pelodictyon phaeoclathratiforme BU-1] ZP_00588106.1 0.33 29% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1117 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available moniae subsp. pneumoniae MGH 78578] gb|ABR77598.1| putative H+/gluconate symporter ...and related permeases [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001335828.1 1.8 26% ... ...CBRC-SARA-01-1117 ref|YP_001335828.1| putative H+/gluconate symporter and related permeases [Klebsiella pneu

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1572 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1572 ref|NP_652753.1| NADH dehydrogenase subunit 5 [Tigriopus japonicu...s] dbj|BAB97224.1| NADH dehydrogenase subunit 5 [Tigriopus japonicus] NP_652753.1 0.14 27% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1999 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1999 ref|YP_126627.1| hypothetical protein lpl1277 [Legionella pneumop...hila str. Lens] emb|CAH15517.1| hypothetical protein [Legionella pneumophila str. Lens] YP_126627.1 0.38 21% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1615 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1615 ref|XP_001683626.1| formin, putative [Leishmania major] emb|CAJ04...769.1| formin, putative [Leishmania major] gb|ABQ43162.1| formin B [Leishmania major] XP_001683626.1 0.52 46% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-2040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-2040 ref|NP_001075253.1| 5-hydroxytryptamine (serotonin) receptor 2A [Equus caba...llus] dbj|BAF32954.1| 5-hydroxytryptamine receptor 2A [Equus caballus] NP_001075253.1 1e-128 87% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella aura...ntiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-0796 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0796 ref|ZP_01774245.1| conserved hypothetical protein [Geobacter bemi...djiensis Bem] gb|EDJ80432.1| conserved hypothetical protein [Geobacter bemidjiensis Bem] ZP_01774245.1 3e-33 39% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1656 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1656 ref|NP_001034958.1| bitter taste receptor Modo-T2R7B [Monodelphis... domestica] dbj|BAE80368.1| bitter taste receptor [Monodelphis domestica] NP_001034958.1 2e-39 43% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1755 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1755 ref|NP_001034947.1| bitter taste receptor Modo-T2R25 [Monodelphis... domestica] dbj|BAE80373.1| bitter taste receptor [Monodelphis domestica] NP_001034947.1 1e-40 35% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-0389 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0389 ref|NP_001034959.1| bitter taste receptor Modo-T2R41 [Monodelphis... domestica] dbj|BAE80381.1| bitter taste receptor [Monodelphis domestica] NP_001034959.1 1e-101 60% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_033365.1| hypothetical protein BH05300 [Bartonella hensela...e str. Houston-1] emb|CAF27338.1| hypothetical protein [Bartonella henselae str. Houston-1] YP_033365.1 0.47 19% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1189 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1189 ref|ZP_01099747.1| arsenical pump membrane protein [Campylobacter... jejuni subsp. jejuni 84-25] gb|EAQ95323.1| arsenical pump membrane protein [Campylobacter jejuni subsp. jejuni 84-25] ZP_01099747.1 0.40 27% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1189 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1189 ref|ZP_01068559.1| arsenical pump membrane protein [Campylobacter... jejuni subsp. jejuni CF93-6] gb|EAQ56421.1| arsenical pump membrane protein [Campylobacter jejuni subsp. jejuni CF93-6] ZP_01068559.1 0.53 28% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0337 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0337 ref|ZP_01068559.1| arsenical pump membrane protein [Campylobacter... jejuni subsp. jejuni CF93-6] gb|EAQ56421.1| arsenical pump membrane protein [Campylobacter jejuni subsp. jejuni CF93-6] ZP_01068559.1 0.67 27% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1189 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1189 ref|ZP_01069237.1| arsenical pump membrane protein [Campylobacter... jejuni subsp. jejuni 260.94] gb|EAQ59437.1| arsenical pump membrane protein [Campylobacter jejuni subsp. jejuni 260.94] ZP_01069237.1 0.53 28% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-0337 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0337 ref|ZP_01099747.1| arsenical pump membrane protein [Campylobacter... jejuni subsp. jejuni 84-25] gb|EAQ95323.1| arsenical pump membrane protein [Campylobacter jejuni subsp. jejuni 84-25] ZP_01099747.1 0.52 27% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-0337 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0337 ref|ZP_01069237.1| arsenical pump membrane protein [Campylobacter... jejuni subsp. jejuni 260.94] gb|EAQ59437.1| arsenical pump membrane protein [Campylobacter jejuni subsp. jejuni 260.94] ZP_01069237.1 0.67 27% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1348 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1348 ref|NP_001028103.1| cholinergic receptor, muscarinic 5 [Macaca mu...latta] sp|P56490|ACM5_MACMU Muscarinic acetylcholine receptor M5 gb|AAB95159.1| muscarinic receptor [Macaca mulatta] NP_001028103.1 0.0 88% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-0378 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0378 ref|NP_693392.1| glycerol-3-phosphate dehydrogenase [Oceanobacill...us iheyensis HTE831] dbj|BAC14427.1| glycerol-3-phosphate dehydrogenase [Oceanobacillus iheyensis HTE831] NP_693392.1 8.7 23% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1651 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1651 ref|NP_203156.1|ND2_15766 NADH dehydrogenase subunit 2 [Tribolium... castaneum] emb|CAC51700.1| NADH dehydrogenase subunit 2 [Tribolium castaneum] NP_203156.1 1.5 19% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-2020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-2020 ref|NP_203162.1|ND5_15766 NADH dehydrogenase subunit 5 [Tribolium... castaneum] emb|CAC51706.1| NADH dehydrogenase subunit 5 [Tribolium castaneum] NP_203162.1 5.5 32% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0795 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0795 ref|NP_203156.1|ND2_15766 NADH dehydrogenase subunit 2 [Tribolium... castaneum] emb|CAC51700.1| NADH dehydrogenase subunit 2 [Tribolium castaneum] NP_203156.1 1.8 19% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1199 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1199 ref|NP_001039945.1| opioid receptor, kappa 1 [Bos taurus] sp|Q2KIP6|OPRK_BOVIN Kap...pa-type opioid receptor (KOR-1) gb|AAI12562.1| Opioid receptor, kappa 1 [Bos taurus] NP_001039945.1 9e-80 92% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1236 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1236 ref|XP_001221542.1| hypothetical protein CHGG_05447 [Chaetomium globo...sum CBS 148.51] gb|EAQ88828.1| hypothetical protein CHGG_05447 [Chaetomium globosum CBS 148.51] XP_001221542.1 0.21 28% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1012 ref|XP_001229383.1| hypothetical protein CHGG_02867 [Chaetomium globo...sum CBS 148.51] gb|EAQ90932.1| hypothetical protein CHGG_02867 [Chaetomium globosum CBS 148.51] XP_001229383.1 4.1 30% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-0179 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0179 ref|XP_001226930.1| predicted protein [Chaetomium globosum CBS 14...8.51] gb|EAQ84989.1| predicted protein [Chaetomium globosum CBS 148.51] XP_001226930.1 1e-04 40% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_913161.1| ATP synthase F0 subunit 6 [Romanomermis culicivo...rax] gb|ABL11588.1| ATP synthase F0 subunit 6 [Romanomermis culicivorax] YP_913161.1 0.33 24% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1697 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1697 ref|YP_913162.1| NADH dehydrogenase subunit 5 [Romanomermis culic...ivorax] gb|ABL11589.1| NADH dehydrogenase subunit 5 [Romanomermis culicivorax] YP_913162.1 0.62 35% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1085 ref|NP_829355.1| hypothetical protein CCA00489 [Chlamydophila cav...iae GPIC] gb|AAP05233.1| conserved hypothetical protein [Chlamydophila caviae GPIC] NP_829355.1 0.26 23% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-2026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-2026 ref|YP_008277.1| hypothetical protein pc1278 [Candidatus Protochlamydia... amoebophila UWE25] emb|CAF24002.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila UWE25] YP_008277.1 0.89 28% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0159 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0159 ref|YP_008619.1| hypothetical protein pc1620 [Candidatus Protochlamydia... amoebophila UWE25] emb|CAF24344.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila UWE25] YP_008619.1 7.8 27% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-2026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-2026 ref|YP_008281.1| hypothetical protein pc1282 [Candidatus Protochlamydia... amoebophila UWE25] emb|CAF24006.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila UWE25] YP_008281.1 3.4 25% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1462 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1462 ref|YP_300930.1| accessory gene regulator C [Staphylococcus saprophyticus subsp. saprophyt...icus ATCC 15305] dbj|BAE17985.1| accessory gene regulator C [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] YP_300930.1 0.020 25% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1236 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1236 ref|YP_213442.1| putative iron transport, fusion membrane protein... [Bacteroides fragilis NCTC 9343] emb|CAH09534.1| putative iron transport, fusion membrane protein [Bacteroides fragilis NCTC 9343] YP_213442.1 1.8 26% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1386 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1386 ref|XP_001165973.1| PREDICTED: prokineticin receptor 2 isoform 1 ...[Pan troglodytes] ref|XP_001166012.1| PREDICTED: prokineticin receptor 2 isoform 2 [Pan troglodytes] XP_001165973.1 1e-115 91% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1868 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1868 ref|NP_067356.2| prokineticin receptor 1 [Mus musculus] gb|AAH59003.1| Prokinetic...2080.1| unnamed protein product [Mus musculus] gb|EDK99210.1| prokineticin receptor 1 [Mus musculus] NP_067356.2 2e-55 77% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

  8. Graph model of behavior simulator. [Interactive simulator developed as part of UCLA SARA system

    Energy Technology Data Exchange (ETDEWEB)

    Razouk, R.R.; Estrin, G.

    1966-01-01

    An interactive simulator developed at UCLA as part of the SARA system is described. This simulator, in conjunction with other design tools of the SARA system, allows the user to model the behavior of the system being designed at various levels of detail. The models which drive the simulator are control graphs and associated data graphs. The simulator uses the control graph to express synchronization of sequences of events. Initiation of any control node triggers the simulator to call on the data graph model to provide interpretation of a process at a desired level of abstraction. The simulator gives the user the capability to examine, or modify, the state of the control and data graphs during a simulation. 8 figures.

  9. SARA (System ARchitects Apprentice): Modeling, analysis, and simulation support for design of concurrent systems

    Energy Technology Data Exchange (ETDEWEB)

    Estrin, G.; Fenchel, R.S.; Razouk, R.R.; Vernon, M.K.

    1986-02-01

    An environment to support designers in the modeling, analysis and simulation of concurrent systems is described. It is shown how a fully nested structure model supports multilevel design and focuses attention on the interfaces between the modules which serve to encapsulate behavior. Using simple examples the paper indicates how a formal graph model can be used to model behavior in three domains: control flow, data flow, and interpretation. The effectiveness of the explicity environment model in SARA is discussed and the capability to analyze correctness and evaluate performance of a system model are demonstrated. A description of the integral help designed into SARA shows how the designer can be offered consistent use of any new tool introduced to support the design process.

  10. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    CERN Document Server

    Keel, William C; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A

    2016-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA), a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofisica de Canarias. SARA observatories comprise a 0.96m telescope at Kitt Peak, Arizona; a 0.6m instrument on Cerro Tololo, Chile; and the 1m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for f...

  11. Serum acute phase proteins in cows with SARA (Subacute Ruminal Acidosis suspect

    Directory of Open Access Journals (Sweden)

    C. Cannizzo

    2012-02-01

    Full Text Available The aim of this study was to evaluate the variations of Acute Phase Proteins (APPs and other blood constituents during the onset of the sub-acute ruminal acidosis (SARA pathological status. A total of 108 cows from 12 dairy herds were randomly selected and divided into three Groups of 36 animals each. All animals were subjected to a rumenocentesis. Group A was composed by subjects with a rumen pH>5.8, Group B was composed by subjects with a rumen pH ≤5.5≤5.8 and Group C was composed by subjects with a rumen pH<5.5. Blood samples were collected by jugular venipuncture and Haptoglobin (Hp, Serum Amyloid A (SAA, Total Proteins, Albumin and White Blood Cells (WBC were determined. One-way ANOVA showed a statistical significance on Rumen pH, Hp, SAA. SARA seems not stimulate the APPs production from liver.

  12. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    OpenAIRE

    Fletcher, Jack M.; Morris, Robin D

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1423 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1423 ref|NP_999614.1| luteinizing hormone/choriogonadotropin receptor ...[Sus scrofa] sp|P16582|LSHR_PIG Lutropin-choriogonadotropic hormone receptor precursor (LH/CG-R) (LSH-R) (Lute...inizing hormone receptor) gb|AAA31062.1| luteinizing hormone receptor precursor NP_999614.1 0.0 65% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1423 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1423 ref|NP_776806.1| luteinizing hormone/choriogonadotropin receptor ...[Bos taurus] sp|Q28005|LSHR_BOVIN Lutropin-choriogonadotropic hormone receptor precursor (LH/CG-R) (LSH-R) (Lute...inizing hormone receptor) gb|AAC24012.1| luteinizing hormone receptor [Bos taurus] NP_776806.1 0.0 65% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1215 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1215 ref|NP_776826.1| neuropeptide Y receptor Y2 [Bos taurus] sp|P79113|NPY2R_BOVIN Neurope...ptide Y receptor type 2 (NPY2-R) (NPY-Y2 receptor) gb|AAB40600.1| type 2 neuropeptide Y receptor NP_776826.1 0.0 85% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0123 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0123 dbj|BAF32759.1| taste receptor, type 1, member 3 [Sus scrofa domestic...a] dbj|BAF32761.1| taste receptor, type 1, member 3 [Sus scrofa domestica] dbj|BAF32762.1| taste recepto...r, type 1, member 3 [Sus scrofa domestica] dbj|BAF32763.1| taste receptor, type 1, member 3 [Sus scrofa domestica] BAF32759.1 1e-120 70% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-0466 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0466 dbj|BAF32759.1| taste receptor, type 1, member 3 [Sus scrofa domestic...a] dbj|BAF32761.1| taste receptor, type 1, member 3 [Sus scrofa domestica] dbj|BAF32762.1| taste recepto...r, type 1, member 3 [Sus scrofa domestica] dbj|BAF32763.1| taste receptor, type 1, member 3 [Sus scrofa domestica] BAF32759.1 3e-32 71% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapie...ns] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1193 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1193 ref|NP_776427.1| calcium-sensing receptor [Bos taurus] sp|P35384|...CASR_BOVIN Extracellular calcium-sensing receptor precursor (CaSR) (Parathyroid Cell calcium-sensing recepto...r) gb|AAB29171.1| Ca(2+)-sensing receptor [Bos taurus] prf||2002360A Ca-sensing receptor NP_776427.1 0.0 86% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1360 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1360 ref|NP_599155.1| trace-amine-associated receptor 1 [Rattus norveg...icus] gb|AAL65137.1|AF421352_1 trace amine receptor 1 [Rattus norvegicus] gb|AAV70127.1| trace amine associa...ted receptor 1 [Rattus norvegicus] gb|EDL87747.1| trace-amine-associated receptor 1 [Rattus norvegicus] NP_599155.1 1e-145 74% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0585 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0585 ref|NP_001071387.1| hypothetical protein LOC514131 [Bos taurus] r...ef|XP_001254537.1| PREDICTED: hypothetical protein LOC514131 [Bos taurus] dbj|BAF36506.1| p97Bucentaur-2 [Bos tau...rus] gb|AAI49203.1| P97Bucentaur-2 [Bos taurus] NP_001071387.1 4e-12 32% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-0259 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0259 ref|NP_001029267.1| tubulin, alpha, ubiquitous [Pan troglodytes] ...sp|Q5R1W4|TBA1B_PANTR Tubulin alpha-1B chain (Tubulin alpha-ubiquitous chain) (Alpha-tubulin ubiquitous) (Tu...bulin K-alpha-1) dbj|BAD74034.1| ubiquitous alpha-tubulin [Pan troglodytes verus] NP_001029267.1 1e-136 86% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-0675 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0675 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-136 76% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1437 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1437 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-123 71% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-0312 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0312 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-137 76% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1238 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1238 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-116 72% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sa...piens] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

  10. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    Science.gov (United States)

    Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

    2017-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.

  11. Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

    Science.gov (United States)

    Thomas, S. M.; Su, Y. C.; Hummel, P. R.

    2016-12-01

    Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance

  12. Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

    2009-07-01

    Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench

  13. Impact of subacute ruminal acidosis (SARA) adaptation and recovery on the density and diversity of bacteria in the rumen of dairy cows

    NARCIS (Netherlands)

    Hook, S.E.; Steele, M.A.; Northwood, K.S.; Dijkstra, J.; France, J.; Wright, A.G.; McBride, B.W.

    2011-01-01

    Subacute ruminal acidosis (SARA) is characterized by ruminal pH depression and microbial perturbation. The impact of SARA adaptation and recovery on rumen bacterial density and diversity was investigated following high-grain feeding. Four ruminally cannulated dairy cows were fed a hay diet, transiti

  14. PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

    Directory of Open Access Journals (Sweden)

    Jorge A. Orrego-Ruiz

    2014-06-01

    Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.

  15. SARAS: a precision system for measurement of the Cosmic Radio Background and signatures from the Epoch of Reionization

    CERN Document Server

    Patra, Nipanjana; Raghunathan, A; Shankar, N Udaya

    2012-01-01

    SARAS is a correlation spectrometer purpose designed for precision measurements of the cosmic radio background and faint features in the sky spectrum at long wavelengths that arise from redshifted 21-cm from gas in the reionization epoch. SARAS operates in the octave band 87.5-175 MHz. We present herein the system design arguing for a complex correlation spectrometer concept. The SARAS design concept provides a differential measurement between the antenna temperature and that of an internal reference termination, with measurements in switched system states allowing for cancellation of additive contaminants from a large part of the signal flow path including the digital spectrometer. A switched noise injection scheme provides absolute spectral calibration. Additionally, we argue for an electrically small frequency-independent antenna over an absorber ground. Various critical design features that aid in avoidance of systematics and in providing calibration products for the parametrization of other unavoidable s...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_104995.1| alcohol dehydrogenase, zinc-containing [Burkholder...ia mallei ATCC 23344] ref|YP_111924.1| alcohol dehydrogenase [Burkholderia pseudomallei K96243] ref|ZP_004...40487.1| COG1064: Zn-dependent alcohol dehydrogenases [Burkholderia mallei GB8 horse 4] ref|YP_336176.1| alc...ohol dehydrogenase, zinc-containing [Burkholderia pseudomallei 1710b] ref|ZP_0093...0750.1| COG1064: Zn-dependent alcohol dehydrogenases [Burkholderia mallei FMH] ref|ZP_00934487.1| COG1064: Z

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1695 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1695 sp|Q9NYW0|T2R10_HUMAN Taste receptor type 2 member 10 (T2R10) (Taste... receptor family B member 2) (TRB2) gb|AAH69089.1| Taste receptor, type 2, member 10 [Homo sapiens] gb|AA...U21148.1| taste receptor T2R10 [Homo sapiens] gb|AAI01763.1| Taste receptor, type 2, member 10 [Homo sapiens] gb|AAI01765.1| Taste

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabinoid... receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cannabinoid... receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cannabinoid

  19. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cannabinoid... receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cannabinoid... receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0921 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0921 ref|NP_003292.1| thyrotropin-releasing hormone receptor [Homo sap...iens] sp|P34981|TRFR_HUMAN Thyrotropin-releasing hormone receptor (TRH-R) (Thyroliberin receptor) emb|CAA52965.1| thyrotropin-releasi...BAA04120.1| human thyrotropin-releasing hormone receptor [Homo sapiens] gb|AAB32222.1| thyrotropin-releasi...ng hormone receptor; TRH receptor [Homo sapiens] dbj|BAA12796.1| thyrotropin-releasing... hormone receptor [Homo sapiens] gb|AAR84356.1| thyrotropin-releasing hormone receptor [Homo sapiens] gb|

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1167 ref|XP_001105680.1| PREDICTED: similar to adiponectin receptor 1 ...isoform 3 [Macaca mulatta] ref|XP_001105751.1| PREDICTED: similar to adiponectin receptor 1 isoform 4 [Macac...a mulatta] ref|XP_001105805.1| PREDICTED: similar to adiponectin receptor 1 isoform 5 [Macaca mulatta] ref|X...P_001105878.1| PREDICTED: similar to adiponectin receptor 1 isoform 6 [Macaca mul...atta] ref|XP_001105957.1| PREDICTED: similar to adiponectin receptor 1 isoform 7 [Macaca mulatta] XP_001105680.1 1e-138 67% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1167 ref|NP_057083.2| adiponectin receptor 1 [Homo sapiens] ref|XP_514107.1| PREDICTED: adipone...ctin receptor 1 isoform 7 [Pan troglodytes] ref|XP_001152270.1| PREDICTED: adiponectin... receptor 1 isoform 1 [Pan troglodytes] ref|XP_001152338.1| PREDICTED: adiponectin receptor 1 isoform 2 [...Pan troglodytes] ref|XP_001152393.1| PREDICTED: adiponectin receptor 1 isoform 3 ...[Pan troglodytes] ref|XP_001152460.1| PREDICTED: adiponectin receptor 1 isoform 4 [Pan troglodytes] ref|XP_0

  3. NCBI nr-aa BLAST: CBRC-SARA-01-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0033 ref|NP_000951.1| prostaglandin I2 (prostacyclin) receptor (IP) [H...in I2 receptor) dbj|BAA05008.1| prostacyclin receptor [Homo sapiens] gb|AAA36448.1| prostanoid IP receptor dbj|BAA06110.1| pros...tacyclin receptor [Homo sapiens] dbj|BAA07325.1| prostacyclin ...receptor [Homo sapiens] gb|AAO92301.1| prostaglandin I2 (prostacyclin) receptor [Homo sapiens] gb|AAH75814.1| Prostaglandin I2 (pros...tacyclin) receptor (IP) [Homo sapiens] gb|EAW57432.1| prostaglandin I2 (prostacyclin

  4. NCBI nr-aa BLAST: CBRC-SARA-01-0259 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0259 ref|XP_001107503.1| PREDICTED: tubulin, alpha, ubiquitous isoform... 10 [Macaca mulatta] ref|XP_001107562.1| PREDICTED: tubulin, alpha, ubiquitous isoform 11 [Macaca mulatta] r...ef|XP_001107624.1| PREDICTED: tubulin, alpha, ubiquitous isoform 12 [Macaca mulatta] ref|XP_001107684.1| PRE...| PREDICTED: tubulin, alpha, ubiquitous isoform 14 [Macaca mulatta] ref|XP_001107805.1| PREDICTED: tubulin, alpha, ubiquitous... isoform 15 [Macaca mulatta] ref|XP_001107870.1| PREDICTED: tubulin, alpha, ubiquitous isof

  5. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_848509.1| progestin and adipoQ receptor family member VII ...[Homo sapiens] sp|Q86WK9|MPRA_HUMAN Membrane progestin receptor alpha (mPR alpha) (Progestin and adipoQ rece...ptor family member VII) gb|AAO47233.1|AF313620_1 putative membrane steroid receptor [Homo sapiens] gb|AAR08373.1| progesti...1| hCG1642829 [Homo sapiens] emb|CAM12867.1| progestin and adipoQ receptor family member VII [Homo sapiens] NP_848509.1 1e-178 87% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_001122232.1| CDP-alcohol phosphatidyltransferase [Francise...lla tularensis subsp. tularensis WY96-3418] ref|YP_001427783.1| CDP-alcohol phosphatidyltransferase [Francis...ella tularensis subsp. holarctica FTA] gb|ABO47111.1| CDP-alcohol phosphatidyltransferase [Francisella tular...ensis subsp. tularensis WY96-3418] gb|EDN35713.1| phosphatidylserine synthase [Francis...ella tularensis subsp. novicida GA99-3549] gb|EDN37179.1| hypothetical protein FTDG_01588 [Francisella

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubent...onia madagascariensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| opsin 1 short-wave...length senstive protein [Daubentonia madagascariensis] gb|ABR53748.1| opsin 1 short-wave...length senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-wave

  8. saeRS and sarA act synergistically to repress protease production and promote biofilm formation in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Lara N Mrak

    Full Text Available Mutation of the staphylococcal accessory regulator (sarA limits biofilm formation in diverse strains of Staphylococcus aureus, but there are exceptions. One of these is the commonly studied strain Newman. This strain has two defects of potential relevance, the first being mutations that preclude anchoring of the fibronectin-binding proteins FnbA and FnbB to the cell wall, and the second being a point mutation in saeS that results in constitutive activation of the saePQRS regulatory system. We repaired these defects to determine whether either plays a role in biofilm formation and, if so, whether this could account for the reduced impact of sarA in Newman. Restoration of surface-anchored FnbA enhanced biofilm formation, but mutation of sarA in this fnbA-positive strain increased rather than decreased biofilm formation. Mutation of sarA in an saeS-repaired derivative of Newman (P18L or a Newman saeRS mutant (ΔsaeRS resulted in a biofilm-deficient phenotype like that observed in clinical isolates, even in the absence of surface-anchored FnbA. These phenotypes were correlated with increased production of extracellular proteases and decreased accumulation of FnbA and/or Spa in the P18L and ΔsaeRS sarA mutants by comparison to the Newman sarA mutant. The reduced accumulation of Spa was reversed by mutation of the gene encoding aureolysin, while the reduced accumulation of FnbA was reversed by mutation of the sspABC operon. These results demonstrate that saeRS and sarA act synergistically to repress the production of extracellular proteases that would otherwise limit accumulation of critical proteins that contribute to biofilm formation, with constitutive activation of saeRS limiting protease production, even in a sarA mutant, to a degree that can be correlated with increased enhanced capacity to form a biofilm. Although it remains unclear whether these effects are mediated directly or indirectly, studies done with an sspA::lux reporter suggest they

  9. Illness, everyday life and narrative montage: the visual aesthetics of cancer in Sara Bro's Diary.

    Science.gov (United States)

    Henriksen, Nina; Tjørnhøj-Thomsen, Tine; Hansen, Helle Ploug

    2011-05-01

    This article presents a study of Sara Bro's Diary (2004), a book montage of images and texts recording the experiences of a Danish breast cancer survivor, Sara Bro. It examines two montages of photography and text, drawing on Roland Barthes' concept of 'the third meaning' to explain and discuss the effect of the layered meanings in the montage alongside their multi-medium and self-referential expression. The discussion is centred on the aesthetic practices that are invited by Bro's book montage. The article considers how the juxtaposition of images and texts are experienced and co-created by the reader. It points to the effect of the aesthetics of disguise and carnival implicit in the visual-verbal montage and argues that these generate a third meaning. This meaning is associated with the breast cancer experience but is not directly discernible in the montage. The article concludes by discussing how Bro's montage acts as an ideological statement, subverting or 'poaching on' the health care system.

  10. First Results on the Epoch of Reionization from First Light with SARAS 2

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2017-08-01

    Long-wavelength spectral distortions in the cosmic microwave background arising from the 21 cm transition in neutral hydrogen are a key probe of the Cosmic Dawn and the Epoch of Reionization. These features may reveal the nature of the first stars and ultra-faint galaxies that transformed the spin temperature and ionization state of the primordial gas. SARAS 2 is a spectral radiometer purposely designed for the precision measurement of these monopole or all-sky global 21 cm spectral distortions. We use 63 hr nighttime observations of the radio background in the frequency band 110-200 MHz, with the radiometer deployed at the Timbaktu Collective in Southern India, to derive likelihoods for plausible redshifted 21 cm signals predicted by theoretical models. First light with SARAS 2 disfavors the class of models that feature weak X-ray heating (with {f}X≤slant 0.1) and rapid reionization (with peak \\tfrac{{{dT}}b}{{dz}}≥slant 120 mK per unit redshift interval).

  11. Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

    Science.gov (United States)

    Goldrick-Rab, Sara; Kelly, Andrew P.

    2016-01-01

    In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…

  12. A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

    Science.gov (United States)

    Worthen, Helena Harlow

    2012-01-01

    The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…

  13. Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge.

    Science.gov (United States)

    Plaizier, Jan C; Li, Shucong; Danscher, Anne Mette; Derakshani, Hooman; Andersen, Pia H; Khafipour, Ehsan

    2017-02-08

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces samples was analyzed to assess their bacterial communities using MiSeq Illumina sequencing of the V4 region of the 16S rRNA gene. The induction of SARA reduced the richness, diversity, and stability of bacterial communities and resulted in distinctly different microbiota in the rumen and feces. Bacteroidetes and Firmicutes were the most abundant phyla and, combined, they represented 76.9 and 94.4% of the bacterial community in the rumen fluid and the feces, respectively. Only the relative abundance of Firmicutes in the rumen was increased by the SARA challenge. In rumen fluid and feces, the abundances of nine out of the 90 and 25 out of the 89 taxa, respectively, were affected by the challenge. Hence, SARA challenge altered the composition of the bacterial community at the lower taxonomical level in the feces and therefore also likely in the hindgut, as well as in the rumen. However, only reductions in the bacterial richness and diversity in the rumen fluid and feces were in agreement with those of other studies and had a biological basis. Although the composition of the

  14. Psyche’s Daughter of Today: Sara Jeannette Duncan and the New Woman

    Directory of Open Access Journals (Sweden)

    Michelle Gadpaille

    2007-06-01

    Full Text Available The Canadian novelist Sara Jeannette Duncan (1861-1922 constructed a New Woman heroine in the fin-de- siecle novel; A Daughter of Today (1894. Written in the popular mode of the transatlantic novel; the work engages in debate on the appropriate construction of femininity in art and public life. The heroine; Elfrida Bell; descends from artist; to muse; to model; to painted image—a descent framed by a rival male artist and a hostile London art scene. Represented as Psyche; the heroine undergoes a quest and failure similar to the mythical one. Adaptation of the Psyche myth clarifies the position of Duncan in the spectrum of gender ideologies of the fin-de- siecle.

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapie...ns] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapie...ns] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapie

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0185 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0185 ref|NP_000852.1| histamine receptor H1 [Homo sapiens] ref|NP_001091681.1| histamine... receptor H1 [Homo sapiens] ref|NP_001091682.1| histamine receptor H1 [Homo sapiens] ref|NP_001091683.1| histamine... receptor H1 [Homo sapiens] sp|P35367|HRH1_HUMAN Histamine H1 receptor emb|CAA54182.1| histamine... H1 receptor [Homo sapiens] dbj|BAA05840.1| histamine H1 receptor [Ho...mo sapiens] emb|CAA84380.1| Human histamine H1 receptor [Homo sapiens] dbj|BAA03319.1| histamine H1 receptor

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed ...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1199 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1199 ref|NP_035141.1| opioid receptor, kappa 1 [Mus musculus] sp|P33534|OPRK_MOUSE Kap...pa-type opioid receptor (KOR-1) (MSL-1) gb|AAA39363.1| kappa opioid receptor gb|AAB34130.2| kap...pa opioid receptor; KOR [Mus sp.] gb|AAP32232.1| kappa-opioid receptor [Mus sp.] gb|AAI16796.1| Opioid receptor, kap...pa 1 [Mus musculus] gb|AAI19027.1| Opioid receptor, kappa 1 [Mus muscu...lus] gb|EDL14259.1| opioid receptor, kappa 1, isoform CRA_a [Mus musculus] NP_035141.1 1e-78 92% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0004 ref|NP_000900.1| neuropeptide Y receptor Y1 [Homo sapiens] sp|P25929|NPY1R_HUMAN Neurope...ptide Y receptor type 1 (NPY1-R) gb|AAA73215.1| [Human neuropeptide Y peptide YY rece...ptor mRNA, complete cds.], gene product gb|AAA59947.1| neuropeptide Y receptor Y1 gb|AAH36657.1| Neuropeptid...e Y receptor Y1 [Homo sapiens] gb|AAS55647.1| neuropeptide Y1 receptor [Homo sapiens] gb|AAH71720.1| Neuro...peptide Y receptor Y1 [Homo sapiens] gb|EAX04841.1| neuropeptide Y receptor Y1 [Hom

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1215 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1215 ref|NP_000901.1| neuropeptide Y receptor Y2 [Homo sapiens] ref|NP_001012655.1| neurope...ptide Y receptor Y2 [Pan troglodytes] sp|P49146|NPY2R_HUMAN Neuropeptide Y receptor typ...e 2 (NPY2-R) (NPY-Y2 receptor) sp|Q5IS62|NPY2R_PANTR Neuropeptide Y receptor type 2 (NPY2-R) (NPY-Y2 receptor) gb|AAC50281.1| neurope...ptide Y/peptide YY Y2 receptor gb|AAB04120.1| neuropepti...de y2 receptor gb|AAC51115.1| type 2 neuropeptide Y receptor gb|AAO92062.1| neuropeptide Y receptor Y2 [Homo

  1. SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

    DEFF Research Database (Denmark)

    Martin, Christer; Heinze, C.; Busch, M.

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... to the existence of superimposed regulatory systems suppressing a multi-cellular biofilm life style in vitro. Transposon mutagenesis of clinical significant but biofilm-negative S. epidermidis 1585 was used to isolate a biofilm positive mutant carrying a Tn917 insertion in sarA,chief regulator of staphylococcal...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenerg...ic receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AA...B59487.1| alpha 1a/d adrenergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenerg

  3. Escribiendo el silencio: la contemplación poética de Sara Pujol

    Directory of Open Access Journals (Sweden)

    Gala, Candelas

    2005-06-01

    Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.

  4. Functional impairment in patients with myotonic dystrophy type 1 can be assessed by an ataxia rating scale (SARA).

    Science.gov (United States)

    DiPaolo, Giovanni; Jimenez-Moreno, Cecilia; Nikolenko, Nikoletta; Atalaia, Antonio; Monckton, Darren G; Guglieri, Michela; Lochmüller, Hanns

    2017-04-01

    Myotonic dystrophy type 1 (DM1) is not characterised by ataxia per se; however, DM1 and ataxia patients show similar disturbances in movement coordination often experiencing walking and balance difficulties, although caused by different underlying pathologies. This study aims to investigate the use of a scale previously described for the assessment and rating of ataxia (SARA) with the hypothesis that it could have utility in DM1 patients as a measure of disease severity and risk of falling. Data from 54 DM1 patients were pulled from the PHENO-DM1 natural history study for analysis. Mean SARA score in the DM1 population was 5.45 relative to the maximum score of eight. A flooring effect (score 0) was observed in mild cases within the sample. Inter-rater and test-retest reliability was high with intraclass coefficients (ICC) of 0.983 and 1.00, respectively. Internal consistency was acceptable as indicated by a Cronbach's alpha of 0.761. Component analysis revealed two principle components. SARA correlated with: (1) all measures of muscle function tested, including quantitative muscle testing of ankle dorsiflexion (r = -0.584*), the 6 min walk test (r = -0.739*), 10 m walk test (r = 0.741*), and the nine hole peg test (r = 0.602*) and (2) measures of disease severity/burden, such as MIRS (r = 0.718*), MDHI (r = 0.483*), and DM1-Activ (r = -0.749*) (*p < 0.001). The SARA score was predicted by an interaction between modal CTG repeat length and age at sampling (r = 0.678, p = 0.003). A score of eight or above predicted the use of a walking aid with a sensitivity of 100% and a specificity of 85.7%. We suggest that further research is warranted to ascertain whether SARA or components of SARA are useful outcome measures for clinical trials in DM1. As a tool, it can be used for gathering information about disease severity/burden and helping to identify patients in need of a walking aid, and can potentially be applied in both research and healthcare

  5. "Doing and Undoing Gender": Female Higher Education in the Islamic Republic of Iran

    Science.gov (United States)

    Mehran, Golnar

    2009-01-01

    Since the establishment of the Islamic Republic, female higher education has been characterised by a paradoxical combination of discrimination and exclusion, on the one hand, and increasing equality and empowerment, on the other. This study focuses on the triangle of education, equality and empowerment, using Sara Longwe's women's empowerment…

  6. The Sub-keV Atom Reflecting Analyzer (SARA) Experiment Aboard Chandrayaan-1 Mission: Instrument and Observations

    CERN Document Server

    Bhardwaj, Anil; Dhanya, M B; Barabash, Stas; Yoshifumi, Futaana; Holmstrom, Mats; Sridharan, R; Wurz, Peter; Schaufelberger, Audrey; Kazushi, Asamura

    2010-01-01

    SARA experiment aboard the first Indian lunar mission Chandrayaan-1 had the objective to explore the solar wind-lunar interaction using energetic neutral atoms (ENA) from the lunar surface as diagnostic tool. SARA consisted of an ENA imaging mass analyzer CENA (Chandrayaan-1 Energetic Neutral Analyzer) and an ion mass analyser SWIM (Solar Wind Monitor), along with a digital processing unit (DPU) which commands and controls the sensors and provides the interface to the spacecraft. Both sensors have provided excellent observational data. CENA has observed ENAs from the lunar surface and found that ~20% of the incident solar wind ions get backscattered as ENAs from the lunar surface. This is contrary to the previous assumptions of almost complete absorption of solar wind by the lunar surface. The observation is relevant for other airless bodies in the solar system.

  7. Holocene environment changes around the Sara Us River, northern China, revealed by optical dating of lacustrine-aeolian sediments

    Science.gov (United States)

    Zhao, Hui; Sheng, Yongwei; Li, Bo; Fan, Yuxin

    2016-04-01

    The Sara Us River is located along the boundary of the Mu Us Desert and the Chinese Loess Plateau in northern China. The river has cut down through Quaternary sediments creating 70-80 m deep valleys with thick lacustrine/aeolian sequences exposed. We applied optical stimulated luminescence on sediments from a Holocene section of aeolian sand/lacustrine deposits in the top of the river valley. The dating results show that a humid period existed from 7.1 to 2.0 ka ago as evidenced by two layers of peat and lacustrine sediments. However, compared to other published Holocene sections in the Sara Us River valleys close to the section under studying, the local environment experienced very complicated changes during the Holocene. All of the sections recorded a period with drought and/or cold before the Holocene at around 13 ka, and an episode of aridity after about 2 ka ago as evidenced by the layers of aeolian sand. However, the ages of the lacustrine and peat layers in these sections are substantially different. Geomorphological analysis by digital elevation models does not support the existence of a mega lake covering the study area at 2 ka. The intricate environmental changes may have been caused by the meandering of the Sara Us River. Environmental changes also strongly affected human migration in this area, which is documented by Chinese historical records.

  8. SARA: a self-adaptive and resource-aware approach towards secure wireless ad hoc and sensor networks

    Science.gov (United States)

    Chigan, Chunxiao; Li, Leiyuan

    2005-05-01

    Providing security is essential for mission critical Wireless Ad Hoc and Sensor Networks (WAHSN) applications. Often a highly secure mechanism inevitably consumes a rather large amount of system resources, which in turn may unintentionally cause a Security Service Denial of Service (SSDoS) attack. This paper proposes a self-adaptive resource-aware (SARA) security provisioning approach for WAHSNs. For resource scarce WAHSNs, SARA strives to provide the optimal tradeoff between the sufficient security (which is reflected by the Security Index (SI)) and the acceptable network performance degradation (which is reflected by the Performance Index (PI)). With the support of the offline optimal secure protocol selection module and the online self-adaptive security control module, SARA is capable of employing different combinations of secure protocol sets to satisfy different security need at different condition for different applications. To determine the security index SI of a secure protocol set, a heuristic cross-layer security-service mapping mechanism is presented. Furthermore, we evaluate performance index PI of a secure protocol set via simulation followed by Analysis of Variance (ANOVA). Consequently, the proposed self-adaptive security provisioning based on both SI and PI achieves the maximum overall network security services and network performance services, without causing the SSDoS attack. Furthermore, this self-adaptive mechanism is capable of switching from one secure protocol set to another while keeping similar level of security and performance, it thus provides additional security by security service hopping.

  9. Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

    Directory of Open Access Journals (Sweden)

    Tirshem Kumar Kaushik

    2015-05-01

    Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.

  10. Studying the Lunar-Solar Wind Interaction with the SARA Experiment aboard the Indian Lunar Mission Chandrayaan-1

    CERN Document Server

    Bhardwaj, Anil; Dhanya, M B; Wieser, Martin; Yoshifumi, Futaana; Holmstrom, Mats; Sridharan, R; Wurz, Peter; Schaufelberger, Audrey; Kazushi, Asamura; 10.1063/1.3395916

    2010-01-01

    The first Indian lunar mission Chandrayaan-1 was launched on 22 October 2008. The Sub-keV Atom Reflecting Analyzer (SARA) instrument onboard Chandrayaan-1 consists of an energetic neutral atom (ENA) imaging mass analyzer called CENA (Chandrayaan-1 Energetic Neutrals Analyzer), and an ion-mass analyzer called SWIM (Solar wind Monitor). CENA performed the first ever experiment to study the solar wind-planetary surface interaction via detection of sputtered neutral atoms and neutralized backscattered solar wind protons in the energy range ~0.01-3.0 keV. SWIM measures solar wind ions, magnetosheath and magnetotail ions, as well as ions scattered from lunar surface in the ~0.01-15 keV energy range. The neutral atom sensor uses conversion of the incoming neutrals to positive ions, which are then analyzed via surface interaction technique. The ion mass analyzer is based on similar principle. This paper presents the SARA instrument and the first results obtained by the SWIM and CENA sensors. SARA observations suggest...

  11. TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

    Energy Technology Data Exchange (ETDEWEB)

    1989-03-01

    This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.

  12. La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli

    Directory of Open Access Journals (Sweden)

    Umberto Fortis

    2014-04-01

    Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.

  13. Identification and characterization of msa (SA1233), a gene involved in expression of SarA and several virulence factors in Staphylococcus aureus.

    Science.gov (United States)

    Sambanthamoorthy, Karthik; Smeltzer, Mark S; Elasri, Mohamed O

    2006-09-01

    The staphylococcal accessory regulator (sarA) plays a central role in the regulation of virulence in Staphylococcus aureus. To date, studies involving sarA have focused on its activity as a global regulator that modulates transcription of a wide variety of genes (>100) and its role in virulence. However, there is also evidence to suggest the existence of accessory elements that modulate SarA production and/or function. A reporter system was developed to identify such elements, and a new gene, msa (SA1233), mutation of which results in reduced expression of SarA, was identified and characterized. Additionally, it was shown that mutation of msa resulted in altered transcription of the accessory gene regulator (agr) and the genes encoding several virulence factors including alpha toxin (hla) and protein A (spa). However, the impact of mutating msa was different in the laboratory strain RN6390 and the clinical isolate UAMS-1. For instance, mutation of msa caused a decrease in spa and hla transcription in RN6390 but had a different effect in UAMS-1. The strain-dependent effects of the msa mutation were similar to those observed previously, which suggests that msa may modulate the production of specific virulence factors through its impact on sarA. Interestingly, sequence analysis of Msa suggests that it is a putative membrane protein with three membrane-spanning regions, indicating that Msa might interact with the environment. The findings show that msa is involved in the expression of SarA and several virulence factors.

  14. Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

    Science.gov (United States)

    Godwin, Allison; Potvin, Geoff

    2017-01-01

    This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…

  15. Impact of individual extracellular proteases on Staphylococcus aureus biofilm formation in diverse clinical isolates and their isogenic sarA mutants.

    Science.gov (United States)

    Loughran, Allister J; Atwood, Danielle N; Anthony, Allison C; Harik, Nada S; Spencer, Horace J; Beenken, Karen E; Smeltzer, Mark S

    2014-12-01

    We demonstrate that the purified Staphylococcus aureus extracellular proteases aureolysin, ScpA, SspA, and SspB limit biofilm formation, with aureolysin having the greatest impact. Using protease-deficient derivatives of LAC, we confirmed that this is due to the individual proteases themselves. Purified aureolysin, and to a lesser extent ScpA and SspB, also promoted dispersal of an established biofilm. Mutation of the genes encoding these proteases also only partially restored biofilm formation in an FPR3757 sarA mutant and had little impact on restoring virulence in a murine bacteremia model. In contrast, eliminating the production of all of these proteases fully restored both biofilm formation and virulence in a sarA mutant generated in the closely related USA300 strain LAC. These results confirm an important role for multiple extracellular proteases in S. aureus pathogenesis and the importance of sarA in repressing their production. Moreover, purified aureolysin limited biofilm formation in 14 of 15 methicillin-resistant isolates and 11 of 15 methicillin-susceptible isolates, while dispersin B had little impact in UAMS-1, LAC, or 29 of 30 contemporary isolates of S. aureus. This suggests that the role of sarA and its impact on protease production is important in diverse strains of S. aureus irrespective of their methicillin resistance status.

  16. Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

    Directory of Open Access Journals (Sweden)

    Helena López

    2013-07-01

    Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.

  17. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  18. sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

    DEFF Research Database (Denmark)

    Christner, Martin; Heinze, Constanze; Busch, Michael;

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant‐associated infections. Nonetheless, large proportions of invasive Staphylococcus epidermidis isolates fail to form a biofilm in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via overexpression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...

  19. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Diego O Andrey

    Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  20. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Science.gov (United States)

    Andrey, Diego O; Jousselin, Ambre; Villanueva, Maite; Renzoni, Adriana; Monod, Antoinette; Barras, Christine; Rodriguez, Natalia; Kelley, William L

    2015-01-01

    Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1), encoded by tst(H), and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1), RNAIII, rot, and the alternative stress sigma factor sigB (σB). By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  1. Beaudrie, Sara, Ducar, Cynthia, & Potowski, Kim (2014). Heritage language teaching: Research and practice. New York State, New York: McGraw Hill.

    OpenAIRE

    Florencia Henshaw

    2015-01-01

    This review introduces readers to Heritage language teaching: Research and practice, by Sara Beaudrie, Cynthia Ducar, and Kim Potowski, which is part of the “Directions in Second Language Learning” series. This handbook offers a comprehensive overview of key concepts, research findings, and pedagogical strategies to better meet the needs of heritage learners, and it underscores the importance of sociolinguistic issues and phenomena in heritage language instruction.

  2. Beaudrie, Sara, Ducar, Cynthia, & Potowski, Kim (2014. Heritage language teaching: Research and practice. New York State, New York: McGraw Hill.

    Directory of Open Access Journals (Sweden)

    Florencia Henshaw

    2015-12-01

    Full Text Available This review introduces readers to Heritage language teaching: Research and practice, by Sara Beaudrie, Cynthia Ducar, and Kim Potowski, which is part of the “Directions in Second Language Learning” series. This handbook offers a comprehensive overview of key concepts, research findings, and pedagogical strategies to better meet the needs of heritage learners, and it underscores the importance of sociolinguistic issues and phenomena in heritage language instruction.

  3. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    Directory of Open Access Journals (Sweden)

    Abdullah K. Shehabat

    2016-09-01

    Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.      Keywords: Women empowerment, authoritarian patriarchy, institutionalized and/or gendered religion, spiritual feminist homes

  4. Alle soglie dell'osceno. Poetiche della profanazione in Sara de Ibáñez e Alejandra Pizarnik

    Directory of Open Access Journals (Sweden)

    Luca Salvi

    2015-01-01

    Full Text Available Moving from Adorno’s statement about the enigmatic nature of modern aesthetics, this paper aims to analyse the forms the enigma takes in the works of the Uruguayan and Argentinian poets Sara de Ibáñez and Alejandra Pizarnik. The essay will consider the figures and the shapes of the enigma as they appear in both poetries. Proper of the revelation of the enigma through its profanation by the poetic language is, in fact, the never-ending and mutual reflection of two different states of the being. Through Martin Heidegger and Giorgio Agamben’s studies on language and negativity, the way in which the enigmatic word appears continuously in its constitutive suspension between infancy and adulthood, absence of time and history, language and silence, the Self and the Other will be revealed. Through the resulting dichotomy of matter and form, emerging from a passage of Agostino’s De natura boni, it will be possible, in conclusion, to recognise in the silent form of the enigma the embryonic proposal of a poetical ethics of writing.

  5. Beta-lactams interfering with PBP1 induce Panton-Valentine leukocidin expression by triggering sarA and rot global regulators of Staphylococcus aureus.

    Science.gov (United States)

    Dumitrescu, Oana; Choudhury, Priya; Boisset, Sandrine; Badiou, Cédric; Bes, Michele; Benito, Yvonne; Wolz, Christiane; Vandenesch, François; Etienne, Jerome; Cheung, Ambrose L; Bowden, Maria Gabriela; Lina, Gerard

    2011-07-01

    Previous articles reported that beta-lactam antibiotics increase the expression of Staphylococcus aureus Panton-Valentine leukocidin (PVL) by activating its transcription. We investigated the mechanisms underlying the inductor effect of beta-lactams on PVL expression by determining targets and regulatory pathways possibly implicated in this process. We measured PVL production in the presence of oxacillin (nonselective), imipenem (penicillin-binding protein 1 [PBP1] selective), cefotaxime (PBP2 selective), cefaclore (PBP3 selective), and cefoxitin (PBP4 selective). In vitro, we observed increased PVL production consistent with luk-PV mRNA levels that were 20 to 25 times higher for community-acquired methicillin-resistant S. aureus (CA-MRSA) cultures treated with PBP1-binding oxacillin and imipenem than for cultures treated with other beta-lactams or no antibiotic at all. This effect was also observed in vivo, with increased PVL mRNA levels in lung tissues from CA-MRSA-infected mice treated with imipenem but not cefoxitin. To confirm the involvement of PBP1 inhibition in this pathway, PBP1 depletion by use of an inducible pbp1 antisense RNA showed a dose-dependent relationship between the level of pbp1 antisense RNA and the luk-PV mRNA level. Upon imipenem treatment of exponential-phase cultures, we observed an increased sarA mRNA level after 30 min of incubation followed by a decreased rot mRNA level after 1 to 4 h of incubation. Unlike the agr and saeRS positive regulators, which were nonessential for PVL induction by beta-lactams, the sarA (positive) and rot (negative) PVL regulators were necessary for PVL induction by imipenem. Our results suggest that antibiotics binding to PBP1 increase PVL expression by modulating sarA and rot, which are essential mediators of the inductor effect of beta-lactams on PVL expression.

  6. β-Lactams Interfering with PBP1 Induce Panton-Valentine Leukocidin Expression by Triggering sarA and rot Global Regulators of Staphylococcus aureus ▿

    Science.gov (United States)

    Dumitrescu, Oana; Choudhury, Priya; Boisset, Sandrine; Badiou, Cédric; Bes, Michele; Benito, Yvonne; Wolz, Christiane; Vandenesch, François; Etienne, Jerome; Cheung, Ambrose L.; Bowden, Maria Gabriela; Lina, Gerard

    2011-01-01

    Previous articles reported that beta-lactam antibiotics increase the expression of Staphylococcus aureus Panton-Valentine leukocidin (PVL) by activating its transcription. We investigated the mechanisms underlying the inductor effect of beta-lactams on PVL expression by determining targets and regulatory pathways possibly implicated in this process. We measured PVL production in the presence of oxacillin (nonselective), imipenem (penicillin-binding protein 1 [PBP1] selective), cefotaxime (PBP2 selective), cefaclore (PBP3 selective), and cefoxitin (PBP4 selective). In vitro, we observed increased PVL production consistent with luk-PV mRNA levels that were 20 to 25 times higher for community-acquired methicillin-resistant S. aureus (CA-MRSA) cultures treated with PBP1-binding oxacillin and imipenem than for cultures treated with other beta-lactams or no antibiotic at all. This effect was also observed in vivo, with increased PVL mRNA levels in lung tissues from CA-MRSA-infected mice treated with imipenem but not cefoxitin. To confirm the involvement of PBP1 inhibition in this pathway, PBP1 depletion by use of an inducible pbp1 antisense RNA showed a dose-dependent relationship between the level of pbp1 antisense RNA and the luk-PV mRNA level. Upon imipenem treatment of exponential-phase cultures, we observed an increased sarA mRNA level after 30 min of incubation followed by a decreased rot mRNA level after 1 to 4 h of incubation. Unlike the agr and saeRS positive regulators, which were nonessential for PVL induction by beta-lactams, the sarA (positive) and rot (negative) PVL regulators were necessary for PVL induction by imipenem. Our results suggest that antibiotics binding to PBP1 increase PVL expression by modulating sarA and rot, which are essential mediators of the inductor effect of beta-lactams on PVL expression. PMID:21502633

  7. The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

    Energy Technology Data Exchange (ETDEWEB)

    Islam, Ananna; Cho, Yunju [Kyungpook National University, Department of Chemistry, Daegu 702-701 (Korea, Republic of); Yim, Un Hyuk; Shim, Won Joon [Oil and POPs Research Group, Korea Institute of Ocean Science and Technology, Geoje 656-834 (Korea, Republic of); Kim, Young Hwan [Division of Mass Spectrometry Research and Center for Analytical Research in Disease Sciences, Korea Basic Science Institute, Ochang 863-883 (Korea, Republic of); Graduate School of Analytical Science and Technology, Chungnam National University, Daejeon 305-764 (Korea, Republic of); Kim, Sunghwan, E-mail: sunghwank@knu.ac.kr [Kyungpook National University, Department of Chemistry, Daegu 702-701 (Korea, Republic of); Division of Mass Spectrometry Research and Center for Analytical Research in Disease Sciences, Korea Basic Science Institute, Ochang 863-883 (Korea, Republic of)

    2013-12-15

    Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S{sub 1} class in the saturate fraction and increase of S{sub 1}O{sub 1} class compounds with high DBE values in resin fraction. Levels of N{sub 1} and N{sub 1}O{sub 1} class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques.

  8. The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

    Directory of Open Access Journals (Sweden)

    John M Morrison

    2012-03-01

    Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.

  9. Nutritional Models of Experimentally-Induced Subacute Ruminal Acidosis (SARA) Differ in Their Impact on Rumen and Hindgut Bacterial Communities in Dairy Cows

    Science.gov (United States)

    Plaizier, Jan C.; Li, Shucong; Tun, Hein M.; Khafipour, Ehsan

    2017-01-01

    Effects of subacute ruminal acidosis (SARA) challenges on the bacteria in rumen fluid, cecal digesta, and feces of dairy cows were determined using 16S rRNA gene pyrosequencing and real-time quantitative PCR. Six non-lactating Holstein cows with cannulas in the rumen and cecum were used in a 3 × 3 Latin square arrangement of treatments. During the first 3 wk of each experimental period, cows received a control diet containing 70% forages on a dry matter (DM) basis. In wk 4 of each period, cows received one of three diets: (1) the control diet; (2) a diet in which 34% of the dietary DM was replaced with pellets of ground wheat and barley (GBSC); or (3) a diet in which 37% of dietary DM was replaced with pellets of ground alfalfa (APSC). Rumen fluid, cecal digesta and feces were collected on d 5 of wk 4 of each period and the composition of the bacterial community was studied. Rumen fermentation responses were reported in a companion study. Both SARA-inducing challenges resulted in similar digesta pH depressions (as shown by the companion study), and reduced bacterial richness and diversity in rumen fluid, but GBSC had the larger effect. None of the challenges affected these measures in cecal digesta, and only GBSC reduced bacterial richness and diversity in feces. Only GBSC reduced the abundance of Bacteroidetes in rumen fluid. Abundances of limited number of bacterial genera identified by 16S rRNA gene sequencing in the rumen, cecum and feces were affected by the GBSC. The APSC did not affect any of these abundances. Both challenges increased the abundances of several starch, pectin, xylan, dextrin, lactate, succinate, and sugar fermenting bacterial species in the rumen, cecum, and feces as determined by qPCR. Only GBSC increased that of Megasphaera elsdenii in the rumen. Both challenges decreased the abundance of Streptococcus bovis, and increased that of Escherichia coli, in cecal digesta and feces, with GBSC having the larger effect. These results showed that

  10. A male gift to its partner? Cyanogenic glycosides in the spermatophore of longwing butterflies (Heliconius)

    Science.gov (United States)

    Cardoso, Márcio Zikán; Gilbert, Lawrence E.

    2007-01-01

    Males of several insect species transfer nuptial gifts to females during mating, typically in the form of a protein-rich spermatophore. In chemically defended species, males could potentially enhance such a gift with chemicals that help protect the female, her eggs, or both. This was shown for lepidopteran species that accumulate pyrrolizidine alkaloids. Most Heliconius butterflies are presumably protected from predators by virtue of de novo synthesized and/or sequestered cyanogenic glycosides. Males of Heliconius species are known to transfer nutritional gifts to the females but whether defensive chemicals could also be transferred is not known. To ascertain whether transfer of cyanogens occurs, we dissected freshly mated females from nine different Heliconius species and analyzed spermatophores for cyanogenic glycosides. We found cyanogens in the spermatophores of all nine species. This is the first time cyanogenic glycosides are reported in the spermatophores of arthropods. We discuss the implications of these findings for Heliconius biology and for other cyanogenic insects as well. We suggest that chemically defended species commonly lace their nuptial gifts with defensive chemicals to improve gift quality.

  11. sara(g)ur到sal(i)r——撒拉族源流的语言人类学研究

    Institute of Scientific and Technical Information of China (English)

    马伟

    2013-01-01

    本文以撒拉族相关族名为重点,通过语言人类学的研究,提出撒拉族源自Qaramang(尕勒莽)部,和土库曼、土耳其的Karaman,乌兹别克的努尔塔Salur人都应是源自历史上著名的、Salur乌古斯部的一位领袖Karaman的观点.撒拉族的自称Sal(i)r,是由历史上的Salur、Sal(g)ur、*Sara(g)ur、*Sar(i)(g) O(g)ur等演变而来.Sar(i)(g) O(g)ur意为“黄箭(部落)”,曾是匈奴的一个重要组成部分.撒拉族等一些乌古斯(O(g)uz)民族和维吾尔族、裕固族的祖先回纥(O(g)ur)都同出一源.

  12. Análisis del proceso de cierre contable mensual y propuesta de mejora basada en la filosofía de manufactura esbelta para la empresa Sara Lee Underwear, Operación Centroamérica

    OpenAIRE

    Chinchilla Méndez, Ana Catalina

    2006-01-01

    Tesis de maestría -- Universidad de Costa Rica. Posgrado en Administración y Dirección de Empresas. Maestría Profesional en Administración y Dirección de Empresas con énfasis en Gerencia, 2006 El objetivo general del trabajo es analizar las áreas de mejora del proceso de cierre contable mensual de la empresa Sara Lee Underwear, Operación Centroamérica, con base en los principios básicos establecidos en la filosofía de manufactura esbelta; esto, con el fin de proponer un proceso mejorado aj...

  13. Impact of the regulatory loci agr, sarA and sae of Staphylococcus aureus on the induction of alpha-toxin during device-related infection resolved by direct quantitative transcript analysis.

    Science.gov (United States)

    Goerke, C; Fluckiger, U; Steinhuber, A; Zimmerli, W; Wolz, C

    2001-06-01

    The cytotoxic alpha-toxin (encoded by hla) of Staphylococcus aureus is regulated by three loci, agr, sarA and sae, in vitro. Here, we assess the regulation of hla in a guinea pig model of device-related infection by quantifying RNAIII (the effector molecule of agr) and hla directly in exudates accumulating in infected devices without subculturing of the bacteria. LightCycler reverse transcription-polymerase chain reaction (RT-PCR) was used to quantify the transcripts. Strains RN6390 and Newman expressed considerably smaller amounts of RNAIII in the guinea pig than during in vitro growth. The residual RNAIII expression decreased during the course of infection and was negatively correlated with bacterial densities. As with RNAIII, the highest hla expression was detected in both strains early in infection. Even in strain Newman, a weak hla producer in vitro, a pronounced expression of hla was observed during infection. Likewise, four S. aureus isolates from cystic fibrosis (CF) patients expressed Q1hla despite an inactive agr during device-related infection as in the CF lung. Mutation of agr and sarA in strain Newman and RN6390 had no consequence for hla expression in vivo. In contrast, the mutation in sae resulted in severe downregulation of hla in vitro as well as in vivo. In conclusion, S. aureus seems to be provided with regulatory circuits different from those characterized in vitro to ensure alpha-toxin synthesis during infections.

  14. Characteristics of velocity distribution functions and entry mechanisms of protons in the near-lunar wake from SWIM/SARA on Chandrayaan-1

    Science.gov (United States)

    Dhanya, M. B.; Barabash, Stas; Wieser, Martin; Holmström, Mats; Bhardwaj, Anil; Wurz, Peter; Alok, Abhinaw; Futaana, Yoshifumi

    2016-07-01

    Moon is an airless body with no global magnetic field, although regions of crustal magnetic fields known as magnetic anomalies exist on Moon. Solar wind, the magnetized plasma flow from the Sun, continuously impinges on Moon. Due to the high absorption of solar wind plasma on the lunar dayside, a large scale wake structure is formed downstream of the Moon. However, recent in-situ observations have revealed the presence of protons in the near-lunar wake (100 km to 200 km from the surface). The source of these protons have been found to be the solar wind that enter the wake either directly or after interaction with the lunar surface or with the magnetic anomalies. Using the entire data from the SWIM sensor, which was an ion-mass analyzer, of the SARA experiment onboard Chandrayaan-1, the characteristics of velocity distribution of these protons were investigated to understand the entry mechanisms to near lunar wake. The velocity distribution functions were computed in the two dimensional velocity space, namely in the directions parallel and perpendicular to the IMF (v_allel and v_perp) in the solar wind rest frame. Several proton populations were identified from the velocity distribution and their possible entry mechanism were inferred based on the characteristics of the velocity distribution. These entry mechanisms include (i) diffusion of solar wind protons into the wake along IMF, (ii) the solar wind protons with finite gyro-radii that are aided by the wake boundary electric field, (iii) solar wind protons with gyro-radii larger than lunar radii from the tail of the solar wind velocity distribution, and (iv) scattering of solar wind protons from the dayside lunar surface or from magnetic anomalies. In order to gain more insight into the entry mechanisms associated with different populations, the trajectories of the protons were computed backward in time (backtracing) for each of these populations. For most of the populations, the source mechanism obtained from

  15. Severe accident recriticality analyses (SARA)

    DEFF Research Database (Denmark)

    Frid, W.; Højerup, C.F.; Lindholm, I.

    2001-01-01

    three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto I plant in Finland...... with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality-both super-prompt power bursts and quasi steady-state power...... generation-for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s(-1) injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high...

  16. Notas sobre Feral y las cigüeñas, de Fernando Alonso, y la "Historia del califa cigüeña" (Wilhelm Hauff, Sara Cone Bryant

    Directory of Open Access Journals (Sweden)

    Hans Christian Hagedorn

    2011-01-01

    Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.

  17. Avaliação da metodologia de classificação SARA de óleos brutos e estudo da redução de escala

    OpenAIRE

    Silva, Schnaider Shayane Vieira da

    2016-01-01

    O petróleo ou óleo bruto é uma mistura complexa formada por hidrocarbonetos alifáticos, aromáticos e naftênicos, além de outros compostos contendo enxofre, oxigênio, nitrogênio e constituintes organometálicos complexados com níquel e vanádio. Para a caracterização de óleos brutos, um dos métodos mais empregados é o método de separação por classes SARA (Saturados, Aromáticos, Resinas e Asfaltenos). Este método apresenta algumas desvantagens, como o gasto excessivo de solventes e adsorventes, e...

  18. Knowing me-knowing you: Reported personality and trait discrepancies as predictors of marital idealization between long-wed spouses.

    Science.gov (United States)

    O'Rourke, Norm; Neufeld, Eva; Claxton, Amy; Smith, JuliAnna Z

    2010-06-01

    In previous research, marital idealization has emerged as a significant predictor of adaptation to widowhood, the psychological well-being of spouses of persons with dementia, and the physical health of older married adults over time. Despite the adaptive value of marital idealization, conceptual confusion regarding this phenomenon persists. To this end, the present study examines the degree to which marital idealization is predicted by personality traits relative to partner perceptions of their spouse's personality, and discrepancies between self- vs. spousal reports for both husbands and wives. Multilevel models were computed on the basis of responses from 125 couples married an average of 34 years. Marital idealization by husbands was predicted by his personality (i.e., lower neuroticism, openness to experience, agreeableness, and higher conscientiousness). In contrast, marital idealization by wives was predicted by trait discrepancies (i.e., being seen, and seeing one's spouse, more positively than she or he sees him- or herself). Conscientiousness emerged as the trait for which between-sex differences were most pronounced, whereas both conscientiousness and agreeableness were the traits most broadly associated with marital idealization by both spouses (intracouple trait averages and discrepancies between spousal reports). These results are discussed in relation to gender socialization and between-sex differences.

  19. Related factors of ICARS and SARA scores on spinocerebellar ataxia type 3/Machado-Joseph disease%脊髓小脑性共济失调3型/Machado-Joseph 病ICARS与SARA评分相关因素分析

    Institute of Scientific and Technical Information of China (English)

    周洁; 雷立芳; 廖鑫鑫; 王俊岭; 江泓; 唐北沙; 沈璐

    2011-01-01

    目的:探讨国际协作共济失调评估量表(ICARS)与共济失调等级量表(SARA)评估脊髓小脑性共济失调3型/ Machado-Joseph 病患者的相关因素.方法:应用ICARS与SARA对126例基因检测明确诊断为脊髓小脑性共济失调3型患者进行评估,分析ICARS评分、SARA评分与发病年龄、病程、CAG重复次数的相关性.结果:ICARS总评分(Y1)、SARA总评分(Y2)与病程(X2)呈正相关(r=0.586,P<0.05;r=0.643,P<0.05),回归方程分别为Y1=13.072+2.388 X2(F=68.874,P<0.05),Y2=4.403+0.961 X2(F=87.254,P<0.05).ICARS总评分、SARA总评分与年龄的比值分别与CAG重复次数呈正相关(r=0.328,P<0.05;r=0.335,P<0.05).ICARS各项评分、SARA各项评分与病程均呈正相关(r=0.257~0.589,P<0.05;r=0.432~0.623,P<0.05).ICARS各项评分、SARA各项评分与年龄比值分别与CAG重复次数呈正相关(r=0.263~0.403,P<0.05;r=0.189~0.366,P<0.05).ICARS总评分、SARA总评分均随着病情严重程度增加而增加.结论:ICARS与SARA评分量表均能够有效地反映共济失调患者的病情严重程度,研究者可根据实际需要选用合适的量表.%Objective To investigate the related factors of international cooperative ataxia rating scale (ICARS) and scale for the assessment and rating of ataxia scores (SARA) in patients with spinocerebellar ataxia type 3/Machado-Joseph disease.Methods A total of 126 SCA3/MJD patients were assessed by ICARS and SARA.The relation between ICARS or SARA scores and age of onset, disease duration and CAG repeat size was analyzed.Results Either the total ICARS or the total SARA score was positively related with the disease duration ( r = 0.586, P < 0.05; r =0.643 ,P < 0.05 ).Simple linear regression equations were: Y1 ( total ICARS score) = 13.072 +2.388 X2 ( disease duration) ( F = 68.874, P < 0.05 ); Y2 ( total SARA score) = 4.403 + 0.961 X2 (disease duration)( F =87.254, P <0.05 ).Either age adjusted the total ICARS score or age adjusted the

  20. 《小公主》中萨拉的性格魅力及其影响%Sara's Characteristics And the Influence in 《A Little Princess》

    Institute of Scientific and Technical Information of China (English)

    余清雏

    2005-01-01

    "The inner secret in growth-up" or "growing up with the inner secret" was always the eternal theme of Frances Hodgson Burnett. The female writer who influenced the whole 20th century was respectful to the power which could grasp from the heart, which could obviously be seen in her representative work A Little Princess, and which power was from the difficulties. Burnett wore the magic clothes for this power by her delicate and graceful writing muscle, which could create the miracle. This paper focuses on the charm of Sara's characteristics and the influence on the characters in the book and the readers in the world. Not all the princesses who have big fortune can behave themselves like princesses, but the protagonist of this book-Sara can do it. She is inborn modest and polite, innocent and kind, but not insignificant or orgulous. When she is rich, she has the temperament of a real princess, because she does not enslave herself by her clout and status. However, when she becomes maid in the kitchen because of poverty, she is still optimistic. The power of her characteristics helps her friends become optimistic and industrious like her, makes her enemy scary and awe-struck to her, and also benefits her readers.%"成长中的内心秘密",或者说,"伴随着内心秘密的成长"一直是弗朗西斯·霍奇森·伯内特永恒的主题.这位影响了整个20世纪的女作家对"成长"中的那种内心获得的力量非常敬畏,这一点在其代表作中显露无疑,其力量则来自于磨难.伯内特用她那优美、细腻、化普通为神奇的文笔,给这些力量穿上了带有"魔法"色彩的外衣.本文着重介绍小公主萨拉的性格魅力以及她这种性格魅力对书中人物以及读者的影响.不是每一个拥有巨大财富的女孩都能表现得像一个公主.但本书的主人公萨拉却做到了,她天生谦恭有礼,不卑不亢,纯真和善.在富有的时候,即不谙自己的权势和地位,这使她拥有了真正的公

  1. "doing and Undoing Gender": Female Higher Education in the Islamic Republic of Iran

    Science.gov (United States)

    Mehran, Golnar

    2009-11-01

    Since the establishment of the Islamic Republic, female higher education has been characterised by a paradoxical combination of discrimination and exclusion, on the one hand, and increasing equality and empowerment, on the other. This study focuses on the triangle of education, equality and empowerment, using Sara Longwe's women's empowerment framework to analyse the interplay between the three. State policies to Islamise the universities during the 1980-1983 Cultural Revolution determined the "gender appropriateness" of each specialisation and led to the exclusion of women from "masculine" fields of study during the early years of the revolution. Despite such discriminatory measures, women today represent the majority of students in all fields, except engineering. Women, however, remain underrepresented at graduate levels of education and as faculty members. An important challenge is to understand why men are not entering different specialisations and whether there is a possibility of "re-doing gender" - this time in addressing male inequality and disempowerment at undergraduate levels.

  2. Hydrographic and Impairment Statistics Database: SARA

    Data.gov (United States)

    National Park Service, Department of the Interior — Hydrographic and Impairment Statistics (HIS) is a National Park Service (NPS) Water Resources Division (WRD) project established to track certain goals created in...

  3. Ergenlik Dönemi Okuma Tutumu Ölçeği’nin Türkçe’ye Uyarlanması The Adaptasyon Of Survey Of Adolescent Reading Attitudes (Sara Into Turkish

    Directory of Open Access Journals (Sweden)

    Muhammet BAŞTUĞ

    2013-07-01

    Full Text Available The aim of this study is to adapt the Survey of Adolescent Reading Attitudes SARA to Turkish, which was developed by McKenna, Conradi, Lawrance, Jang, and Meyer (2012, and to test it for validity and reliability. The rationale is that the scale involves one’s attitude towards digital reading. The sample was comprised of 702 sixth,seventh and eighth grade students in Konya- 343 of them being femaleand the remaining 359 being male. The original scale had 18 items infour sub-dimensions, namely academic reading in digital settings (AD,recreational reading in digital settings (RD, academic reading in printsettings (AP and recreational reading in print settings (RP. Theexploratory factor analysis and confirmatory factor analysis revealedthat the four original sub-dimensions were retained when two itemswere omitted. Cronbach’s alpha coefficients were 0.691, 0.802, 0.690,0.660 and 0.623 for the overall scale, RD, RP, AP and AD respectively.The results suggest that the adapted scale is reliable and valid. The 15-item finalized version is appropriate for the Turkish language and use inTurkey. In the development of reading environments and materials,identification of students’ attitudes toward reading in a multidimensionalway is expected to make great contributions to morequalified learning environments. Bu araştırmanın amacı, McKenna, Conradi, Lawrence, Jang ve Meyer (2012 tarafından geliştirilen Ergenlik Dönemi Okuma Tutumu Ölçeği’nin geçerlik ve güvenirliğinin yapılarak Türkçe’ye uyarlanmasıdır. Ölçeğin dijital okumaya karşı tutumu da kapsaması sebebiyle uyarlama çalışmasının uygun olacağı düşünülmüştür. Çalışma grubunu Konya ilinde yer alan ve 6,7 ve 8. Sınıflara devam eden 343’ü kız, 359’u erkek toplam 702 öğrenci oluşturmuştur. Ölçeğin orjinali 18 maddeden ve “Akademik Dijital, Serbest Dijital, Akademik Kağıt ve Serbest Kağıt” olmak üzere 4 alt boyuttan olu

  4. AFSC/REFM: Alaska Stock Assessment Results Archive (SARA)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Each year over 50 Alaskan groundfish stock assessments report the condition of Alaskan fisheries resources in the U.S. Exclusive Economic Zone. Stock assessment...

  5. Gene : CBRC-SARA-01-0604 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available and polyadenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82107.1| cleavage and poly...adenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82108.1| cleavage and polyadenylat...ion specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] 3e-16 77% MSTVPTVSCTS...TDRWGLVGTGRCYGSGRGGSMLASCGELSQAIALPKPVLSGHQAGSDPAGSSLYLVLPEGRCLPSVPAHVCPGTAEPAQHSQTPLQRELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVCPWAGVPRAGRPGPQAQPALSFRCMQWPPAPIRHAPASHA ...

  6. Gene : CBRC-SARA-01-1455 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available _HUMAN 5e-42 47% ref|NP_001005190.1| olfactory receptor, family 7, subfamily A, member 10 [Homo sapiens] sp|...O76100|OR7AA_HUMAN Olfactory receptor 7A10 (Olfactory receptor OR19-18) (OST027) gb|AAC25627.1| BC85395_3 [Homo sapi...ens] tpg|DAA04620.1| TPA_inf: olfactory receptor OR19-18 [Homo sapiens] 7...VIINPQLCGILWIMSAVTSILQSFMVRRPSFCMVLEIPHFFCEINQVD*QDCFNTLLNDILLYVAIGVLGGGYLTGNLYSYTKIISSIHGMARLRAISSIPYLAPIGFRVGRPQPLKKKILKVAFRTLRE ...

  7. Exon: CBRC-SARA-01-0461 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available TCTCCTGGGGTTTTCTGCCAAGCCTGAGCTAGAAATCTACTATGCTTGTCTGTTCCTCGTTCTGTACTTGTTGGCTTTagctggcaacatgctcatcatcaccaccac...GGCCATGCTCACAGTGATGTCCTATGATCGGTACGTGGCCATCTGCTTGCCCCTGCACTATGAAATCATCATGGATgtcagaacctgtgtccatggGTTTGCCGGCGTCTGGGTCAGTGGGAcca...tctctggagtcatgcatgtggcagctactttctccatccacttctgtGGTCCCCGTGTtattcaccagttcttctgtgacatcccTCAGATCCTGAGACTCTCCTGCTCCAATGAGTATCTGGGTGAGGTCGGTGTCACTGCCTTCGTGGCT ...

  8. Exon: CBRC-SARA-01-1336 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available TTTGTTCTTACCTGCTTTCAATACTGTCTTTATTATCTCATCGCCAccaccattatcatcatcattatacggttttggggtcacacccagtggtgctcaaggcttactcctggttcagtgctcaaggcttactcctggtggtgcactgaGGACCATATAA ... ...tttttttttttgctttttttggtcacacccgaagatgcacaggggttattcctgtctctgcactcaggaattactcctggaagtgctcgggggaccatatgggatgct...gcgatacccaggggttactcctggcttagaatttcccctggtggtgctcgggggaccatatgggatgctgggagtcgaacc

  9. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    Directory of Open Access Journals (Sweden)

    Mihael Černetič

    2015-02-01

    Full Text Available The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is analysed from the perspective of mindfulness. Within the course of therapy, parallels were observed between the client's increased mindfulness, improved internal and external contact, strengthened Adult ego state, mastery of introjections, as well as diminished feelings of guilt, improved mood, self care and ability to engage in appropriate separation and individuation. These gains support the conclusion that Integrative Psychotherapy and mindfulness are inherently related and that explicit incorporation of mindfulness may enhance the therapeutic process of Integrative Psychotherapy.

  10. Gene : CBRC-SARA-01-1535 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CTED: hypothetical protein [Ornithorhynchus anatinus] 6e-26 39% MLKDYSWECSGTMGVLRIEPSWHLKRLVPGTIAPGCQIILLLLLFLLLRLLLLLFLLLPLLHLPLLPLL...PPLLLPFPLLLPLLPLPLLPLPPLLPLPHLPPPLFLPPLLLLPLILPLPLLPLLLPFPLLLPLPPLLPLPPRPPPPLPPPPLFLPPLLLLPLLLPLLFLPLPPLL...PPLLPLLLPLLPLFFFLFGSHPAMLRGYSWLCTQELLLAVLGGPYGMPGIEPGSAACKA...NALPAMLSLWPLFYLFLIFLLFLLFLSPSPLPPLPPYLPPPSLPLPSPLPPLLPLLLLLLLLLLLLYPSPSSPLAVYTQQCSGIIPGDVFRNHSWLCSGTIWDIWDQTCMCVQHLYPACYNVGARRES ...

  11. Gene : CBRC-SARA-01-0529 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CCCSCCCCNCCCCSYWCCCICCYCSCCCCSYRCCCSCCCCSWCCCSCCSCNQRCCYSHCYCGCCDHCHCGNFAVVVVVIVATGASVVAAVAANSAVLVGAVVVAVTIVVVIVAAVIAIAIVAIVVVAAVVVVAGNWCCCGTCSCYCCCGCCYYGSYWCFCSCCCCCNGCCCYGVLWLVLPW ...

  12. Gene : CBRC-SARA-01-1792 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available otein product [Mus musculus] 1e-17 62% MTKILRGHVGLCNQHQEGLSSFLPSFLPSFLPSFLPSFLPSFLPSFLPSFLPFSLSLSLSFFLSFFLSF...FSFFLSLSFFISLSAFVSVVTKVLQKSNLLSFLSSLLPSLTPPSSLPSFLPSSLPPSPSLLPSFLPSLPLFLPSLLPSFLPPFLPSFLPSLSSFLPSFLPSFPLFLPSLLPS

  13. Gene : CBRC-SARA-01-1600 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available otein product [Mus musculus] 7e-15 54% MICSFLITVYSTLYIYKCSIHSPIIGISRGVYLFCLFSLCPSIDSFLPSFLPSFLPSFLPSFLPSFLPSFLPSFLLPSFLPSFLPSFLPSFLPS...FLPSFLLSFLTSMAPSLPPSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPSSLQPSFFPCLLLAFFLPSYRPCFLPS

  14. Gene : CBRC-SARA-01-1228 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4% MWFCCCSFLLWGSSLGLLYASHNMPRPAAVFFPPSLPAFLPSFLPSFLPSFLPSFLPSFLPSFLPSFLPSFLPSFLPAFLPAFLPSFLPPFLPSFLPSFLPPFLPSFLPPFLPSFLPSFLPSFLPSFLPS...FLPSFLPSSLPAFLPFFLFSFSSCLSVCLSVCLSFVGVGGRTTPGIAQDLFQSLHL ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1611 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available tor, 5-hydroxytryptamine2F receptor, 5-HT2F [rats, stomach fundus, Peptide, 479 aa] gb|EDL75569.1| 5-hydroxytryptamine (serotonin) receptor 2B [Rattus norvegicus] AAB23921.1 0.0 75% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1| unnamed protein product [Mus musculus] gb|EAW65549.1| non imprinted in Prader-Willi/Angelman syndrome 1, ...isoform CRA_a [Homo sapiens] gb|EAW65551.1| non imprinted in Prader-Willi/Angelman syndrome 1, isoform CRA_a... [Homo sapiens] gb|ABM82178.1| non imprinted in Prader-Willi/Angelman syndrome 1 ...[synthetic construct] gb|ABM85364.1| non imprinted in Prader-Willi/Angelman syndrome 1 [synthetic construct] CAD97953.1 1e-113 81% ...

  17. 76 FR 2712 - Sara Lee Corporation, Master Data, Cash Applications, Deductions, Collections, Call Center...

    Science.gov (United States)

    2011-01-14

    ..., Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial Accounts..., Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial Accounting..., Deductions, Collections, Call Center, Information Technology, Accounts Payable, General Accounts,......

  18. Financial considerations associated with potential SARA listing of Sakinaw and Cultus Lake sockeye

    National Research Council Canada - National Science Library

    2004-01-01

    .... The purpose of this report is to present financial considerations associated with alternative harvest levels designed to address conservation concerns for the Sakinaw Lake and Cultus Lake sockeye populations...

  19. Tee Toompealt Pääskülani ja Tallinna saras / Tõnu Raid

    Index Scriptorium Estoniae

    Raid, Tõnu, 1939-

    2009-01-01

    Keskaegses Tallinnas puudus maamõõtja. Esimese säilinud Tallinna linnaplaani valmistas 1680. aastal Tallinna gümnaasiumi professor Heinrich Julius Woltemate. 1807. aastal loodi linna maamõõtja koht. Kõrgepea nuki asukohast. Pärnu maanteest esimestel kaartidel. Pärnu maantee üleviimisest. Muinasaja teest Pääskülast Tallinna.

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0253 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  1. The State Authorization Reciprocity Agreement (SARA): A Good Idea Whose Time Has Come

    Science.gov (United States)

    Longanecker, David; Hill, Marshall A.

    2014-01-01

    In this article the authors argue that states need a new way to oversee the delivery of postsecondary distance education across state borders. They assert that the current process is too spotty to assure consistent consumer protection and too cumbersome and expensive for institutions. Because education is not specified in the US Constitution as a…

  2. Motivating the European voter: Parties, issues and campaigns in European Parliament elections / Sara B. Hobolt, Jae-Jae Spoon

    Index Scriptorium Estoniae

    Hobolt, Sara B.

    2012-01-01

    Valijate käitumisest Euroopa Parlamendi (EP) valimistel liikmesriikides (sh Eesti), valijakäitumise erinevustest võrreldes siseriiklike valimistega ja parteide mõjust valijakäitumisele. Tabelid, joonised

  3. Review and Evaluation of the SARA System for Application to the Corps of Engineers Project Management Function

    Science.gov (United States)

    1992-02-01

    FINAL INSFEalln] SUBMIT FINAL WRrrIXN7ucaoml I P PRINTOUT -) 46 PDS POST OCCUPANCY -SYSTEM I~zz~I Post Occupancy J Time & Cost Evaluation I Post ...Recommendations for Improved Future Financial Procedures Post Occupancy Recomn ndations for Improved Future Planning Procedures POST CCUPANCY EVALUATION... Occupancy Program to As-Built Evaluation I Budget to Fmal Project Evaluation Post Occupny RecommWatdons for Improved Future Administrative Procedures I

  4. In Ukraine, Fear of Being a Resurgent Russiaѫs Next Target / Nicholas Kulish, Sara Rhodin

    Index Scriptorium Estoniae

    Kulish, Nicholas

    2008-01-01

    Gruusia ja Venemaa vaheline konflikt on suurendanud ebakindlust Venemaa suhtes ka Ukrainas, Poolas ja Balti riikides. Eesti president Toomas Hendrik Ilves leiab, et Gruusia sündmustel on tõsised tagajärjed rahvusvahelise rahu jaoks. Vabariigi President töövisiidil Gruusias 12.-13.08.2008

  5. In Ukraine, Fear of Being a Resurgent Russiaѫs Next Target / Nicholas Kulish, Sara Rhodin

    Index Scriptorium Estoniae

    Kulish, Nicholas

    2008-01-01

    Gruusia ja Venemaa vaheline konflikt on suurendanud ebakindlust Venemaa suhtes ka Ukrainas, Poolas ja Balti riikides. Eesti president Toomas Hendrik Ilves leiab, et Gruusia sündmustel on tõsised tagajärjed rahvusvahelise rahu jaoks. Vabariigi President töövisiidil Gruusias 12.-13.08.2008

  6. 75 FR 67770 - Sara Lee Corporation Including On-Site Leased Workers From EDS, Hewitt Packard, Sapphire...

    Science.gov (United States)

    2010-11-03

    ..., Cash Applications, Deductions, Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial Accounts, Payroll, and Employee Master Data Departments Including On-Site... Payable, General Accounts, Financial Accounts, Payroll, and Employee Master Data Departments, including...

  7. sarA as a Target for the Treatment and Prevention of Staphylococcal Biofilm-Associated Infection

    Science.gov (United States)

    2015-02-01

    limits biofilm formation in Staphylococcus aureus to a degree that can be correlated with increased antibiotic susceptibility and an improved...Staphylococcus aureus to a degree that can be correlated with increased antibiotic susceptibility (Beenken et al., 2003, Weiss et al., 2009a, Weiss et al...Pharmaceutical Sciences Department at the University of Arkansas for Medical Sciences, who has a distinguished history in drug discovery and development

  8. Motivating the European voter: Parties, issues and campaigns in European Parliament elections / Sara B. Hobolt, Jae-Jae Spoon

    Index Scriptorium Estoniae

    Hobolt, Sara B.

    2012-01-01

    Valijate käitumisest Euroopa Parlamendi (EP) valimistel liikmesriikides (sh Eesti), valijakäitumise erinevustest võrreldes siseriiklike valimistega ja parteide mõjust valijakäitumisele. Tabelid, joonised

  9. Phytothermotherapy in osteoarthritis: new evidence for an old therapy

    National Research Council Canada - National Science Library

    Fioravanti, Antonella; Cheleschi, Sara; Tenti, Sara; Galeazzi, Mauro

    2013-01-01

    Sara Cheleschi, Sara Tenti, Mauro Galeazzi, Antonella FioravantiRheumatology Unit, Department of Medicine, Surgery, and Neuroscience, University of Siena, Siena, ItalyIntroduction: Osteoarthritis (OA...

  10. SARA Reading Components Tests, RISE Forms: Technical Adequacy and Test Design, 2nd Edition. Research Report. ETS RR-15-32

    Science.gov (United States)

    Sabatini, John; Bruce, Kelly; Steinberg, Jonathan; Weeks, Jonathan

    2015-01-01

    This technical report describes the conceptual foundation and measurement properties of the Reading Inventory and Scholastic Evaluation (RISE). The RISE is a 6-subtest, Web-administered reading skills components battery. The theoretical and empirical foundations of each subtest in the battery are reviewed, as well as item designs. The results…

  11. Las Insometidas de la Ciudad de México: The Novel of Prostitution in Antonia Mora, Sara Sefchovich and Cristina Rivera Garza

    OpenAIRE

    Gonzalez, Carolyn

    2014-01-01

    In my dissertation, I examine the representation of prostitution in the novels of twentieth-century Mexicana writers. This study will focus on what I call the Mexicana novel of prostitution, texts that feature female protagonists who have been compelled to enter the profession of prostitution out of necessity for financial or personal reasons. Examples of this genre that I analyze include Antonia Mora's "Del oficio" (1972), Sarah Sefchovich's Demasiado amor (1990), and Cristina Rivera Garza's...

  12. Larger, Higher-level Academic Institutions in the US Do Not Necessarily Have Better-resourced Library Web Teams. A Review of: Connell, Ruth Sara.

    Directory of Open Access Journals (Sweden)

    Suzanne Lewis

    2008-12-01

    Full Text Available Objective – To discover how library Web teams’ staffing, backgrounds, tools, and professional development differ among various types of academic libraries.Design – Survey.Setting – Academic libraries in the United States.Subjects – Academic library Web team members.Methods – A systematic sample of every twelfth institution on The Carnegie Classification of Institutions of Higher Education list was used to establish a sample group. A Web search was carriedout to identify each institution’s library Web site and contact information for the Web site designer or most appropriate alternative person. Institutions were excluded from the sample if they had no Web site at all, had no library Web site, had a Web site that did not mention a library, or had a Spanish language Web site. In September 2006 an e-mail was sent to the contact for each institution in the sample group asking them to participate in an online survey. A follow up e-mail was sent two weeks later and the survey closed after one month. The survey respondents were asked to identify their institutions so that analysis of the results in relation to the sizeand type of institution could be carried out. The researchers used a simplified version of the Carnegie classification to sort the responding institutions into five main groups.Main Results – The systematic sample consisted of 288 institutions (sample size 6.5%. The profile of the responding institutions was as follows: associate’s colleges (35.5%, baccalaureate colleges (18.2%, master’s colleges and universities (20.9%, doctorate-granting universities (9% and special focus institutions (15.5%. A total of 110 institutions completed the survey, yielding a response rate of 38.19%, although not all respondents answered all the survey questions. The final sample of 110 was 2.5% of the total 4384 institutions on the Carnegielist. Seventy-one per cent of institutions with multiple libraries shared Web teams, with two-year colleges more likely (91.7% to share a Web team than four-year or above institutions (60.9%. The majority of responding institutions (94.4% used in-house library Web site design, with only 5.6% of respondents outsourcing this task.Nearly half (49% of respondents indicated that library Web design was done by one person and even the larger libraries did not necessarily have larger Web teams. Very few Web team members (4.9% had Web design as their primary role; the majority (83.5% indicated that it was just one component of their job. Web team members from master’s- and doctorate-granting institutions were more likely to have taught themselves Web design, while those from associate, baccalaureate and special focus colleges were more likely to have taken Web design courses. For all respondents, the most commonly listed quality for selection to the Web team was an interest in Web design and the most valued skill for library Web designers was the ability to organise information effectively.Knowledge of Web authoring software and basic HTML coding were the most commonly listed knowledge requirements for Web team members. A significant number of respondents indicated that they or other Web team members did not have access to Web authoring (36.9% and image editing (52% software. Generally (except for two very large institutions, the larger institutions were more likely to use database-driven systems for their library Web sites and the smaller institutions were more likely to use content management systems. Associate’s and special focus colleges were less likely than other types of institutions to use either database driven or content management systems. Associate’s institutions were more likely to achieve ADA (Americans with Disabilities Act Web accessibility compliance. Only 48.6% of respondents utilised usability testing during Web site design.Conclusion – The author expected that institutions providing higher levels of education would have better-resourced Web design and training, but the results of the survey did not support this expectation. One reason why associate’s colleges performed better than other institutions in some areas of Web design may be that these colleges tend to offer more Web design and computer technology courses than baccalaureate, master’s and doctorate-granting institutions. Web site design and testing attracted fewer resources than might be expected in academic libraries. Across all types of institutions, Web design tended to be the responsibility of a small team or one person, with most Web designers having other responsibilities apart from the library’s Web site. Just over half of the institutions surveyed did not implement usability testing of their library Web sites.

  13. Variation in Extracellular Protease Production among Clinical Isolates of Staphylococcus aureus Due to Different Levels of Expression of the Protease Repressor sarA

    OpenAIRE

    Karlsson, Anna; Arvidson, Staffan

    2002-01-01

    Staphylococcus aureus produces four major extracellular proteases: staphylococcal serine protease (V8 protease; SspA), cysteine protease (SspB), metalloprotease (aureolysin; Aur), and staphopain (Scp). Several in vitro studies have suggested that these enzymes are important virulence factors. Here we analyzed the protease production of 92 S. aureus strains from infected human soft tissue. Twenty-one strains produced variable zones of proteolysis on casein agar plates, while the remaining 71 s...

  14. Long-term effects of subacute ruminal acidosis (SARA on milk quality and hepatic gene expression in lactating goats fed a high-concentrate diet.

    Directory of Open Access Journals (Sweden)

    Haibo Dong

    Full Text Available PURPOSE: The mechanism underlying the decline in milk quality during periods of feeding high-concentrate diets to dairy ruminants is not well documented. The aim of this study was to investigate the metabolic changes in the liver that contribute to the input of substrate precursors to the mammary gland after feeding a high-concentrate diet to lactating goats for a long period. EXPERIMENTAL DESIGN: Eight mid-lactating goats with rumen cannulas were randomly assigned to two groups. For 9 weeks, the treatment group was fed a high-concentrate diet (60% concentrate of dry matter, HC and the control group was fed a low-concentrate diet (40% concentrate of dry matter, LC. Ruminal fluid, plasma, and liver tissues were sampled, microarray techniques and real-time polymerase chain reaction were used to evaluate metabolic parameters and gene expression in liver. RESULTS: Feeding a 60%-concentrate diet for 9 weeks resulted in a significant decrease in rumen pH. Changes in fat and protein content also occurred, which negatively affected milk quality. Plasma levels of leptin (p = 0.058, non-esterified fatty acid (p = 0.071, and glucose (p = 0.014 increased markedly in HC group. Plasma cortisol concentration was significantly elevated in the treatment group (p<0.05. Expression of the glucocorticoid receptor protein gene was significantly down-regulated (p<0.05 in the liver. The expression of genes for interleukin 1β, serum amyloid A, C-reactive protein, and haptoglobin mRNA was significantly increased (p<0.05 in the HC group. GeneRelNet analysis showed that gene expression involved in inflammatory responses and the metabolism of lipids, protein, and carbohydrate were significantly altered by feeding a high-concentrate diet for 9 weeks. CONCLUSIONS: Activation of the acute phase response and the inflammatory response may contribute to nutrient partitioning and re-distribution of energy in the liver, and ultimately lead to a decline in milk quality.

  15. MULTICULTURALISM AND RELIGIOUS-BASED CONFLICT: EVENTS OF CONFLICT BASED ON ETHNICITY, RELIGION, RACE, AND INTER-GROUP RELATIONS (SARA IN THE CITY OF PONTIANAK

    Directory of Open Access Journals (Sweden)

    Lailial Muhtifah

    2013-06-01

    Full Text Available There is a tendency of similar idea that caught the conflict prevention and management efforts nowadays to the articles of the Charter of Medina which was religious-based and containing the theory of civil society. It I mostly on the handling of conflict which tends to take preventive measures and to stop the conflict directly, as well as making a comprehensive synergistic effort to mange conflict. Conflict prevention is a core component of a comprehensive Conflict Management Program. This paper explores the conflict that occurred in Ponianak between a group of people from ethnic Dayak and members of an Islamic organization in 2012 which includes an important lesson for the people of West Kalimantan, both for the government and the community elements especially in dealing with a dispute between different groups of people. An integrative prevention has been proven to be able to answer the question of handling a conflict that has a potential to escalate into a full-scale riot. This work concludes that an integrative conflict handling model may become a viable alternative model to be adopted by the community of West Kalimantan in particular and other societies in general. A synergic integrative conflict handling model that reflects local wisdom of the people of Pontianak is expected to inspire real peace for various communities with a multicultural background. Key words: multicultural, religious-based conflict, ethnicity, religion

  16. De roman als wapen tegen Frankrijk: Sara Burgerhart van Wolff en Deken en de strijd tegen de ‘gallofilie’ / The Novel as a Weapon against France: Wolff’s and Deken’s Sara Burgerhart and the Struggle Against the ‘Francophilia’

    Directory of Open Access Journals (Sweden)

    Urbaniak Jan

    2015-11-01

    Full Text Available The so-called ‘moral reorientation’ (Dutch: ‘morele heroriëntatie’ was a large-scale Dutch project, aimed at an improvement of ethical standards of society in the 18th century. It was also a reaction to the decay of the Dutch Republic reflected in the literature at the end of the 18th century. Using magazines, drama’s and novels, authors provided example of a right behaviour and criticized all those phenomena, which led to a moral malaise in society. One of these phenomena was a boundless love for France, its culture, fashion, literature and philosophy. In literature it was presented as a grave danger for Dutch identity. The term ‘francophilia’ was invented.

  17. Screamy Bird

    DEFF Research Database (Denmark)

    Tarby, Sara; Cermak, Daniel

    2016-01-01

    Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016.......Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016....

  18. Reliability and validity of the Chinese version of the Scale for Assessment and Rating of Ataxia

    Institute of Scientific and Technical Information of China (English)

    TAN Song; NIU Hui-xia; ZHAO Lu; GAO Yuan; LU Jia-meng; SHI Chang-he; Chandra Avinash

    2013-01-01

    Background The Scale for the Assessment and Rating of Ataxia (SARA) was shown to be a reliable and valid measurement for patients with spinocerebellar ataxia (SCA).The Brazilian version and the Japanese version of SARAwere favorable for good reliability and validity.This study aimed to translate SARA into Chinese and test its reliability and validity in measurement of cerebellar ataxia.Methods SARA was translated into Chinese.A total 39 patients with degeneration cerebellar ataxia were evaluated independently by two neurologists with the Chinese version of SARA.Then the patients were evaluated by one of above neurologists with International Cooperative Ataxia Rating Scale (ICARS).The statistical analyses were performed using SPSS 17.0 for Windows.Results The Cronbach's alpha coefficient of the Chinese version of SARA was 0.78,which represents a good internal consistence.The correlation coefficient of the Chinese version of SARA scores between the two evaluators was 0.86,illustrating that the inter-rater reliability of Chinese version of SARA was good.The correlation coefficient between the Chinese version of SARA and ICARS was 0.91,illustrating that the criterion validity of Chinese version of SARA was not bad.Conclusions The Chinese version of SARA is reliable and effective for the assessment of degeneration cerebellar ataxia.Compared with ICARS,the evaluation of Chinese version of SARA is more objective,the assessment time is shortened,and the maneuverability is better.

  19. Roberto Gusmani, Itinerari linguistici, Scritti raccolti in occasione del 60. compleanno, a cura di Raffaella Bombi, Guido Cifolrtti, Sara Frdalto, Fabiana Fusco, Lucia Innocente, Vincenzo Orioles; Edizioni dell'Orso, Alessandria, 1995; XXVII+382 pagine

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    1997-12-01

    Full Text Available Oggigiomo al centro degli studi linguistici non è più il sistema astratto bensì il linguaggio in società e nei vari contatti di popoli, lingue, culture, con le differenze non soltanto «orizzontali» (areali, geografiche, ma anche «verticali» (sociali e diafasiche, diamesiche ecc. Conseguenza di contatti linguistici sono il bilinguismo e la diglossia (anche coesistenti, fenomeni dovuti a quello che si designa con il termine inglese intercourse. Sono tutti aspetti della vita del linguaggio che si danno in ogni società e ad ogni epoca; eppure, come è risaputo, sono stati più o meno trascurati dalle dottrine linguistiche che studiavano ii linguaggio in vitro, come sistema idealizzato e astratto: neogrammatici, strutturalisti, generativisti.

  20. Un mundo para Sara. Una nueva categoría en el derecho español de la contratación pública: los contratos sujetos a regulación armonizada

    OpenAIRE

    2009-01-01

    El trabajo lleva a cabo un estudio acerca de la nueva categoría creada por la Ley 30/2007, de Contratos del Sector Público: los denominados contratos sujetos a regulación armonizada. Se analiza el porqué de esta nueva figura, su significado, los supuestos excluidos y las normas aplicables a esta clase de contratos, reflexionándose sobre cómo afecta al completo régimen contractual público. Se critica y cuestiona en el texto la distinción en la LCSP entre contratos sujetos o no a regulación com...

  1. Women and Spirituality in 20th-Century Writing: an Exploration into the Fiction of Virginia Woolf, Michèle Roberts, Sara Maitland, Gail Godwin and Toni Morrison

    Directory of Open Access Journals (Sweden)

    Laurence LUX-STERRITT

    2011-03-01

    Full Text Available The following essays were initially presented at the international conference on Women and Spirituality, which was organized by Laurence Lux-Sterritt and Claire Sorin (Université de Provence, LERMA in June 2009. In the context of this event, spirituality was to be understood as a broad notion encompassing personal and/or institutionalized relations to the divine, a notion that at once included and transcended religion. The purpose of the conference was to explore the diversity and specificit...

  2. Subacute ruminal acidosis in dairy cows: the physiological causes, incidence and consequences.

    Science.gov (United States)

    Plaizier, J C; Krause, D O; Gozho, G N; McBride, B W

    2008-04-01

    During subacute ruminal acidosis (SARA) rumen pH is depressed for several hours per day due to accumulation of volatile fatty acids and insufficient rumen buffering. Surveys suggested an incidence of SARA of between 19% and 26% in early and mid-lactation dairy cows. Causes of SARA include feeding excessive amounts of non-structural carbohydrates and highly fermentable forages, and insufficient dietary coarse fiber. Consequences of SARA include feed intake depression, reduced fiber digestion, milk fat depression, diarrhea, laminitis, liver abscesses, increased production of bacterial endotoxin and inflammation characterized by increases in acute phase proteins. The increase in endotoxin is similar among methods for SARA induction, but depends on the diet fed before induction. Increases in acute phase proteins vary among methods of SARA induction, even when the methods result in similar rumen pH depressions. This suggests that the inflammatory response might not be solely due to bacterial endotoxin in the rumen.

  3. Evaluation of the systemic innate immune response and metabolic alterations of nonlactating cows with diet-induced subacute ruminal acidosis.

    Science.gov (United States)

    Rodríguez-Lecompte, J C; Kroeker, A D; Ceballos-Márquez, A; Li, S; Plaizier, J C; Gomez, D E

    2014-12-01

    Subacute ruminal acidosis (SARA) increases lipopolysaccharide endotoxin in the rumen, which might translocate into the systemic circulation, triggering a cascade of clinical and immunological alterations. The objective of this study was to characterize the clinical immune and metabolic responses to ruminal-derived lipopolysaccharide in nonlactating cows induced with SARA using 2 challenges, a grain-based SARA challenge (GBSC) or an alfalfa-pellet SARA challenge (APSC). Six dry, nonlactating Holstein cows were used in a 3 × 3 Latin square arrangement of treatments with 4-wk experimental cycles. All cows received the control diet containing 70% forage and 30% mixed concentrates (dry matter basis) for 3 wk. In wk 4, cows received a control diet, GBSC (38% wheat-barley pellets, 32% other mixed concentrate, and 30% forages), or APSC (45% mixed concentrate, 32% alfalfa pellets, and 23% other forages). Total plasma proteins and immunology-related proteins, acute phase proteins, blood cells, serum chemistry, mRNA gene expression of peripheral blood cell surface markers, and selected proinflammatory cytokines were evaluated. Ruminal pH was lower in both groups with induced SARA compared with a control group. Ruminal endotoxins were higher in GBSC; however, plasma endotoxin was not detected in any study group. No significant differences in feed intake, rectal temperature, white blood cell counts, or differentials were found between control and SARA challenge groups; changes in glucose, urea, Ca, and Mg were observed in SARA groups. Total plasma proteins were lower in both SARA groups, and acute phase proteins were higher in GBSC. The expression of CD14, MD2, and TLR4 mRNA in peripheral blood leukocytes was not affected by SARA induction. The induction of SARA as a result of GBSC or APSC challenge was successful; however, LPS was not detected in plasma. Changes in clinical, metabolic, and inflammatory responses were not observed in the SARA-challenged cows, suggesting that

  4. Editorial: Developing better therapies through collegial interaction ||Free Paper||

    OpenAIRE

    Walker, Richard F

    2007-01-01

    Richard F WalkerInternational Society for Applied Research in Aging (SARA)The Society for Applied Research in Aging (SARA) was founded to serve the needs of practitioners who seek to sustain health, vitality, and quality of life of their patients during aging. Recognizing that a most basic and important part of that task is to provide relevant professional information to its members, Clinical Interventions in Aging (CIA) was created as the official SARA journal.

  5. Adaptive Noise Reduction Techniques for Airborne Acoustic Sensors

    Science.gov (United States)

    2012-01-01

    8 2.3.3 Low Cost Scout UAV Acoustics System ( LOSAS ) . . . . . . . . . . . . . 8 2.3.4 Shot Spotter...detecting supersonic projectiles. 2.3.3 Low Cost Scout UAV Acoustics System ( LOSAS ) SARA, Inc. has developed an acoustic sensor package that is...www.armytimes.com/legacy/new/0-ARMYPAPER-620646.php [25] (2012) Sara, inc. [Online]. Available: http://www.sara.com/ISR/acoustic sensing/ LOSAS . html [26

  6. CWI at TREC 2012, KBA Track and Session Track

    Science.gov (United States)

    2012-11-01

    the session infor- mation will then calculate. the documents in the stream corpora. Three out of the seven runs used a Hadoop cluster provide by...information will then calculate. the documents in the stream corpora. Three out of the seven runs used a Hadoop cluster provide by Sara.nl to process the...Environment We used JAVA and python as main programming languages. We used Hadoop architecture provided by SARA (the Natherlands SARA Computing and

  7. Rumen microbiome composition determined using two nutritional models of subacute ruminal acidosis.

    Science.gov (United States)

    Khafipour, Ehsan; Li, Shucong; Plaizier, Jan C; Krause, Denis O

    2009-11-01

    Subacute ruminal acidosis (SARA) is a metabolic disease in dairy cattle that occurs during early and mid-lactation and has traditionally been characterized by low rumen pH, but lactic acid does not accumulate as in acute lactic acid acidosis. It is hypothesized that factors such as increased gut permeability, bacterial lipopolysaccharides, and inflammatory responses may have a role in the etiology of SARA. However, little is known about the nature of the rumen microbiome during SARA. In this study, we analyzed the microbiome of 64 rumen samples taken from eight lactating Holstein dairy cattle using terminal restriction fragment length polymorphisms (TRFLP) of 16S rRNA genes and real-time PCR. We used rumen samples from two published experiments in which SARA had been induced with either grain or alfalfa pellets. The results of TRFLP analysis indicated that the most predominant shift during SARA was a decline in gram-negative Bacteroidetes organisms. However, the proportion of Bacteroidetes organisms was greater in alfalfa pellet-induced SARA than in mild or severe grain-induced SARA (35.4% versus 26.0% and 16.6%, respectively). This shift was also evident from the real-time PCR data for Prevotella albensis, Prevotella brevis, and Prevotella ruminicola, which are members of the Bacteroidetes. The real-time PCR data also indicated that severe grain-induced SARA was dominated by Streptococcus bovis and Escherichia coli, whereas mild grain-induced SARA was dominated by Megasphaera elsdenii and alfalfa pellet-induced SARA was dominated by P. albensis. Using discriminant analysis, the severity of SARA and degree of inflammation were highly correlated with the abundance of E. coli and not with lipopolysaccharide in the rumen. We thus suspect that E. coli may be a contributing factor in disease onset.

  8. Transforming Junior Leader Development: Developing the Next Generation of Pentathletes

    Science.gov (United States)

    2007-12-14

    paragraph 6.19. 44 Edward Pitts, Sara Thompson, and ROTC Cadet Command, Accesions (Selection and Branching)(Headquarters, Cadet Command, 2006, accessed 24...Edition, Counterinsurgency Reader October 2007 (2006). Pitts, Edward, Sara Thompson, and ROTC Cadet Command. Accesions (Selection and Branching

  9. Illness, everyday life and narrative montage

    DEFF Research Database (Denmark)

    Henriksen, Nina; Tjørnhøj-Thomsen, Tine; Hansen, Helle Ploug

    2011-01-01

    This article presents a study of Sara Bro's Diary (2004), a book montage of images and texts recording the experiences of a Danish breast cancer survivor, Sara Bro. It examines two montages of photography and text, drawing on Roland Barthes' concept of 'the third meaning' to explain and discuss t...

  10. The effects of grain-induced subactue ruminal acidosis on interleukin-6 and acute phase response in dairy cows

    DEFF Research Database (Denmark)

    Li, Shucong; Danscher, Anne Mette; Andersen, Pia Haubro

    2014-01-01

    Subacute ruminal acidosis (SARA) resulting from excessive grain feeding to dairy cows is accompanied by an acute phase response. Interleukin 6 (IL-6) has been proposed as a mediator of this response. We tested if the acute phase response associated with grain-induced SARA is mediated by IL-6. Six...

  11. Scale for the assessment and rating of ataxia: development of a new clinical scale.

    NARCIS (Netherlands)

    Schmitz-Hubsch, T.; Montcel, S.T. du; Baliko, L.; Berciano, J.; Boesch, S.; Depondt, C.; Giunti, P.; Globas, C.; Infante, J.; Kang, J.S.; Kremer, H.P.H.; Mariotti, C.; Melegh, B.; Pandolfo, M.; Rakowicz, M.; Ribai, P.; Rola, R.; Schols, L.; Szymanski, S.; Warrenburg, B.P.C. van de; Durr, A.; Klockgether, T.; Fancellu, R.

    2006-01-01

    OBJECTIVE: To develop a reliable and valid clinical scale measuring the severity of ataxia. METHODS: The authors devised the Scale for the Assessment and Rating of Ataxia (SARA) and tested it in two trials of 167 and 119 patients with spinocerebellar ataxia. RESULTS: The mean time to administer SARA

  12. Using AAC Device Features to Enhance Teenager's Quality of Life

    Science.gov (United States)

    McAfoose, Linnea R.

    2004-01-01

    The subject of the attached case study is Sara, a 17-year-old high school honors student who communicates using a DynaVox 3100, which she accesses via single-switch visual scanning. A team of education and engineering specialists at DynaVox Systems LLC collaborated with Sara to identify and maximize her use of device features and accessories that…

  13. Stationing a U.S. Army Reserve Black Hawk Helicopter Company at Joint Forces Training Base Los Alamitos, California

    Science.gov (United States)

    2011-03-01

    slender wild oat (Avena barbata), and Italian ryegrass (Lolium multiflorum). Areas of the Installation used for agricultural purposes contain crop...successful for all parties involved. Sincerely, Sara Jackson, REM Environmental Program Manager CONSULTING PLANNERS, SCIENTISTS...Sincerely, Sara Jackson, REM Environmental Program Manager Regional Location Map Site Map

  14. Flight School in the Virtual Environment: Capabilities and Risks of Executing a Simulations-Based Flight Training Program

    Science.gov (United States)

    2012-05-17

    27 Kathy L. Nau, Sara K. Krondak, and Norma L Lewis, "Flight School XXI (FSXXI) Training...October 12, 2011). Nau, Kathy L., Sara K. Krondak, and Norma L Lewis. "Flight School XXI (FSXXI) Training Effectiveness Analysis (TEA)." White

  15. The use of sodic monensin and probiotics for controlling subacute ruminal acidosis in sheep

    Directory of Open Access Journals (Sweden)

    Elizabeth Schwegler

    2015-02-01

    Full Text Available The aim of this work was to validate a protocol for induction of subacute ruminal acidosis (SARA (Experiment 1 and test the efficiency of probiotic Saccharomyces cerevisiae or monensin to avoid pH ruminal drops in sheep (Experiment 2. In Experiment 1, six ewes were fasted for two days and then fed most with concentrate during four days. Ewes in this protocol had ruminal fluid pH below 6.0 and kept it for 75 consecutive hours. In Experiment 2, 18 sheep were distributed into three groups: Control (CG, n = 6, monensin (MG, n = 6 and probiotic group (PG, n = 6. SARA was induced according Experiment 1. PG had lower pH (5.7 ± 0.1 than CG (6.0 ± 0.1 (P = 0.05, while MG (5.7 ± 0.1 was similar to both during SARA induction. SARA induction reduced ruminal protozoa population (P < 0.05 and increased chloride concentrations in ruminal fluid (P < 0.01. In serum, SARA increased concentrations of phosphorus (P < 0.01, AST (P < 0.01 and GGT (P < 0.01, but reduced LDH (P < 0.01. In conclusion, the protocol used for SARA induction was able to maintain ruminal pH between 5.5-6.0 for more than 48 hours. However, monensin and probiotics supplementation was not effective in preventing changes in ruminal and serum parameters during SARA.

  16. SARA Officially Perform the Duty of Operation Director for the National Association of YMCA and YWCA%国家宗教局正式履行基督教青年会、女青年会全国协会业务上管单位职责

    Institute of Scientific and Technical Information of China (English)

    裴红卫

    2009-01-01

    @@ 11月5日,中华基督教青年会、中华基督教女青年会全体人员大会在上海举行.中央统战部、国家宗教局、共青团中央、全国妇联及上海市委统战部、市民宗委、团市委、市妇联有关部门同志,中华基督教青年会全国协会、中华基督教女青年会全国协会(以下简称"男、女青年会全国协会")在沪董事会、执事会成员,"男、女青年会全国协会"所有工作人员,北京、上海等10城市地方基督教青年会、女青年会总干事参加会议.

  17. Leisure activities in Prader-Wlli syndrome: Implications for health, cognition and adaptive functioning

    Science.gov (United States)

    Dykens, Elisabeth M

    2012-01-01

    To this day, I can recite the Sara Sparrow definition of adaptive behavior. To this day, I recall Sara sitting on the other side of a one-way mirror observing me, an inexperienced clinical psychology intern, administer the Vineland Adaptive Behavior Scales to the mother of a child with learning disabilities. Talk about nervous-- the world’s expert on adaptive behavior held my very internship and career success in her hands! Even though I stumbled through it, Sara reassured me that I did great…all I needed was more practice. So, thousands of Vineland’s later, I was launched. Both my first and my latest publications in the disability field used assessment tools that I learned from Sara—primarily the Vineland, but also several cognitive tests. Beyond these tools, I cherish key insights from Sara that have stayed with me over the long haul. First and foremost, Sara taught me how to be a real psychologist, how to carefully observe and assess people with standardized tools and with my own eyes and ears. Second, she instilled a practical skill that I still am working on—always be on time even if others are late! Third, Sara imbued a sense of fun and adventure into our training and she continued to be a source of inspiration and fun in the years after I left Yale. For us data-driven types, the process of research and discovery is inherently fun—it is a total blast. Yet Sara modeled that fun and enjoyment need to come in other ways that are more balanced or well-rounded—that are, in a word, adaptive. It seems a fitting tribute to Sara to submit a paper that related her treasured Vineland Scales to how people with developmental disabilities have fun. Thank you, Sara. PMID:22484792

  18. Korean Version of the Scale for the Assessment and Rating of Ataxia in Ataxic Stroke Patients

    OpenAIRE

    Kim, Bo-Ram; Lee, Jin-Youn; Kim, Min Jeong; Jung, Heeyoune; Lee, Jongmin

    2014-01-01

    Objective To investigate the intra-rater and inter-rater reliability and usefulness of the Korean version of the Scale for the Assessment and Rating of Ataxia (K-SARA) in ataxic stroke patients. Methods The original SARA was translated into Korean, back translated to English, and compared to the original version. Stroke patients (n=60) with ataxia were evaluated using the K-SARA by one physiatrist and one occupational therapist. All subjects were rated twice. We divided the subjects into 5 gr...

  19. Hella hingega karmid naised / Krista Kaer

    Index Scriptorium Estoniae

    Kaer, Krista

    1996-01-01

    Tänapäeva kriminaalromaani inglise ja ameerika autoritest (Dame Phyllis Dorothy James, Joan Smith, Lynda La Plante (inglise); Sara Paretsky, Sue Grafton, Patricia Cornwell (ameerika) ja nende poolt loodud naisdetektiivi kujudest

  20. Hella hingega karmid naised / Krista Kaer

    Index Scriptorium Estoniae

    Kaer, Krista

    1996-01-01

    Tänapäeva kriminaalromaani inglise ja ameerika autoritest (Dame Phyllis Dorothy James, Joan Smith, Lynda La Plante (inglise); Sara Paretsky, Sue Grafton, Patricia Cornwell (ameerika) ja nende poolt loodud naisdetektiivi kujudest

  1. Intimate Relationship of Sex and Inflammatory Bowel Disease

    Science.gov (United States)

    ... Relationship of Sex and IBD Go Back The Intimate Relationship of Sex and IBD Email Print + Share It’s ... to keep these diseases from interfering with truly intimate relationships. – Sara M. Silberman This article originally appeared in ...

  2. Pop / Tõnis Kahu

    Index Scriptorium Estoniae

    Kahu, Tõnis, 1962-

    2008-01-01

    Heliplaatidest: Get Cape. Wear Cape. Fly "Searching For The Hows And Whys", The Black Crowes "Warpaint", Jonny Greenwood "There Will Be Blood", Tegan & Sara "The Con", Teräsbetoni "Myrskyntuoja", REM "Accelerate"

  3. Esittävän taiteen voittokulkua / Maaria Niemi

    Index Scriptorium Estoniae

    Niemi, Maaria

    2016-01-01

    Hüperrealismist. Kolmest kunstinäitusest: "Ron Mueck" Sara Hildenini kunstimuuseumis Tamperes; "Külm paik. Hüperrealismi variatsioonid Eesti kunstis" Kumu Kunstimuuseumis; "Fotorealism. 50 aastat hüperrealistlikku maali" Kumu Kunstimuuseumis

  4. Becoming a Blood Stem Cell Donor

    Medline Plus

    Full Text Available ... takes you through her blood stem cell donation experience at the National Institutes of Health Clinical Center ... views 11:58 Sara's filgrastim and PBSC donation experience - Duration: 10:58. Be The Match 24,944 ...

  5. Technical Guidance for Hazardous Analysis, Emergency Planning for Extremely Hazardous Substances

    Science.gov (United States)

    This current guide supplements NRT-1 by providing technical assistance to LEPCs to assess the lethal hazards related to potential airborne releases of extremely hazardous substances (EHSs) as designated under Section 302 of Title Ill of SARA.

  6. Depression among Congestive Heart Failure Patients: Results of a Survey from Central China

    Directory of Open Access Journals (Sweden)

    JPMS

    2011-10-01

    Full Text Available Tabish Hussain, Li Yu Shu, Xiang Cheng, Tumenjavkhlan Sosorburam, A.Seid Adji, Sara Tajammul, Aamra Sartaj (Union Hospital, Tongji Medical College, Huazhong University of Sciences and Technology, Wuhan, China (pages 38-42

  7. Breast Cancer Chemotherapy and Your Heart

    Science.gov (United States)

    ... American Heart Association Cardiology Patient Page Breast Cancer Chemotherapy and Your Heart Christine Unitt , Kamaneh Montazeri , Sara ... cancer treatments. Breast cancer treatments include the following: Chemotherapy involves drugs that are intended to kill the ...

  8. Esittävän taiteen voittokulkua / Maaria Niemi

    Index Scriptorium Estoniae

    Niemi, Maaria

    2016-01-01

    Hüperrealismist. Kolmest kunstinäitusest: "Ron Mueck" Sara Hildenini kunstimuuseumis Tamperes; "Külm paik. Hüperrealismi variatsioonid Eesti kunstis" Kumu Kunstimuuseumis; "Fotorealism. 50 aastat hüperrealistlikku maali" Kumu Kunstimuuseumis

  9. Pop / Tõnis Kahu

    Index Scriptorium Estoniae

    Kahu, Tõnis, 1962-

    2008-01-01

    Heliplaatidest: Get Cape. Wear Cape. Fly "Searching For The Hows And Whys", The Black Crowes "Warpaint", Jonny Greenwood "There Will Be Blood", Tegan & Sara "The Con", Teräsbetoni "Myrskyntuoja", REM "Accelerate"

  10. Intermedial Strategies of Memory in Contemporary Novels

    DEFF Research Database (Denmark)

    Tanderup, Sara

    2014-01-01

    In her article "Intermedial Strategies and Memory in Contemporary Novels" Sara Tanderup discusses a tendency in contemporary literature towards combining intermedial experiments with a thematic preoccupation with memory and trauma. Analyzing selected works by Steven Hall, Jonathan Safran Foer...

  11. A Molecular Epidemiologic Case-Case Study of Prostate Cancer

    Science.gov (United States)

    2002-03-01

    Receptor Polymorphism and Prostate Cancer Risk 1 Sara S. Strom 2, Qiang Zhang, Yun Gu, Margaret R. Spitz, Peter T. Scardino 3, Christopher J. Logothetis...Taylor, J. A. Vitamin D receptor polymorphisms and prostate cancer. Molecular Carcinogenesis, 27: 18-23, 2000. 6. Ma, J., Stampfer , M. J., Gann, P. H...Margaret R. Spitz, Richard J. Babaian, Christopher Logothetis, Sara S. Strom, University of Texas M.D. Anderson Cancer Center, Houston, TX; The University

  12. In vitro residual anti-bacterial activity of difloxacin, sarafloxacin and their photoproducts after photolysis in water

    Energy Technology Data Exchange (ETDEWEB)

    Kusari, Souvik; Prabhakaran, Deivasigamani; Lamshoeft, Marc [Institut fuer Umweltforschung (INFU), Technische Universitaet Dortmund, Otto-Hahn-Strasse 6, D-44221 Dortmund (Germany); Spiteller, Michael, E-mail: m.spiteller@infu.uni-dortmund.d [Institut fuer Umweltforschung (INFU), Technische Universitaet Dortmund, Otto-Hahn-Strasse 6, D-44221 Dortmund (Germany)

    2009-10-15

    Fluoroquinolones like difloxacin (DIF) and sarafloxacin (SARA) are adsorbed in soil and enter the aquatic environment wherein they are subjected to photolytic degradation. To evaluate the fate of DIF and SARA, their photolysis was performed in water under stimulated natural sunlight conditions. DIF primarily degrades to SARA. On prolonged photodegradation, seven photoproducts were elucidated by HR-LC-MS/MS, three of which were entirely novel. The residual anti-bacterial activities of DIF, SARA and their photoproducts were studied against a group of pathogenic strains. DIF and SARA revealed potency against both Gram-positive and -negative bacteria. The photoproducts also exhibited varying degrees of efficacies against the tested bacteria. Even without isolating the individual photoproducts, their impact on the aquatic environment could be assessed. Therefore, the present results call for prudence in estimating the fate of these compounds in water and in avoiding emergence of resistance in bacteria caused by the photoproducts of DIF and SARA. - Assessment of the residual anti-bacterial efficacies of difloxacin, sarafloxacin and their photoproducts in water, and estimating their impact on the aquatic environment in inducing resistance to microorganisms.

  13. Ruminal lipopolysaccharide concentration and inflammatory response during grain-induced subacute ruminal acidosis in dairy cows.

    Science.gov (United States)

    Gozho, G N; Krause, D O; Plaizier, J C

    2007-02-01

    The effects of grain-induced subacute ruminal acidosis (SARA) in lactating dairy cows on free ruminal lipopolysaccharide (LPS) and indicators of inflammation were determined. Four mid lactation dairy cows were divided into 2 groups of 2 cows and used in a repeated switchover design. During each period, SARA was induced in 2 animals for 5 subsequent days by replacing 25% of their total mixed ration (dry matter basis) with a concentrate made of 50% wheat and 50% barley. The other 2 cows acted as controls and were fed a total mixed ration diet in which 44% of dry matter was concentrate. On average, inducing SARA did not affect milk composition, increased the duration of rumen pH below 5.6 from 187 to 309 min/d, and increased free ruminal LPS concentration from 24,547 endotoxin units (EU)/mL to 128,825 EU/mL. Averaged across treatments, milk fat yield and milk protein yield were 0.66 and 1.00 kg/d, respectively. Rumen pH and milk fat data suggest that control cows also experienced ruminal acidosis, albeit a milder form of this disease than SARA cows. Serum LPS concentration in both control and SARA cows was less than the detection limit of inflammation including haptoglobin, fibrinogen, serum copper, or white blood cells. These results suggest that grain-induced SARA in mid lactation dairy cows increases the lysis of gram-negative bacteria and activates an inflammatory response.

  14. The effects of grain-induced subactue ruminal acidosis on interleukin-6 and acute phase response in dairy cows

    DEFF Research Database (Denmark)

    Li, Shucong; Danscher, Anne Mette; Andersen, Pia Haubro

    2014-01-01

    Subacute ruminal acidosis (SARA) resulting from excessive grain feeding to dairy cows is accompanied by an acute phase response. Interleukin 6 (IL-6) has been proposed as a mediator of this response. We tested if the acute phase response associated with grain-induced SARA is mediated by IL-6. Six...... 5, and d 3 before SARA induction and during three SARA days. ELISA kits were used for measurement of IL-6, and the acute phase proteins haptoglobin (Hp), LPS binding protein (LBP), and serum amyloid A (SAA). The SARA challenge tended to increase LBP (7.54 vs. 10.23 mg/L, P = 0.10), and increased...... the SAA (4.24 vs. 11.60 mg/L, P = 0.04) and Hp (3.57 vs. 22.09 mg/L, P = 0.04) in blood plasma, confirming that the challenge caused an acute phase response. Concentrations of IL-6 were not affected by the SARA challenge, and averaged 5.06 ng/mL across treatments. Our data do not confirm that IL-6...

  15. RANCANGAN MODEL KEBIJAKAN PENANGGULANGAN KEMISKINAN DALAM PERSPEKTIF PEMBERDAYAAN PEREMPUAN (KAJIAN TERHADAP IMPLEMENTASI PROGRAM KELUARGA HARAPAN DI KECAMATAN SUMBERBARU KABUPATEN JEMBER

    Directory of Open Access Journals (Sweden)

    Liawati Suntiana Suntiana

    2015-08-01

    Full Text Available Penelitian ini bertujuan untuk menganalisis (1 partisipasi perempuan dalam implementasi kebijakan PKH di Kecamatan Sumberbaru Kabupaten Jember; (2 faktor-faktor yang menjadi pendukung dan penghambat dalam proses pemberdayaan perempuan dalam pelaksanaan PKH di Kecamatan Sumberbaru Kabupaten Jember; (3 rancangan model penanggulangan kemiskinan dalam perspektif pemberdayaan perempuan. Penelitian ini menggunakan teori kebijakan sosial dan pemberdayaan perempuan dengan pendekatan longwe sebagai alat analisanya, sedangkan jenis penelitian adalah deskriptif kualitatif. Lokasi penelitian di Kecamatan Sumberbaru Kabupaten Jember. Informan dari penelitian ini adalah tenaga pendamping, perempuan penerima PKH dan para stakeholders yang dipilih dengan menggunakan tekhnik purposive sampling, dimana data yang terkumpul dianalisis mengguakan model interaktif Miles dan Huberman. Hasil dari penelitian ini adalah (1 partisipasi perempuan di dalam implementasi PKH belum optimal; (2 Faktor pendukung bahwa uang bantuan PKH bisa digunakan untuk memenuhi kebutuhan pokok setelah kewajiaban intervensi pendidikan atau kesehatan terpenuhi sehingga mampu meningkatkan ekonomi daya beli masyarakat sedangkan faktor penghambat program kebijakan PKH yang bersifat Top Down yang tidak melibatkanya peran perempuan RTSM dalam proses awal perencanaan sampai dengan evaluasi menyebakan lemahnya partisipasi perempuan; (3 rancangan model kebijakan penanggulangan kemiskinan dengan perspektif pemberdayaan perempuan yang diperoleh dari hasil implementasi PKH di Kecamatan Sumberbaru Kabupaten Jember adalah penyempurnaan dari PKH dengan merubah dari kebijakan Top Down menjadi kebijakan bottom up dan harus ada sinergitas dengan kebijakan penanggulangan kemiskinan yang lainya. Kata kunci: Program Keluarga Harapan (PKH, Partisipasi dan Pemberdayaan PerempuanPenelitian ini bertujuan untuk menganalisis (1 partisipasi perempuan dalam implementasi kebijakan PKH di Kecamatan Sumberbaru Kabupaten

  16. Impact of Staphylococcus aureus regulatory mutations that modulate biofilm formation in the USA300 strain LAC on virulence in a murine bacteremia model.

    Science.gov (United States)

    Rom, Joseph S; Atwood, Danielle N; Beenken, Karen E; Meeker, Daniel G; Loughran, Allister J; Spencer, Horace J; Lantz, Tamara L; Smeltzer, Mark S

    2017-09-14

    Staphylococcus aureus causes acute and chronic forms of infection, the latter often associated with formation of a biofilm. It has previously been demonstrated that mutation of atl, codY, rot, sarA, and sigB limits biofilm formation in the USA300 strain LAC while mutation of agr, fur, and mgrA has the opposite effect. Here we used a murine sepsis model to assess the impact of these same loci in acute infection. Mutation of agr, atl, and fur had no impact on virulence, while mutation of mgrA and rot increased virulence. In contrast, mutation of codY, sarA, and sigB significantly attenuated virulence. Mutation of sigB resulted in reduced accumulation of AgrA and SarA, while mutation of sarA resulted in reduced accumulation of AgrA, but this cannot account for the reduced virulence of sarA or sigB mutants because the isogenic agr mutant was not attenuated. Indeed, as assessed by accumulation of alpha toxin and protein A, all of the mutants we examined exhibited unique phenotypes by comparison to an agr mutant and to each other. Attenuation of the sarA, sigB and codY mutants was correlated with increased production of extracellular proteases and global changes in extracellular protein profiles. These results suggest that the inability to repress the production of extracellular proteases plays a key role in attenuating the virulence of S. aureus in acute as well as chronic, biofilm-associated infections, thus opening up the possibility that strategies aimed at the de-repression of protease production could be used to broad therapeutic advantage. They also suggest that the impact of codY, sarA, and sigB on protease production occurs via an agr-independent mechanism.

  17. Adaptation to High Grain Diets Proceeds Through Minimal Immune System Stimulation and Differences in Extracellular Matrix Protein Expression in A Model of Subacute Ruminal Acidosis in Non-lactating Dairy Cows

    Directory of Open Access Journals (Sweden)

    L. Dionissopoulos

    2012-01-01

    Full Text Available Problem statement: Subacute Ruminal Acidosis (SARA is a metabolic disorder affecting approximately 20% of all dairy cattle in North America. Although the presence of SARA has been described for some time, the etiology of the disorder remains uncertain. For example, many animals diagnosed with SARA seem to remodel and adapt their epithelium to accommodate the stresses imposed by SARA, but not before exacting a significant health and economic toll. Specifically, a search is on in which a desire to identify the system and associated pathways that are causative agents in the progression and development of SARA is evident. We hypothesize that adaptation to SARA is facilitated by the immune system. Approach: In order to answer of this question, 4 mature, non-lactating dairy cattle were transitioned from a High Fiber (HF; 0% grain diet to High Grain (HG; 65% grain diet. Having fed the HG diet for three weeks, the cattle were then transitioned back to the HF diet for an additional three weeks to facilitate adaptation. SARA was diagnosed by pH data only during the first week and not during the remaining weeks, indicating that adaptation to the HG diet took place within one week. Results: In this study, significant (pConclusion: These results indicate that the immune system is involved in the adaptation of the rumen epithelium to a HG diet, but to a lesser extent than was previously thought. This is the first time an attempt has been made to link the immune system and wound healing in the adaptation of the bovine rumen to a HG diet."""

  18. Epimural bacterial community structure in the rumen of Holstein cows with different responses to a long-term subacute ruminal acidosis diet challenge.

    Science.gov (United States)

    Wetzels, S U; Mann, E; Pourazad, P; Qumar, M; Pinior, B; Metzler-Zebeli, B U; Wagner, M; Schmitz-Esser, S; Zebeli, Q

    2017-03-01

    Subacute ruminal acidosis (SARA) is a prevalent metabolic disorder in cattle, characterized by intermittent drops in ruminal pH. This study investigated the effect of a gradual adaptation and continuously induced long-term SARA challenge diet on the epimural bacterial community structure in the rumen of cows. Eight rumen-cannulated nonlactating Holstein cows were transitioned over 1 wk from a forage-based baseline feeding diet (grass silage-hay mix) to a SARA challenge diet, which they were fed for 4 wk. The SARA challenge diet consisted of 60% concentrates (dry matter basis) and 40% grass silage-hay mix. Rumen papillae biopsies were taken at the baseline, on the last day of the 1-wk adaptation, and on the last day of the 4-wk SARA challenge period; ruminal pH was measured using wireless sensors. We isolated DNA from papillae samples for 16S rRNA gene amplicon sequencing using Illumina MiSeq. Sequencing results of most abundant key phylotypes were confirmed by quantitative PCR. Although they were fed similar amounts of concentrate, cows responded differently in terms of ruminal pH during the SARA feeding challenge. Cows were therefore classified as responders (n = 4) and nonresponders (n = 4): only responders met the SARA criterion of a ruminal pH drop below 5.8 for longer than 330 min/d. Data showed that Proteobacteria, Firmicutes, and Bacteroidetes were the most abundant phyla, and at genus level, Campylobacter and Kingella showed highest relative abundance, at 15.5 and 7.8%, respectively. Diversity analyses revealed a significant increase of diversity after the 1-wk adaptation but a decrease of diversity and species richness after the 4-wk SARA feeding challenge, although without distinction between responders and nonresponders. At the level of the operational taxonomic unit, we detected diet-specific shifts in epimural community structure, but in the overall epimural bacterial community structure, we found no differences between responders and nonresponders

  19. An Adaptive File Replication Method Based on Semantic Group in P2P Network%P2P网络中基于语义组的自适应资源预测复制算法

    Institute of Scientific and Technical Information of China (English)

    张同光; 赵晓莉

    2012-01-01

    在众多P2P资源搜索技术中,基于热点资源复制的搜索被重点关注.本文在考虑节点语义的情况下,基于ARIMA预测模型提出了自适应热点资源复制方法(semantic-aware replication based on ARIMA,SARA).SARA充分考虑了无结构P2P网络中语义拓扑结构的特性,引入ARIMA预测模型,对于可能出现的热点资源提前进行副本复制.实验表明,SARA有效地避免了不必要的副本复制浪费,减小了复制开销,同时保证了较高的副本查询效率.%Among various searching techniques, the hot resource-based searching is focused on. In this paper, we propose an adaptive file replication method based on semantic dynamic community SARA (semantic-aware replication based on ARIMA). By introduced ARIMA prediction model and fully taken account the features of the semantics topology of unstructured P2P network, SARA copies possible hot resources in advance. The simulation results show that SARA effectively avoids unnecessary waste of copies, and reduces the replication cost. Meanwhile SARA also can guarantee a high search efficiency of the copies.

  20. Molecular modeling of interactions between heavy crude oil and the soil organic matter coated quartz surface.

    Science.gov (United States)

    Wu, Guozhong; Zhu, Xinzhe; Ji, Haoqing; Chen, Daoyi

    2015-01-01

    Molecular dynamic (MD) simulation was applied to evaluate the mobility, diffusivity and partitioning of SARA (saturates, aromatics, resins, asphaltenes) fractions of heavy crude oil on soil organic matter (SOM) coated quartz surface. Four types of SOM were investigated including Leonardite humic acid, Temple-Northeastern-Birmingham humic acid, Chelsea soil humic acid and Suwannee river fulvic acid. The SOM aggregation at oil-quartz interface decreased the adsorption of SARA on the quartz surface by 13-83%. Although the SOM tended to promote asphaltenes aggregation, the overall mobility of SARA was significantly greater on SOM-quartz complex than on pure quartz. Particularly, the diffusion coefficient of asphaltenes and resins increased by up to one-order of magnitude after SOM addition. The SOM increased the overall oil adsorption capacity but also mobilized SARA by driving them from the viscous oil phase and rigid quartz to the elastic SOM. This highlighted the potential of SOM addition for increasing the bioavailability of heavy crude oil without necessarily increasing the environmental risks. The MD simulation was demonstrated to be helpful for interpreting the role of SOM and the host oil phase for the adsorption and partitioning of SARA molecules, which is the key for developing more realistic remediation appraisal for heavy crude oil in soils.

  1. Aerothermodynamic Analysis of a Reentry Brazilian Satellite

    CERN Document Server

    Santos, Wilson F N

    2012-01-01

    This work deals with a computational investigation on the small ballistic reentry Brazilian vehicle SARA (acronyms for SAt\\'elite de Reentrada Atmosf\\'erica). Hypersonic flows over the vehicle SARA at zero-degree angle of attack in a chemical equilibrium and thermal non-equilibrium are modeled by the Direct Simulation Monte Carlo (DSMC) method, which has become the main technique for studying complex multidimensional rarefied flows, and that properly accounts for the non-equilibrium aspects of the flows. The emphasis of this paper is to examine the behavior of the primary properties during the high altitude portion of SARA reentry. In this way, velocity, density, pressure and temperature field are investigated for altitudes of 100, 95, 90, 85 and 80 km. In addition, comparisons based on geometry are made between axisymmetric and planar two-dimensional configurations. Some significant differences between these configurations were noted on the flowfield structure in the reentry trajectory. The analysis showed t...

  2. Substorm associated radar auroral surges: a statistical study and possible generation model

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available Substorm-associated radar auroral surges (SARAS are a short lived (15–90 minutes and spatially localised (~5° of latitude perturbation of the plasma convection pattern observed within the auroral E-region. The understanding of such phenomena has important ramifications for the investigation of the larger scale plasma convection and ultimately the coupling of the solar wind, magnetosphere and ionosphere system. A statistical investigation is undertaken of SARAS, observed by the Sweden And Britain Radar Experiment (SABRE, in order to provide a more extensive examination of the local time occurrence and propagation characteristics of the events. The statistical analysis has determined a local time occurrence of observations between 1420 MLT and 2200 MLT with a maximum occurrence centred around 1700 MLT. The propagation velocity of the SARAS feature through the SABRE field of view was found to be predominately L-shell aligned with a velocity centred around 1750 m s–1 and within the range 500 m s–1 and 3500 m s–1. This comprehensive examination of the SARAS provides the opportunity to discuss, qualitatively, a possible generation mechanism for SARAS based on a proposed model for the production of a similar phenomenon referred to as sub-auroral ion drifts (SAIDs. The results of the comparison suggests that SARAS may result from a similar geophysical mechanism to that which produces SAID events, but probably occurs at a different time in the evolution of the event.

    Key words. Substorms · Auroral surges · Plasma con-vection · Sub-auroral ion drifts

  3. Rumen microbial abundance and fermentation profile during severe subacute ruminal acidosis and its modulation by plant derived alkaloids in vitro.

    Science.gov (United States)

    Mickdam, Elsayed; Khiaosa-Ard, Ratchaneewan; Metzler-Zebeli, Barbara U; Klevenhusen, Fenja; Chizzola, Remigius; Zebeli, Qendrim

    2016-06-01

    Rumen microbiota have important metabolic functions for the host animal. This study aimed at characterizing changes in rumen microbial abundances and fermentation profiles using a severe subacute ruminal acidosis (SARA) in vitro model, and to evaluate a potential modulatory role of plant derived alkaloids (PDA), containing quaternary benzophenanthridine and protopine alkaloids, of which sanguinarine and chelerythrine were the major bioactive compounds. Induction of severe SARA strongly affected the rumen microbial composition and fermentation variables without suppressing the abundance of total bacteria. Protozoa and fungi were more sensitive to the low ruminal pH condition than bacteria. Induction of severe SARA clearly depressed degradation of fiber (P < 0.001), which came along with a decreased relative abundance of fibrolytic Ruminococcus albus and Fibrobacter succinogenes (P < 0.001). Under severe SARA conditions, the genus Prevotella, Lactobacillus group, Megasphaera elsdenii, and Entodinium spp. (P < 0.001) were more abundant, whereas Ruminobacter amylophilus was less abundant. SARA largely suppressed methane formation (-70%, P < 0.001), although total methanogenic 16S rRNA gene abundance was not affected. According to principal component analysis, Methanobrevibacter spp. correlated to methane concentration. Addition of PDA modulated ruminal fermentation under normal conditions such as enhanced (P < 0.05) concentration of total SCFA, propionate and valerate, and increased (P < 0.05) degradation of crude protein compared with the unsupplemented control diet. Our results indicate strong shifts in the microbial community during severe SARA compared to normal conditions. Supplementation of PDA positively modulates ruminal fermentation under normal ruminal pH conditions.

  4. Effects of Non-fiber Carbohydrate to Neutral Detergent Fiber Ratios on Ruminal pH Dynamics in Dairy Goats

    Institute of Scientific and Technical Information of China (English)

    HU Hong-lian; LU De-xun; LIU Da-cheng

    2011-01-01

    IntroductionSubacute ruminal acidosis (SARA)has become common and important economic and health issues for high-yielding dairy cows.Rumen pH takes a central position in the pathogenesis of SARA.So monitoring of rumen pH is play important role in recognizing,quantifying and subsequently controlling this disorder.The objective of the present study was to determine effects of different non-fiber carbohydrate to neutral detergent fiber ratios on ruminal pH dynamics.

  5. Lutikat : [luuletused] / Viktor Shibanov

    Index Scriptorium Estoniae

    Shibanov, Viktor

    2005-01-01

    Sisu: Lutikat / udmurdi keelest soome keelde tõlkinud Viktor Shibanov, Sara Hännikäinen ; Ylösalaisin kasvava puu / udmurdi keelest soome keelde tõlkinud Sara Hännikäinen, Hannu Oittinen ; Ovi / udmurdi keelest soome keelde tõlkinud Kari Sallamaa ; Lumest / udmurdi keelest eesti keelde tõlkinud koostöös autoriga Mihkel Kera ; Ringikujuline lõks ; Nulg ; Maja ; "Maa ühest otsast teise..." ; Vana ajaleht ; Neiu ja karu / udmurdi keelest eesti keelde tõlkinud Irina Orehhova, Kristiina Ehin

  6. The madness of modern measurement.

    Science.gov (United States)

    Wickham, Sara

    2016-06-01

    In this column, Sara Wickham takes a sideways look at issues relevant to midwives, students, women and families, inviting us to sit down with a cup of tea and ponder what we think we know. In this article, Sara shares the story of a woman who discovered that the due date calculation made by a machine was considered inalienable, even when another date was known with certainty to be correct. Is this an inevitable consequence of our modern world, or can we act to challenge such situations?

  7. På sporet af den tabte sans

    DEFF Research Database (Denmark)

    Nielsen, Thomas Rosendal

    2014-01-01

    Analyse af en workshop om interaktive strategier i børneteater for børn. Workshoppen fandt sted på Dramatikkens hus i Oslo og blev ledet af Sara Topsøe-Jensen, kunstneriske leder af teatret Carte Blanche.......Analyse af en workshop om interaktive strategier i børneteater for børn. Workshoppen fandt sted på Dramatikkens hus i Oslo og blev ledet af Sara Topsøe-Jensen, kunstneriske leder af teatret Carte Blanche....

  8. Patterns of motor signs in spinocerebellar ataxia type 3 at the start of follow-up in a reference unit.

    Science.gov (United States)

    Pulido-Valdeolivas, Irene; Gómez-Andrés, David; Sanz-Gallego, Irene; Rausell, Estrella; Arpa, Javier

    2016-01-01

    Spinocerebellar ataxia type 3 (SCA3) is a neurodegenerative disorder that affects the cerebellar system and other subcortical regions of the brain. As for other cerebellar diseases, the severity of this type of ataxia can be assessed with the Scale for Assessment and Rating of Ataxia (SARA) which gives a total score that reflects functional impairment out of 8 cerebellar function tests. SCA3 patients score profile is heterogeneous on at the start of follow up. This study investigates possible patterns in those profiles and analyses the impact of other usually concurrent signs of impairment of extracerebellar motor systems in that profile variability by means of multivariate statistical approaches. Seventeen patients with SCA3 underwent systematic anamnesis, neurological and SARA assessment, visual evaluation of (123)I-Ioflupane (DaTSCAN) single-photon emission computed tomography (SPECT) imaging and electrophysiological studies (nerve conduction and electromyography). Patterns in the profiles of SARA item scores were investigated by hierarchical clustering after multivariate correspondence analysis. A network analysis was used to represent relationships between SARA item scores, clinical, genetic and neurological examination parameters as well as abnormalities of DaTSCAN SPECT imaging and electrophysiological studies. The most frequently altered SARA items in all patients are gait and stance, and three profiles of SCA3 patients can be distinguished depending mainly on their degree of impairment in those two items. Other SARA items like the score on heel-shin slide contribute less to the classification. Network analysis shows that SARA item scores configure a single domain that is independent of the size of the mutated expanded allele and age of onset, which are, in turn closely and inversely correlated. The severity of cerebellar dysfunction is correlated with longer disease duration, altered visual evaluation of DaTSCAN SPECT imaging and decreased patellar

  9. Phase I Clinical Pharmacology Studies

    Science.gov (United States)

    1993-09-28

    Organ Cultures el Humnan BEGCUE. SARA SPANGE.NB.RGER. BARBARA A. ReISpnfiy Elowhie’n. £ ARAUDA’. C CRUMP S MARLIN. V`JRUWE LS AND GEORGES PETER Bmw...SUMHARY T.O. #10 JR 6026, an 8-aminoquinoline similar to primaquine, may be a useful agent to treat visceral leishmaniasis and may hold an advantage over

  10. Unmarried Parents in College

    Science.gov (United States)

    Goldrick-Rab, Sara; Sorensen, Kia

    2010-01-01

    Noting that access to higher education has expanded dramatically in the past several decades, Sara Goldrick-Rab and Kia Sorensen focus on how unmarried parents fare once they enter college. Contrary to the expectation that access to college consistently promotes family stability and economic security, the authors argue that deficiencies in current…

  11. Unmarried Parents in College: Pathways to Success. Fast Focus. No. 9-2011

    Science.gov (United States)

    Goldrick-Rab, Sara; Sorensen, Kia

    2011-01-01

    This issue of "Fast Focus" is based on an article published by Sara Goldrick-Rab and Kia Sorensen in the fall 2010 issue of "The Future of Children" (Vol. 20, No. 2; used here with permission), which focuses on "fragile families," defined as families in which the parents were unmarried when the child was born. The authors examine unmarried parents…

  12. Kanuti gildi saalis toimub kuni 24. XI festival "Continental Breakfast Tallinn"

    Index Scriptorium Estoniae

    2005-01-01

    Korraldajad: Anders Härm, Priit Raud. 4. XI Tellervo Kalleineni (Soome) performance "Lase mind/Let me". 5. XI Saralundeni (Sara Lunden, Rootsi) muusikaline performance "Sweet Beat Tour". 8. ja 9. XI esineb babaLAN (Vlado Gotvan Repnik, Sloveenia) multimeedia-performance'iga

  13. Improved ion guide for heavy-ion fusion-evaporation reactions

    NARCIS (Netherlands)

    Dendooven, P; Beraud, R; Chabanat, E; Emsallem, A; Honkanen, A; Huhta, M; Jokinen, A; Lhersonneau, G; Oinonen, M; Penttila, H; Perajarvi, K; Wang, JC; Aysto, J

    1998-01-01

    The ion guide for heavy-ion-induced reactions developed originally for the SARA facility in Grenoble has been implemented at the Jyvaskyla IGISOL facility. For the Cd-116(Ar-40, 6n)Dy-150 reaction an efficiency of 0.5% relative to the number of reaction products entering the stopping chamber was obt

  14. Flu-related Hospitalizations by Industry

    Centers for Disease Control (CDC) Podcasts

    2012-04-30

    Dr. Sara Luckhaupt, a CDC medical officer, discusses which industries are most impacted by the flu.  Created: 4/30/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 5/2/2012.

  15. Mahavira's Geometrical Problems

    DEFF Research Database (Denmark)

    Høyrup, Jens

    2004-01-01

    Analysis of the geometrical chapters Mahavira's 9th-century Ganita-sara-sangraha reveals inspiration from several chronological levels of Near-Eastern and Mediterranean mathematics: (1)that known from Old Babylonian tablets, c. 1800-1600 BCE; (2)a Late Babylonian but pre-Seleucid Stratum, probably...

  16. Telecommunications Growth in Latin America: A Comparative Analysis, the Development and Policy of Technologies in Emerging Markets

    Science.gov (United States)

    2009-09-01

    achieved, as seen in Figure 14. 80 Ipsos Public Affairs, La Gran Encuesta de la Televisión en Colombia September 2008, 74. Figure 14. Colombian...Market Access Results. April 2008. 134 Ipsos Public Affairs. La Gran Encuesta de la Televisión en Colombia September 2008. Ken Parks, Sara Silver

  17. Mapping the Heart

    Science.gov (United States)

    Hulse, Grace

    2012-01-01

    In this article, the author describes how her fourth graders made ceramic heart maps. The impetus for this project came from reading "My Map Book" by Sara Fanelli. This book is a collection of quirky, hand-drawn and collaged maps that diagram a child's world. There are maps of her stomach, her day, her family, and her heart, among others. The…

  18. Towards a sustainable coffee market: paradoxes faced by a multinational company

    NARCIS (Netherlands)

    Kolk, A.

    2012-01-01

    This paper examines the case of sustainable coffee as faced by Sara Lee's International Coffee and Tea Division (SL), asking which strategic direction the company should take considering its regulatory, competitive, and societal contexts. More than a decade after sustainable coffee became a strategi

  19. Smoking in the United States Air Force: Trends, Most Prevalent Diseases and their Association with Cost

    Science.gov (United States)

    2011-09-01

    Talcott, Harry Lando, and Risa J. Stein. “Smoking prevalence and risk factors for smoking in a population of United States Air Force basic trainees...Stein, Risa J., Sara A. Pyle, C. Keith Haddock, W.S. Carlos Poston, Robert Bray, and Jason Williams, “ Reported stress and its relationship to tobacco

  20. 77 FR 12004 - Stanislaus National Forest, CA; Notice of Intent To Prepare an Environmental Impact Statement for...

    Science.gov (United States)

    2012-02-28

    ...: Candy Rock; 19777 Greenley Road; Sonora, CA 95370; (209) 532-3671. Comments may be submitted by Fax ; or... Sara Friberg, Stanislaus National Forest, 19777 Greenley Road; Sonora, CA 95370; phone: (209) 532-3671...'s Office, 19777 Greenley Road, Sonora, CA 95370. Nature of Decision To Be Made The...

  1. Between Looking and Gesturing, Pierre Hébert′s concept of ′Animation d′observation′

    DEFF Research Database (Denmark)

    Graca, Marina Estela

    The French Canadian filmmaker Pierre Hébert expression ?animation d?observation? (literally, observation animation) first appears within the context of the production of his film ETIENNE ET SARA (1984) and is only employed there and during the implementation of the following project: (1985). At t...

  2. On the Image of Hate in Education: Desirable Emotions, Learning, and the Visibility of Bodies in Educational Relations

    Science.gov (United States)

    Ryther, Cathrine

    2016-01-01

    In this article I explore how images of hate from the work of feminist, psychoanalytical educational thinkers Deborah Britzman and Alice Pitt, and from Sara Ahmed's investigation into the cultural politics of emotion, function to shift the ideal-image of pedagogically desired emotions and complicate the emotional landscape of educational…

  3. 77 FR 66191 - Senior Executive Service-Performance Review Board

    Science.gov (United States)

    2012-11-02

    .... FOR FURTHER INFORMATION CONTACT: Sara Saphos, OPM Human Resources, Office of Personnel Management... reviews and evaluates the initial appraisal of a senior executive's performance by the supervisor, and.... Grimes, III, Chief Operating Officer Mark D. Reinhold, Deputy Associate Director for OPM Human...

  4. Una mirada crítica sobre Lengua Madre Una conversación con María Teresa Andruetto (23 de diciembre de 2013

    Directory of Open Access Journals (Sweden)

    Costanza Borghi

    2014-06-01

    Full Text Available Una mirada crítica sobre Lengua MadreUna conversación con María Teresa Andruetto(23 de diciembre de 2013por Costanza Borghi, Serena Cappellini, Sara De Simone,Alma Martini, Valentina Paleari, Marco Pozzoni,Annamaria Rodio, Beatrice Tresoldi

  5. A new genus and species of Cecidomyiidae (Diptera) from leaf blister galls on Ribes (Grosulariaceae)in North America

    Science.gov (United States)

    Ribesia sarae Gagné, new genus, new species(Diptera: Cecidomyiidae), is described from simple leaf blister galls on Ribes aureum(Grossulariaceae) from Montana. The female abdomen is superficially similar to that of CystiphoraKieffer and SackenomyiaFelt. The three genera are compared. Because of stro...

  6. After Dark in the Antipodes: Pedagogy, Place and Queer Phenomenology

    Science.gov (United States)

    Crowley, Vicki; Rasmussen, Mary Lou

    2010-01-01

    This paper pursues issues of pedagogy, place and queer phenomenology in the context of what might be meant by the term "after-queer" or "what falls outside queer" as we currently theorise, practice and locate queer. Inspired by Sara Ahmed's account of how bodies become oriented by the ways in which they take up time and space,…

  7. Guidance: Interim Municipal Settlement Policy

    Science.gov (United States)

    Interim guidance and fact sheets regarding settlements involving municipalities or municipal waste under Section 122 CERCLA as amended by SARA. Interim policy sets forth the criteria by which EPA generally determines whether to exercise enforcement discretion to pursue MSW generators and transporters as PRPs.

  8. Mord og metafysik

    DEFF Research Database (Denmark)

    Hansen, Kim Toft

    2012-01-01

    overnaturlige. Mord og metafysik inddrager titler fra forfatterskaber som Arne Dahl, Elsebeth Egholm, Stieg Larsson, Håkan Nesser, Sara Blædel, Gunnar Staalesen, Tom Egeland, Camilla Läckberg, Anne Holt, Peter Høeg, Johan Theorin og mange flere. Desuden suppleres disse af tv-serier som Rejseholdet, Livvagterne...

  9. Mord og metafysik

    DEFF Research Database (Denmark)

    Hansen, Kim Toft

    overnaturlige. Mord og metafysik inddrager titler fra forfatterskaber som Arne Dahl, Elsebeth Egholm, Stieg Larsson, Håkan Nesser, Sara Blædel, Gunnar Staalesen, Tom Egeland, Camilla Läckberg, Anne Holt, Peter Høeg, Johan Theorin og mange flere. Desuden suppleres disse af tv-serier som Rejseholdet, Livvagterne...

  10. Logic Programming and Knowledge Maintenance.

    Science.gov (United States)

    1987-08-13

    the literature , and became convinced that many of the advantages of frames and semantic nets can be captured in logic programming systems by a...consists of: needs(john,money). married_to(john,mary). loves(john,mary). (mary is the dead victim in this thriller .) The victim’s sister sara consists of

  11. Logic Programming and Knowledge Base Maintenance.

    Science.gov (United States)

    1986-09-30

    but not exhaustively, surveyed much of the literature , and became convinced that many of the advantages of frames and semantic nets can be captured in...consists of. needs(john,money). married_to~john,mary). loves(john,mary). (mary is the dead victim in this thriller .) The victim’s sister sara consists of

  12. Mapping the transcription start points of the Staphylococcus aureus eap, emp, and vwb promoters reveals a conserved octanucleotide sequence that is essential for expression of these genes.

    Science.gov (United States)

    Harraghy, Niamh; Homerova, Dagmar; Herrmann, Mathias; Kormanec, Jan

    2008-01-01

    Mapping the transcription start points of the eap, emp, and vwb promoters revealed a conserved octanucleotide sequence (COS). Deleting this sequence abolished the expression of eap, emp, and vwb. However, electrophoretic mobility shift assays gave no evidence that this sequence was a binding site for SarA or SaeR, known regulators of eap and emp.

  13. Workplace Stress Relief (A Cup of Health with CDC)

    Centers for Disease Control (CDC) Podcasts

    2014-07-31

    The stress of everyday life can lead to all kinds of health problems. It’s particularly a problem at work. In this podcast, Dr. Sara Luckhaupt discusses the health impact of work-related stress.  Created: 7/31/2014 by MMWR.   Date Released: 7/31/2014.

  14. A Cohort Study of Health Effects of HTLV-I Infection in Jamaican Children and their Associations with Viral, Immunologic and Host Genetic Markers

    Science.gov (United States)

    2002-01-01

    sisters Irene, Pat, Jane , Sara, Catherine (thanks for the laptop) and brothers Jim, Dan and Terry who have always been proud of my accomplishments...Plewig G. Seborrheic dermatitis. In: Fitzpatrick TB, Eisen AZ, Wolff K, Freedberg IM, Austen KF (eds): Dermatology in General Medicine. New

  15. Assessment of speech in early-onset ataxia: a pilot study.

    Science.gov (United States)

    Kuiper, Marieke J; Brandsma, Rick; Lawerman, Tjitske F; Lunsing, Roelineke J; Keegstra, Anne L; Burger, Huibert; De Koning, Tom J; Tijssen, Marina A J; Sival, Deborah A

    2014-12-01

    The aim of the study was to determine whether paediatric ataxia speech subscores are reliably applicable for international early-onset ataxia (EOA) databases. If so, we reasoned that ataxia speech subscores should be associated with ataxia scores and involve high interobserver agreement, including those for internationally applicable Scale for Assessment and Rating of Ataxia (SARA) syllable repetition tasks (SARASRT). Three independent paediatric neurologists and a speech therapist scored speech in 52 healthy children (mean age 10y, range 4-16y) and 40 individuals with EOA (mean age 15y, range 5-34y). We compared ataxia speech subscores for the association with age and ataxia scores as well as interobserver reliability. In healthy children, ataxia speech subscores were moderately associated with age (International Cooperative Ataxia Rating Scale [ICARS]: r=-0.515; SARA: r=-0.321; pataxia scores (ICARS: r=0.552; SARA: r=0.336; pataxia scores (ICARS: r=0.735; SARA: r=0.730; pataxia speech subscores are associated with ataxia and also reveal high interobserver agreement, including those internationally applicable to SARASRT. We conclude that SARASRT appears to be applicable for EOA databases. However, before syllable repetition tasks are included, we would advise to wait for the results published by the international Childhood Ataxia and Cerebellar Group. © 2014 Mac Keith Press.

  16. Mapping the Heart

    Science.gov (United States)

    Hulse, Grace

    2012-01-01

    In this article, the author describes how her fourth graders made ceramic heart maps. The impetus for this project came from reading "My Map Book" by Sara Fanelli. This book is a collection of quirky, hand-drawn and collaged maps that diagram a child's world. There are maps of her stomach, her day, her family, and her heart, among others. The…

  17. Correct Requirements, A Factor for Success in Major Acquisition Programs

    Science.gov (United States)

    2008-06-01

    Warfighters need support throughout the procurement process in order to deliver a usable solution, or “best bang for the buck ” systems. Because overall...Streamlining Act (FASA) and Service Acquisition Reform Act (SARA) are additional opportunities to booster commercial item acquisition and competition

  18. Archaeological Investigations at Nelson Wash, Fort Irwin, California. Fort Irwin Archaeological Project Research Report Number 23. Volume 1. Revision

    Science.gov (United States)

    1991-09-01

    Mimus polygottos 0 Say’s Phoebe Savornis sara C Ruby-crowned Kinglet Regulus calendula 0 Black-throated Sparrow Amphispiza bilineata C Brewer’s...Ruby- crowned Kinglet (Regulls calendula ), Turkey Vulture (Cathartes aura), and American Robin (Turdus migratorius), all winter visitants (present

  19. Open innovatie in een gesloten omgeving

    NARCIS (Netherlands)

    Van der Duin, P.A.; Bacco, F.

    2013-01-01

    Innovatie is van levensbelang voor organisaties. We kennen de bekende voorbeelden van de Senseo van Philips en Sara Lee en de Ipad van Apple. Ook de overheid laat zich niet onbetuigd; denk aan de belastingdiskette en de Zandmotor voor de kust van Zuid-Holland. In het bedrijfsleven heeft innovatie zi

  20. Multiple Uses of a Word Study Technique

    Science.gov (United States)

    Joseph, Laurice M.; Orlins, Andrew

    2005-01-01

    This paper presents two case studies that illustrate the multiple uses of word sorts, a word study phonics technique. Case study children were Sara, a second grader, who had difficulty with reading basic words and John, a third grader, who had difficulty with spelling basic words. Multiple baseline designs were employed to study the effects of…

  1. Kanuti gildi saalis toimub kuni 24. XI festival "Continental Breakfast Tallinn"

    Index Scriptorium Estoniae

    2005-01-01

    Korraldajad: Anders Härm, Priit Raud. 4. XI Tellervo Kalleineni (Soome) performance "Lase mind/Let me". 5. XI Saralundeni (Sara Lunden, Rootsi) muusikaline performance "Sweet Beat Tour". 8. ja 9. XI esineb babaLAN (Vlado Gotvan Repnik, Sloveenia) multimeedia-performance'iga

  2. La Ley de Residencias es ya un hecho

    OpenAIRE

    Femenía,Francisco; Salomón, Susana Elsa; Papa, Sara

    2008-01-01

    Fil: Femenía, Francisco. Comisión Interinstitucional de Educación de Posgrado en Medicina Fil: Salomón, Susana Elsa. Comisión Interinstitucional de Educación de Posgrado en Medicina Fil: Papa, Sara. Comisión Interinstitucional de Educación de Posgrado en Medicina

  3. Sprogspil om følelser i supervision

    DEFF Research Database (Denmark)

    Nordentoft, Helle Merete

    2008-01-01

    Evalueringen er slut efter 5 måneders supervision af det tværfaglige team i en palliativ afdeling. En af deltagerne, Sara  kommer hen til de to supervisorer og siger, at hun ønsker at sige dem personligt tak for hele forløbet, at det har betydet meget for hende fordi - som hun udtrykker det: "Jeg...

  4. Celebrity Witnessing

    DEFF Research Database (Denmark)

    Frello, Birgitta; Christiansen, Lene Bull

    2016-01-01

    discourse’ and Sara Ahmed’s engagement with the concept of ‘orientation’. We argue that while criticising the dominant narrative modality is highly relevant, there is a risk that a too narrow focus on its reproduction can bar our view of the fact that it also enables discursive completions that can engage...

  5. Celebrity witnessing

    DEFF Research Database (Denmark)

    Christiansen, Lene Bull; Frello, Birgitta

    2016-01-01

    discourse’ and Sara Ahmed’s engagement with the concept of ‘orientation’. We argue that while criticising the dominant narrative modality is highly relevant, there is a risk that a too narrow focus on its reproduction can bar our view of the fact that it also enables discursive completions that can engage...

  6. Co-creating & Co-performing Tourism of Affects, Emotions, Feelings and Senses

    NARCIS (Netherlands)

    Buda, Dorina; van Hoven, Bettina; Hoskins, Gareth

    2014-01-01

    “What do emotions do?” asks Sara Ahmed. Emotions, feelings, senses and affects are complex, slippery concepts. They shape, circulate between and connect bodies, they belong to individuals and to collectivities alike, they reside inside, within us and outwith when they are released outwards towards o

  7. 76 FR 80949 - Request for Nominations for Voting Members on Public Advisory Panels or Committees

    Science.gov (United States)

    2011-12-27

    ... expertise in the areas of dental implants, dental materials, periodontology, tissue engineering, and dental..., Silver Toxicology Devices Panel. Spring, MD 20993, 301-796-7046, email: Dental Products Panel. Sara..., clinical pathology, clinical laboratory medicine, endocrinology, and diabetes. Dental Products Panel of...

  8. SEL Interventions in Early Childhood

    Science.gov (United States)

    McClelland, Megan M.; Tominey, Shauna L.; Schmitt, Sara A.; Duncan, Robert

    2017-01-01

    Young children who enter school without sufficient social and emotional learning (SEL) skills may have a hard time learning. Yet early childhood educators say they do not get enough training to effectively help children develop such skills. In this article, Megan McClelland, Shauna Tominey, Sara Schmitt, and Robert Duncan examine the theory and…

  9. Law and Society in Seattle: Law-Related Education as Culturally Responsive Teaching

    Science.gov (United States)

    VanderStaay, Steven L.

    2007-01-01

    In this article, I provide a portrait (Sara Lawrence-Lightfoot and Jessica Hoffman Davis 1997) of a renowned law-related education (LRE) program, its teacher, and four of its student-participants. Following the portrait, I discuss theoretical explanations for the success of ethnic-minority students in this and other LRE programs. These…

  10. How Can Authentic Community Engagement Be Fostered through Federal Policy?

    Science.gov (United States)

    Gray, Richard

    2013-01-01

    Sara McAlister, in her article "Why Community Engagement Matters in School Turnaround," in this issue (p35-42) of "Voices in Urban Education," lays out the strong research base showing that family and community participation is a crucial resource not only for individual student achievement, but also for catalyzing and…

  11. Diagnosis of asphaltene stability in crude oil through “two parameters” SVM model

    DEFF Research Database (Denmark)

    Chamkalani, Ali; Mohammadi, Amir H.; Eslamimanesh, Ali

    2012-01-01

    is determined using the existing SARA fractions experimental data for this purpose. The powerful Least-Square modification of Support Vector Machine (LSSVM) strategy is applied to develop a computer program, by which the asphaltene stability region can be determined for various crudes. The developed two...

  12. Corporate social responsibility in the coffee sector: The dynamics of MNC responses and code development

    NARCIS (Netherlands)

    A. Kolk

    2005-01-01

    Since the collapse of the international coffee agreement in 1989, attention has increasingly focused on the role of multinational corporations in this sector. As the main actors in the international coffee chain, companies such as Sara Lee/Douwe Egberts, Nestlé and Kraft have been pressurised to sho

  13. Why Critical Literacy Should Turn to "The Affective Turn": Making a Case for Critical Affective Literacy

    Science.gov (United States)

    Anwaruddin, Sardar M.

    2016-01-01

    The central argument of this essay is that critical literacy with a rationalistic bent may not enable us to cope with ethical dilemmas in our responsiveness to human sufferings. I argue that critical literacy education would benefit from turning to the recent scholarship on affect/emotion studies. I draw upon the works of Sara Ahmed--one of the…

  14. Integrated and Applied Curriculum: Six School-to-Work Units.

    Science.gov (United States)

    Lo Guidice, Tom, Comp.

    This publication consists of six units for middle and high school grades that incorporate school-to-work (STW). The six units were developed by six practicing teachers. The first unit, "Wellness: An Integrated Unit with STW Emphasis for Seventh Grade" (Sara Hellenbrand), provides STW objectives and a list of activities. The second unit,…

  15. Unmarried Parents in College: Pathways to Success. Fast Focus. No. 9-2011

    Science.gov (United States)

    Goldrick-Rab, Sara; Sorensen, Kia

    2011-01-01

    This issue of "Fast Focus" is based on an article published by Sara Goldrick-Rab and Kia Sorensen in the fall 2010 issue of "The Future of Children" (Vol. 20, No. 2; used here with permission), which focuses on "fragile families," defined as families in which the parents were unmarried when the child was born. The authors examine unmarried parents…

  16. 76 FR 76189 - 2002 Reopened-Previously Denied Determinations;

    Science.gov (United States)

    2011-12-06

    ...; Sara Lee Corp., Bensenville, IL. TA-W-80,068; New Enterprise Stone and Lime, Erie, PA . TA-W-80,103..., Fairfield, OH. TA-W-80,315; Marlette Homes, Inc., Lewistown, PA. TA-W-80,323; Allen Family Foods,...

  17. International Organizations and Environmental Protection

    DEFF Research Database (Denmark)

    Meyer, Jan-Henrik; Kaiser, Wolfram

    of sustainable development.” · Sara Lorenzini, University of Trento Wolfram Kaiser is Professor of European Studies at the University of Portsmouth and Visiting Professor at the College of Europe in Bruges. His recent publications include Writing the Rules for Europe: Experts, Cartels, and International...

  18. VES magas Riias

    Index Scriptorium Estoniae

    2002-01-01

    Valie Export Society (Kadi Estland, Killu Sukmit, Marko Laimre, Meelis Salujärv) osales 9.-11. V Riias toimunud rahvusvahelisel üritusel "6th element" remake-aktsiooniga. Performance'itega esinesid Sara Lunden Rootsist, Kate Pendry Norrast, Jenia Svetlova Venemaalt, Solomia Savtshuk ja Natalia Golibroda Ukrainast

  19. Presence and Absence: The Impact of Collaborative Blogging on Devised Ensemble Work

    Science.gov (United States)

    Bable, Wendy; Waxman, Sara; Bellomo, Samantha

    2011-01-01

    This article puts forth the reflections and questions of three artists at People's Light and Theatre (Resident Teaching Artist Sara Waxman, Resident Director Samantha Bellomo, and Producer for Arts Discovery Programs, Wendy Bable) in their ongoing dialogue on the intersection of media, young artists, and theatre-making in the Teen Summerstage…

  20. ICARUS LIVE FACEBOOK

    CERN Multimedia

    CERN video productions; Ronaldus Suykerbuik; Jacques Fichet; Paola Catapano; Julie Haffner; Sara Charley

    2017-01-01

    13th of June is a big day for ICARUS! The giant neutrino detector is ready for a long journey across the Atlantic Ocean, as it will travel from CERN (Switzerland) to Fermilab (US). There, it will its new life, looking for extremely elusive particles. Host : Sara Charley Guests: Stefania Bordoni (CERN neutrino platform), Andrea Zani (ICARIS collaboration)

  1. DoD Technology Transfer Program: Defense Industrial Base Seminar and Workshops

    Science.gov (United States)

    2010-06-16

    Disclosures App licat ions Issued • 2001 • 2002 2003 • 2004 • 2005 2006 2007 2008 2009 APPROVED FOR PUBLIC RELEASE • Provide skill...Carson, CO – ORTA: Paul Mele and Sara Miller, Army Medical Research and Materiel Command – Inventor : Sgt. Lynn Randall King, 91W Command

  2. VES magas Riias

    Index Scriptorium Estoniae

    2002-01-01

    Valie Export Society (Kadi Estland, Killu Sukmit, Marko Laimre, Meelis Salujärv) osales 9.-11. V Riias toimunud rahvusvahelisel üritusel "6th element" remake-aktsiooniga. Performance'itega esinesid Sara Lunden Rootsist, Kate Pendry Norrast, Jenia Svetlova Venemaalt, Solomia Savtshuk ja Natalia Golibroda Ukrainast

  3. Maternal Thinking and Beyond: Towards a Care-Full Pedagogy for Early Childhood

    Science.gov (United States)

    Luff, Paulette; Kanyal, Mallika

    2015-01-01

    This paper explores feminist philosopher Sara Ruddick's concept of "maternal thinking" and considers the applicability and use of her ideas for early childhood pedagogy. This is illustrated through a small-scale case study, undertaken in early years settings in England, in which three dimensions of maternal thinking are evidenced in the…

  4. Graphical Requirements for Force Level Planning. Volume 2

    Science.gov (United States)

    1991-09-01

    39 o 3D typography tied to turnpoints - display 3D topography when the user clicks on a turnpoint. This technique uses the actual path as an active...chapter 8, pages 201-224. 4 Sara Bly. Sound and Computer Information Presentation. PhD thesis, University of California, Davis, 1982. 5 Piero P Bonissone

  5. Spazio ASI, INFN e Nobel Ting a caccia di antimateria

    CERN Multimedia

    Boz,

    2003-01-01

    "Una apparecchiatura per la ricerca dell' antimateria che nell'autunno del 2005 sara' installata sulla Stazione Spaziale e' al centro di un accordo di collaborazione tra l'Agenzia Spaziale Italiana e il Nobel Samuel Ting, del Mit e del Cern di Ginevra, firmato oggi a Roma (1 page).

  6. Law and Society in Seattle: Law-Related Education as Culturally Responsive Teaching

    Science.gov (United States)

    VanderStaay, Steven L.

    2007-01-01

    In this article, I provide a portrait (Sara Lawrence-Lightfoot and Jessica Hoffman Davis 1997) of a renowned law-related education (LRE) program, its teacher, and four of its student-participants. Following the portrait, I discuss theoretical explanations for the success of ethnic-minority students in this and other LRE programs. These…

  7. JPRS Report, Soviet Union, Political Affairs

    Science.gov (United States)

    1989-07-27

    Issyk-Kul, which took over the shore at Koy-Sara, praised even in ancient sagas , for industrial facilities. I am also convinced that the shores of...colony is a fact. One life is the one that is on display. The other life, the twilight life, begins during the hours when the yellow lantern of the

  8. Reach for Reference. What Did We Wear Yesterday? A New Costume Reference

    Science.gov (United States)

    Safford, Barbara Ripp

    2004-01-01

    This article describes a new five-volume series, "Fashion, Costume, and Culture: Clothing, Headwear, Body Decorations, and Footwear through the Ages" (Sara Pendergast and Tom Pendergast, Editors), that provides a broad overview of costume traditions of diverse cultures from prehistoric times to the present day. These volumes illustrate how…

  9. "Walking with a Ghost": Arts-Based Research, Music Videos, and the Re-Performing Body

    Science.gov (United States)

    Taylor, Pamela G.; Wilder, Shannon O.; Helms, Kathryn R.

    2007-01-01

    In folk-rock duo Tegan and Sara's 2004 music video "Walking with a Ghost," two women face one another, mirrored images in black and white. One is dressed in black--grunge shirt, pants and boots, while the other stands barefoot in a simple white dress. The black-clad figure removes three red paper hearts from her twin's chest, leaving crimson…

  10. Infección por virus West Nile

    National Research Council Canada - National Science Library

    Pérez Ruiz, Mercedes; Sanbonmatsu Gámez, Sara; Ángel Jiménez Clavero, Miguel

    2011-01-01

    ... por virus West Nile Mercedes Pérez Ruiz a, *, Sara Sanbonmatsu Gámez a y Miguel Ángel Jiménez Clavero b a Servicio de Microbiología, Hospital Universitario Virgen de las Nieves, Gr...

  11. HF Radio Astronomy from a Small Satellite

    Science.gov (United States)

    2016-06-15

    antenna as shown in Figure 4. Dual mode loop-dipole elements are described in [25,29,30]. The 10 MHz radiation patterns of the six modes are shown in... telemetry , GPS, and vector antenna modules. Robey 14 30th Annual AIAA/USU Conference on Small Satellites Alexander Morris. Thanks to Sara Klein for

  12. What Are Bath Salts?

    Science.gov (United States)

    ... in Missouri. She won the 3rd place 2013 Addiction Science Award . Read More » 0 Comments Bath Salts: An Emerging Danger February 05, 2013 / Sara Bellum ... copy Listen Drug Facts ... Nicotine, & E-Cigarettes Brain and Addiction Drug Overdoses in Youth HIV/AIDS and Drug ...

  13. Rumen lipopolysaccharide and inflammation during grain adaptation and subacute ruminal acidosis in steers.

    Science.gov (United States)

    Gozho, G N; Krause, D O; Plaizier, J C

    2006-11-01

    Three rumen-fistulated Jersey steers were gradually adapted to a wheat-barley concentrate over a 4-wk period. Adaptation steps consisted of four 1-wk periods during which steers were fed diets with forage-to-concentrate (F:C) ratios of 100:0, 79:21, 59:41, and 39:61. The forage consisted of chopped hay (CH), and the concentrate consisted of pelleted concentrate containing 50% ground wheat and 50% ground barley. Steers were fed the all-forage diet ad libitum during wk 1. Feed offered in wk 2 to 4 was kept constant at the ad libitum intake during wk 1. On 2 d that were set 3 d apart during wk 5, subacute ruminal acidosis (SARA) was induced in the steers by feeding a diet with an F:C ratio of 24:76 by offering them 0.9 kg of CH at 0900 h followed by 2 meals of 3.0 kg each of wheat-barley pellets (WBP) at 1100 h and 1300 h and 0.9 kg of CH at 1700 h, to depress rumen pH for at least 3 h/d below 5.6. The average concentrate inclusion for the SARA induction diet was 76 +/- 10% DM. During stepwise adaptation, time with pH below 5.6 increased to an average of 121 min/d when the steers were consuming a diet containing 61% DM as WBP. Dietary inclusion of WBP at the rate of 76% DM induced SARA because the steers spent an average of 219 min/d with pH below 5.6. The free ruminal lipopolysaccharide (LPS) concentration increased from 6,310 endotoxin units (EU)/mL with the all-forage diet to 18,197 EU/mL with the 61% concentrate diet. The ruminal LPS concentration increased to 26,915 EU/mL when SARA was induced. Serum haptoglobin increased from 0.53 mg/mL when steers were on the all-forage diet to 1.90 mg/mL with the 61% concentrate diet and were not increased further by inducing SARA. The serum amyloid-A concentration was not affected by increasing dietary concentrate during stepwise adaptation to the concentrate, but increased from 71 to 163 microg/mL when SARA was induced. A gradual increase in dietary concentrate so that the F:C ratio decreased to 39:61 resulted in increased

  14. Sara E. Chapman, Private Ambition and Political Alliances. The Phélypeaux de Pontchartrain Family and Louis XIV’s Government, 1650-1715, Rochester, The University of Rochester Press, 2004, xvi-292 p., $ 80.Charles Frostin, Les Pontchartrain, ministres de Louis XIV. Alliances et réseaux d’influence sous l’Ancien Régime, Rennes, Presses Universitaires de Rennes, 2006, Collection « Histoire », 597 p., 25 €.

    Directory of Open Access Journals (Sweden)

    Elie Haddad

    2010-07-01

    Full Text Available Ces deux livres portent sur des sujets semblables : les réseaux de clientèles des Phélypeaux de Pontchartrain analysés principalement sous l’angle des alliances matrimoniales et des relations de parenté qui les structurent. Leur intérêt dépasse donc largement la simple histoire familiale des Pontchartrain ou l’histoire de leur action politique : c’est un éclairage sur les liens entre histoire sociale et histoire politique qu’ils entendent projeter, sur une tranche chronologique plus large que...

  15. Determination of fluoroquinolones in aquaculture products by ultra-performance liquid chromatography-tandem mass spectrometry (UPLC-MS/MS).

    Science.gov (United States)

    Pearce, J N; Burns, B G; van de Riet, J M; Casey, M D; Potter, R A

    2009-01-01

    An ultra-performance liquid chromatography-tandem mass spectrometry (UPLC-MS/MS) method was developed for the determination of fluoroquinolones-ciprofloxacin (CIPRO), danofloxacin (DANO), enrofloxacin (ENRO) and sarafloxacin (SARA)-in aquaculture products, specifically salmon, shrimp and tilapia. After initial sample extraction with an acidic acetonitrile solution, the extract was diluted with dichloromethane and centrifuged, then an aliquot was concentrated and applied to a C18 solid-phase extraction cartridge and concentrated for a second time. The resultant residue was dissolved in acetonitrile, diluted with water, and then further defatted with hexane. The fluoroquinolone residues were determined by UPLC with an HSS T3 C18 reverse-phase column using an ammonium hydroxide-formic acid buffer in an acetonitrile gradient with MS/MS detection using multiple reaction monitoring. Average recoveries for salmon tissue ranged from 73% for DANO to 95% for SARA, for shrimp from 71% for DANO to 109% for SARA, and from 62% for DANO to 111% for SARA in tilapia, fortified at the 1.0 ng g(-1) level. Standard curves were linear between 0.002 and 0.5 ng injected for all compounds. Detection limits of 0.2 ng g(-1) for CIPRO, DANO, ENRO, and SARA were easily obtainable. The operational errors, interferences, and recoveries for fortified samples demonstrate that this described method is suitable for routine use in a regulatory programme. The recommended method is simple, rapid, specific and reliable for the routine monitoring of fluoroquinolone residues in aquatic species such as salmon, tilapia and shrimp.

  16. 食品安全的社会治理%Social Management of Food Safety

    Institute of Scientific and Technical Information of China (English)

    窦竹君

    2011-01-01

    食品安全问题是社会治理问题。食品安全的社会治理有三个维度:一是生产者、销售者自我道德约束;二是行业自律;三是政府监管。目前食品安全社会治理存在的问题是过分注重政府监管,忽视行业自律,诚信道德文化缺乏,安全食品生产和消费的机制没有理顺。打造食品安全的长效机制,必须重视诚信文化建设,以"业必归会"为原则组建强有力的行业组织并使之发挥行业自律功能,注重发挥农村专业合作社在食品安全中特殊作用,采取措施理顺安全食品生产和消费机制。%It is a problem of social management to ensure safety of the food products.There are three dimensions: moral constrains of producer and seller,self-regulation of the trades,and government regulation.The problems of social management are excessively dependent on supervising and governing from government,ignoring action of self-regulation,deficiency of moral culture,and lacking mechanism to secure food producing and consuming.In order to ensure food safety for long,we should reconstruct moral culture,structure trade organization for trade self-regulation,emphasize the special actions of farmer specialization cooperation,and improve producing and consuming mechanism.

  17. A novel curve fitting method for AV optimisation of biventricular pacemakers.

    Science.gov (United States)

    Dehbi, Hakim-Moulay; Jones, Siana; Sohaib, S M Afzal; Finegold, Judith A; Siggers, Jennifer H; Stegemann, Berthold; Whinnett, Zachary I; Francis, Darrel P

    2015-09-01

    In this study, we designed and tested a new algorithm, which we call the 'restricted parabola', to identify the optimum atrioventricular (AV) delay in patients with biventricular pacemakers. This algorithm automatically restricts the hemodynamic data used for curve fitting to the parabolic zone in order to avoid inadvertently selecting an AV optimum that is too long.We used R, a programming language and software environment for statistical computing, to create an algorithm which applies multiple different cut-offs to partition curve fitting of a dataset into a parabolic and a plateau region and then selects the best cut-off using a least squares method. In 82 patients, AV delay was adjusted and beat-to-beat systolic blood pressure (SBP) was measured non-invasively using our multiple-repetition protocol. The novel algorithm was compared to fitting a parabola across the whole dataset to identify how many patients had a plateau region, and whether a higher hemodynamic response was achieved with one method.In 9/82 patients, the restricted parabola algorithm detected that the pattern was not parabolic at longer AV delays. For these patients, the optimal AV delay predicted by the restricted parabola algorithm increased SBP by 1.36 mmHg above that predicted by the conventional parabolic algorithm (95% confidence interval: 0.65 to 2.07 mmHg, p-value = 0.002).AV optima selected using our novel restricted parabola algorithm give a greater improvement in acute hemodynamics than fitting a parabola across all tested AV delays. Such an algorithm may assist the development of automated methods for biventricular pacemaker optimisation.

  18. Resistance status of ticks (Acari; Ixodidae) to amitraz and cypermethrin acaricides in Isoka District, Zambia.

    Science.gov (United States)

    Muyobela, Jackson; Nkunika, Philip Obed Yobe; Mwase, Enala Tembo

    2015-12-01

    This study was designed to obtain data on the farmer's approach to tick control and to determine whether Rhipicephalus appendiculatus Neuman, Amblyomma variegatum (Fabricius), and Rhipicephalus (Boophilus) microplus (Canestrini) were resistant to amitraz and cypermethrin acaricides, in Isoka District, Zambia. Prevailing tick control practices were documented by administering a semi-structured questionnaire to 80 randomly selected smallholder livestock farmers from four agricultural camps (Longwe, Kantenshya, Kapililonga, and Ndeke) in Isoka District. Modified larval packet test (LPT) bioassay experiments were used to determine the resistance status of the common tick species against amitraz and cypermethrin acaricides. Fifty percent of respondents practiced chemical tick control with amitraz (27 %) and cypermethrin (23 %) being the acaricides in use, and were applied with knapsack sprayers. Less than 3 l of spray wash per animal was used which was considerably lower than the recommended delivery rate of 10 l of spray wash per animal. No significant susceptibility change to amitraz at 95 % confidence level was observed in R. appendiculatus and A. variegatum against amitraz. However, a significant change in the susceptibility of R. (Bo.) microplus tested with amitraz was detected at 95 % confidence. The test population had a lower susceptibility (LD50 0.014 %; LD90 0.023 %) than the reference population (LD50 0.013 %; LD90 0.020 %). The results indicated that resistance to amitraz was developing in R. (Bo.) microplus. For cypermethrin, no significant susceptibility change at 95 % confidence was observed in any of the three species and thus resistance to this chemical was not observed.

  19. Increased feeding frequency increased milk fat yield and may reduce the severity of subacute ruminal acidosis in higher-risk cows.

    Science.gov (United States)

    Macmillan, K; Gao, X; Oba, M

    2017-02-01

    The objectives of this study were to determine whether feeding behavior is different between cows at higher or lower risk for subacute ruminal acidosis (SARA) and whether increasing feeding frequency could be used to reduce the severity of SARA in higher-risk cows. In preliminary studies, 16 ruminally cannulated lactating cows were fed high-grain diets once per day to increase the risk of SARA. After a 17-d diet adaptation, ruminal pH was measured every 30 s over 24 h. Cows were classified as higher-risk (n = 7) or lower-risk (n = 9) for SARA based on an acidosis index (area of pH Feeding behavior was recorded every 5 min over the same 24 h. The 24-h observation period was analyzed in 3 periods of 8 h after feeding. Although there was no significant difference in overall dry matter intake, higher-risk cows spent more time eating in the first 8-h period after feeding than lower-risk cows (186 vs. 153 min) and less time eating in the third 8-h period (19 vs. 43 min). In the primary experiment, 8 ruminally cannulated lactating cows were fed a high-grain diet once per day (1×; 0800 h) or 3 times per day (3×; 0800, 1500, and 2000 h) in a crossover design with 21-d periods (16 d of treatment adaptation and 5 d of data collection). Rumen pH and feeding behavior were measured over 72 h. Behavior data were summarized separately for the 3 periods (0800 to 1500, 1500 to 2200, and 2200 to 0800 h). Four cows were categorized as higher-risk and 4 as lower-risk, based on their acidosis index. The 3× feeding reduced eating time between 0800 and 1500 h (99 vs. 145 min) and increased eating time between 2200 and 0800 h (76 vs. 43 min) for all cows, regardless of category, compared with 1× feeding. For higher-risk cows, 3× feeding reduced the area below pH 5.8 (51 vs. 98 pH × min/d), but it did not affect rumen pH for the lower-risk cows. Milk yield was not different between groups, but 3× feeding increased milk fat yield (1.22 vs. 1.08 kg/d) for all cows, regardless of

  20. Short communication: Noninvasive indicators to identify lactating dairy cows with a greater risk of subacute rumen acidosis.

    Science.gov (United States)

    Gao, X; Oba, M

    2015-08-01

    The objective of the current study was to evaluate if milk urea nitrogen (MUN) and milk fat content could be used as the noninvasive indicator to identify cows with greater or lower risk of subacute ruminal acidosis (SARA). Our hypothesis was that cows with lower MUN and milk fat content would have greater risk of SARA, whereas cows with higher MUN and milk fat content would have lower risk of SARA. In the screening study, 35 late-lactating Holstein cows (DIM=250±71.1; BW=601±45.4kg) were fed a high-grain diet containing 35% forage and 65% concentrate mix ad libitum for 21 d. Concentration of MUN ranged from 5.7 to 13.9Mg/dL among the 35 cows, and the average milk fat content was 3.5%. Then, 5 cows with highest MUN concentrations with milk fat higher than 3.5% were selected as animals that presumably have low risk of SARA, and 5 cows with lowest MUN concentrations with milk fat less than 3.5% were selected as animals that presumably have high risk of SARA. These 10 animals were ruminally cannulated during the subsequent dry period. As 1 low-risk cow was culled due to fatty liver, 9 animals (DIM=122±33.2; BW=615±49.1kg) were used in the subsequent study in the following lactation. All cows were fed a high-grain diet consisting of 35% forage and 65% concentrate mix ad libitum for 21 d. Ruminal pH was measured every 30 s for 72 h. Minimum (5.75 vs. 5.30) and mean ruminal pH (6.35 vs. 6.04) was higher for low- compared with high-risk animals. In addition, duration of rumen pH below 5.8 was shorter in low-risk animals (52.5 vs. 395min/d). These results suggested that MUN and milk fat content in late-lactating cows fed a high-grain diet may be used to identify cows that have higher or lower risk of SARA. Copyright © 2015 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  1. Why CLEAN when you can PURIFY?

    CERN Document Server

    Carrillo, Rafael E; Wiaux, Yves

    2013-01-01

    We extend previously proposed radio-interferometric imaging approaches based on convex optimization to handle continuous visibilities and large-scale optimization problems. We propose a general algorithmic framework based on the simultaneous-direction method of multipliers to solve sparse imaging problems. The algorithm offers a parallel implementation structure, thus providing a significant gain in terms of speed and scalability to very high dimensions. We implement various state-of-the-art sparsity regularization priors, including our recent average sparsity approach SARA, in a new imaging software dubbed PURIFY. We evaluate through realistic simulations the performance of the software in terms of reconstruction quality and computational speed. Simulation results confirm both the superiority of SARA for continuous Fourier measurements and the fact that the new algorithmic structure offers a promising path to handle large-scale problems. Code is available at https://github.com/basp-group/purify

  2. Briefing paper -- Remedial Action Assessment System

    Energy Technology Data Exchange (ETDEWEB)

    Buelt, J.L.

    1990-04-01

    Congress has mandated a more comprehensive management of hazardous wastes with the Resource Conservation and Recovery Act (RCRA), the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA or Superfund'') and the Superfund Amendment and Reauthorization Act (SARA). This mandate includes restoration of disposal sites contaminated through past disposal practices. This mandate applies to facilities operated for and by the Department of Energy (DOE), just as it does to industrial and other institutions. To help implement the CERCLA/SARA remedial investigation and feasibility study (RI/FS) process in a consistent, timely, and cost-effective manner, a methodology needs to be developed that will allow definition, sorting, and screening of remediation technologies for each operable unit (waste site). This need is stated specifically in Section 2.2.2.1 of the October 1989 Applied Research, Development, Demonstration, Testing, and Evaluation (RDDT E) Plan of the DOE. This Briefing Paper is prepared to respond to this need. 1 fig.

  3. Spectral characterization of crude oil using fluorescence (synchronous and time-resolved) and NIR (Near Infrared Spectroscopy); Caracterizacao espectral do petroleo utilizando fluorescencia (sincronizada e resolvida no tempo) e NIR (Near Infrared Spectroscopy)

    Energy Technology Data Exchange (ETDEWEB)

    Falla Sotelo, F.; Araujo Pantoja, P.; Lopez-Gejo, J.; Le Roux, G.A.C.; Nascimento, C.A.O. [Universidade de Sao Paulo (USP), SP (Brazil). Dept. de Engenharia Quimica. Lab. de Simulacao e Controle de Processos; Quina, F.H. [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Quimica. Centro de Capacitacao e Pesquisa em Meio Ambiente (CEPEMA)

    2008-07-01

    The objective of the present work is to evaluate the performance of two spectroscopic techniques employed in the crude oil characterization: NIR spectroscopy and fluorescence spectroscopy (Synchronous fluorescence - SF and Time Resolved Fluorescence - TRF) for the development of correlation models between spectral profiles of crude oil samples and both physical properties (viscosity and API density) and physico-chemical properties (SARA analysis: Saturated, Aromatic, Resins and Asphaltenes). The better results for viscosity and density were obtained using NIR whose prediction capacity was good (1.5 cP and 0.5 deg API, respectively). For SARA analysis, fluorescence spectroscopy revealed its potential in the model calibration showing good results (R2 coefficients greater than 0.85). TRF spectroscopy had better performance than SF spectroscopy. (author)

  4. Ein bunter Hund, die tool-box und lipstick lesbians A Sore Thumb, the Tool-Box, and Lipstick Lesbians

    Directory of Open Access Journals (Sweden)

    Ruben Marc Hackler

    2007-11-01

    Full Text Available Sara Mills legt eine Einführung in die Diskursanalyse vor, die durch ihre Ausrichtung am Forschungsprozess und ihr Interesse an der Vielzahl von Diskursen überzeugt. Aus dem Wald von Einführungen ragt sie heraus durch ihre Konzentration auf gesellschaftskritische Fragen, wie sie unter anderem vom Feminismus aufgeworfen wurden, und vertritt ein engagiertes Wissenschaftsverständnis.Sara Mills presents an introduction to discourse analysis made convincing through her concentration on the research process and her interest in multiple discourses. Her work distinguishes itself from the plethora of other such introductions in that she concentrates on social questions and how they are produced by feminism (among other aspects. She also possesses an engaging understanding of scholarship.

  5. Die räumliche Dimension von Herrschaftsverhältnissen The Spatial Dimension of Relations of Dominance

    Directory of Open Access Journals (Sweden)

    Ruben Marc Hackler

    2006-11-01

    Full Text Available Sara Mills stellt in klarer Sprache ein Konzept vor, sexistische, rassistische und klassenbezogene Herrschaftspraxen in den Kolonien des British Empire hinsichtlich ihrer räumlichen Dimension zu analysieren. Ihr Ansatz soll möglichst viele Formen von Herrschaft integrieren, offen bleibt aber die Frage, ob dabei das von ihr verwendete Habituskonzept Bourdieus die passende Erklärung hierzu liefert.Sara Mills presents, in clear language, a concept for analyzing the sexists, racist, and class-based practices of dominance in the colonies of the British Empire based on their spatial dimensions. Her approach intends to integrate as many forms of dominance as possible into the discussion, however, the question as to whether Bourdieu’s habitus concept utilized by Mills offers the appropriate explanation remains unanswered.

  6. Time-To-Complete Prediction for Data Transfers

    CERN Document Server

    Toler, Wesley

    2016-01-01

    Currently, there is no prediction provided to users for the amount of time a particular data transfer from one site in the Worldwide LHC Computing Grid to another will take to complete. To develop a time-to-complete prediction, network performance data and per-file information is gathered from two separate databases and fused, and the resulting cleaned data is fitted using random forest regression. Results are shown for two separate links: the link from CERN Data Centre to Brookhaven National Laboratory’s ATLAS data center, and the link from CERN Data Centre to SARA-MATRIX in Amsterdam. A total RMS error of 25.93 minutes between predicted and test data is found for the CERN-PROD -> BNL-ATLAS link, while the CERN-PROD -> SARA-MATRIX link yields a total RMS error of 3.00 minutes.

  7. Proceedings of the 3rd Biennial Conference of the Society for Implementation Research Collaboration (SIRC) 2015: advancing efficient methodologies through community partnerships and team science

    OpenAIRE

    Kerns, Suzanne; Puspitasari, Ajeng; Hendricks, Karin; Pierson, Andria; Fizur, Phil; Comtois, Katherine A.; Green, Amy E; Trott, Elise M.; Willging, Cathleen E.; Fernandez, Maria E.; Woolf, Nicholas H.; Liang, Shuting Lily; Heredia, Natalia I.; Kegler, Michelle; Risendal, Betsy

    2016-01-01

    Table of contents Introduction to the 3rd Biennial Conference of the Society for Implementation Research Collaboration: advancing efficient methodologies through team science and community partnerships Cara Lewis, Doyanne Darnell, Suzanne Kerns, Maria Monroe-DeVita, Sara J. Landes, Aaron R. Lyon, Cameo Stanick, Shannon Dorsey, Jill Locke, Brigid Marriott, Ajeng Puspitasari, Caitlin Dorsey, Karin Hendricks, Andria Pierson, Phil Fizur, Katherine A. Comtois A1: A behavioral economic perspective ...

  8. Sex and starvation: Famine and three Chadian societies

    OpenAIRE

    Brown, E.P.

    1991-01-01

    Metadata only record This chapter looks at the way three traditional Chadian societies: the Kanembou, the Maba and the Sara, divide labour tasks along the lines of gender, and the impact this division has on risk avoidance and famine coping. The most crucial factors in coping with a food deficit is the possession of some economically productive skills and the right to use and dispose of a large variety of resources on which an individual can depend for existence. Pronounced differences in ...

  9. Sub-inhibitory tigecycline concentrations induce extracellular matrix binding protein Embp dependent Staphylococcus epidermidis biofilm formation and immune evasion.

    Science.gov (United States)

    Weiser, Julian; Henke, Hanae A; Hector, Nina; Both, Anna; Christner, Martin; Büttner, Henning; Kaplan, Jeffery B; Rohde, Holger

    2016-09-01

    Biofilm-associated Staphylococcus epidermidis implant infections are notoriously reluctant to antibiotic treatment. Here we studied the effect of sub-inhibitory concentrations of penicillin, oxacillin, vancomycin, daptomycin, linezolid and tigecycline on S. epidermidis 1585 biofilm formation, expression of extracellular matrix binding protein (Embp) and potential implications for S. epidermidis - macrophage interactions. Penicillin, vancomycin, daptomycin, and linezolid had no biofilm augmenting effect at any of the concentrations tested. In contrast, at sub-inhibitory concentrations tigecycline and oxacillin exhibited significant biofilm inducing activity. In S. epidermidis 1585, SarA is a negative regulator of giant 1 MDa Embp, and down regulation of sarA induces Embp-dependent assembly of a multi-layered biofilm architecture. Dot blot immune assays, confocal laser scanning microscopy, and qPCR showed that under biofilm inducing conditions, tigecycline augmented embp expression compared to the control grown without antibiotics. Conversely, expression of regulator sarA was suppressed, suggesting that tigecycline exerts its effects on embp expression through SarA. Tigecycline failed to induce biofilm formation in embp transposon mutant 1585-M135, proving that under these conditions Embp up-regulation is necessary for biofilm accumulation. As a functional consequence, tigecycline induced biofilm formation significantly impaired the up-take of S. epidermidis by mouse macrophage-like cell line J774A.1. Our data provide novel evidence for the molecular basis of antibiotic induced biofilm formation, a phenotype associated with inherently increased antimicrobial tolerance. While this could explain failure of antimicrobial therapies, persistence of S. epidermidis infections in the presence of sub-inhibitory antimicrobials is additionally propelled by biofilm-related impairment of macrophage-mediated pathogen eradication.

  10. Development of a Concept Maturity Assessment Framework

    Science.gov (United States)

    2010-03-01

    Harding and Mr. Luke Schaub for giving me the opportunity to work in challenging jobs . I thank Col Sara Beth Cliatt, Lt Col Chris Beverly, and Maj John... homework ” (pg 49), had the greatest chance for success. Khuranan and Rosenthal (1997) argue that to execute the front-end activities cor- rectly an...where it should be. The proposed model herein is similar to a model used to evaluate ear- ly childhood development. The Child Development Inventory

  11. DEVELOPMENT OF FINE MOTOR COORDINATION AND VISUAL-MOTOR INTEGRATION IN PRESCHOOL CHILDREN

    OpenAIRE

    Haris MEMISEVIC; Selmir HADZIC

    2013-01-01

    Fine motor skills are prerequisite for many everyday activities and they are a good predictor of a child's later academic outcome. The goal of the present study was to assess the effects of age on the development of fine motor coordination and visual-motor integration in preschool children. The sample for this study consisted of 276 preschool children from Canton Sara­jevo, Bosnia and Herzegovina. We assessed children's motor skills with Beery Visual Motor Integration Test and Lafayette Pegbo...

  12. Calibration of the M(sub s):m(sub b) Discriminant at the International Monitoring System Array NVAR (PS-47)

    Science.gov (United States)

    2005-09-01

    Jessie L. Bonner, Ileana M. Tibuleac, David G. Harkrider, Robert H. Shumway, Eugene H- enin , Sara A. Russell, David Russell, Delainc T. Reiter, and Robert... software (Wessel and Smith, 1998), Computer Programs in Seismology (Herrmann, 2002), and Matlab, which were all used to generate and present the results...reviewer helped improve the paper during the review process. We thank the developers of the Generic Mapping Tools software (Wessel and Smith, 1998

  13. Anvendelse af Water FLUTe multi-level vandprøvetagning til DNAPL-karakterisering

    DEFF Research Database (Denmark)

    Janniche, Gry Sander; Kerrn-Jespersen, Henriette; Christensen, Anders G.;

    2013-01-01

    Denne artikel omhandler erfaringer med anvendelse af en ny metode, Water FLUTe til niveauspecifik vandprøvetagning i fm. karakterisering af DNAPL i et kalkmagasin. Metoden blev anvendt i et samarbejdsprojekt mellem DTU Miljø og Region Hovedstaden om afprøvning af metoder til bestemmelse af DNAPL ...... (se artikler i Jordforurening.info Nr. 1, 2013, s. 11-23) eller hele projektet på www.sara.env.dtu.dk....

  14. Microstructural Characteristics of High Rate Plastic Deformation in Elektron (trademark) WE43 Magnesium Alloy

    Science.gov (United States)

    2012-04-01

    Microstructural Characteristics of High Rate Plastic Deformation in Elektron ™ WE43 Magnesium Alloy by Joseph Hamilton, Sarah T. Brennan...Ground, MD 21005-5069 ARL-RP-363 April 2012 Microstructural Characteristics of High Rate Plastic Deformation in Elektron ™ WE43 Magnesium...Alloy Joseph Hamilton, Sara T. Brennan, and Yongho Sohn University of Central Florida Bruce Davis and Rick DeLorme Magnesium Elektron North

  15. Alteration in Fecal Microbiota Associated with Grain-induced Subacute Ruminal Acidosis Challenge in Dairy Cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    of the control period, and second and last day of full SARA-feeding. DNA was extracted and the V4 region of bacterial 16S rRNA gene was amplified and subjected to Illumina sequencing. Bioinformatics were performed using QIIME and resultant operational taxonomic units (OTUs) were aligned to Greengenes database...... of the disease. bovine, subacute ruminal acidosis, fecal microbiome, biological marker Host publication information...

  16. Proceedings of the 3rd Biennial Conference of the Society for Implementation Research Collaboration (SIRC) 2015: advancing efficient methodologies through community partnerships and team science

    OpenAIRE

    Kerns, Suzanne; Puspitasari, Ajeng; Hendricks, Karin; Pierson, Andria; Fizur, Phil; Comtois, Katherine A.; Green, Amy E.; Trott, Elise M.; Willging, Cathleen E.; Fernandez, Maria E.; Woolf, Nicholas H.; Liang, Shuting Lily; Heredia, Natalia I.; Kegler, Michelle; Risendal, Betsy

    2016-01-01

    Table of contents Introduction to the 3rd Biennial Conference of the Society for Implementation Research Collaboration: advancing efficient methodologies through team science and community partnerships Cara Lewis, Doyanne Darnell, Suzanne Kerns, Maria Monroe-DeVita, Sara J. Landes, Aaron R. Lyon, Cameo Stanick, Shannon Dorsey, Jill Locke, Brigid Marriott, Ajeng Puspitasari, Caitlin Dorsey, Karin Hendricks, Andria Pierson, Phil Fizur, Katherine A. Comtois A1: A behavioral economic perspective ...

  17. Abrupt Climate Change in the Atlantic Ocean During the Last 20,000 Years: Insights from Multi-Element Analyses of Benthic and Planktic Foraminifera and a Coupled OA-GCM

    Science.gov (United States)

    2005-09-01

    waters. Benthic foraminiferal Cd/Ca from an intermediate depth Florida Current core documents the history of the northward penetration of southern...Kevin and Cindy, and Sara and Peter? Or without Toshi, the sushi chef at Misaki, who made my culinary life on Cape Cod tolerable? I owe many thanks to...present foraminiferal Cd/Ca and 813C data from an intermediate depth South Atlantic core in order to document the history of southern vs. northern

  18. Representationen av genus : En semiotisk studie av Tom Fords Gucci kampanj 2003 samt Frida Gianninis Gucci kampanj 2013

    OpenAIRE

    Andréasson, Sara

    2013-01-01

    Title: The representation of gender: A semiotic study of Tom Ford's Gucci campaign 2003 and Frida Gianninis Gucci Campaign 2013. Number of pages: 73 (79 including enclosures) Author: Sara Andréasson Tutor: Anne-Marie Morhed Course: Media and Communication Studies D (2IV091) Period: VT 2013 University: Division of Media and Communication, Department of Informatics and Media, Uppsala University. Purpose/ Aim: The aim of this study was to examine the representation of gender in advertising that ...

  19. Tselluloidi aura ja kaasaegne kunst / Hanno Soans

    Index Scriptorium Estoniae

    Soans, Hanno, 1974-

    2004-01-01

    Muutustest filmitegemises ja filmiesteetikas. Filmi sarnanemisest tehniliselt üha enam videoga. Kunstnike tegelemisest filmiga. 26. XI näeb kinos "Sõprus" "1+1=1" raames kaasaegsete kunstnike teoseid laiekraanil: Eija-Liisa Ahtila "If 6 was 9" (1995), "Today" (1996-97), "Consolation Service" (1999); Sara Lunden ja Henry Moore Selder (sünd. 1973, Stockholm) "Deadly Boring" (2001), "She is Dead" (2003)

  20. Rumen microbial and fermentation characteristics are affected differently by bacterial probiotic supplementation during induced lactic and subacute acidosis in sheep

    Directory of Open Access Journals (Sweden)

    Lettat Abderzak

    2012-07-01

    Full Text Available Abstract Background Ruminal disbiosis induced by feeding is the cause of ruminal acidosis, a digestive disorder prevalent in high-producing ruminants. Because probiotic microorganisms can modulate the gastrointestinal microbiota, propionibacteria- and lactobacilli-based probiotics were tested for their effectiveness in preventing different forms of acidosis. Results Lactic acidosis, butyric and propionic subacute ruminal acidosis (SARA were induced by feed chalenges in three groups of four wethers intraruminally dosed with wheat, corn or beet pulp. In each group, wethers were either not supplemented (C or supplemented with Propionibacterium P63 alone (P or combined with L. plantarum (Lp + P or L. rhamnosus (Lr + P. Compared with C, all the probiotics stimulated lactobacilli proliferation, which reached up to 25% of total bacteria during wheat-induced lactic acidosis. This induced a large increase in lactate concentration, which decreased ruminal pH. During the corn-induced butyric SARA, Lp + P decreased Prevotella spp. proportion with a concomitant decrease in microbial amylase activity and total volatile fatty acids concentration, and an increase in xylanase activity and pH. Relative to the beet pulp-induced propionic SARA, P and Lr + P improved ruminal pH without affecting the microbial or fermentation characteristics. Regardless of acidosis type, denaturing gradient gel electrophoresis revealed that probiotic supplementations modified the bacterial community structure. Conclusion This work showed that the effectiveness of the bacterial probiotics tested depended on the acidosis type. Although these probiotics were ineffective in lactic acidosis because of a deeply disturbed rumen microbiota, some of the probiotics tested may be useful to minimize the occurrence of butyric and propionic SARA in sheep. However, their modes of action need to be further investigated.

  1. Weyerhaeuser Export Facility at DuPont. Volume I.

    Science.gov (United States)

    1982-05-01

    Jordan Tannenbaum, Advisory Council on Historic Preservation State and Local Agencies and Groups Orin Smith, Director, Office of Financial Management...Engle, President, Washington Environmental Council Huxley Environmental Reference Bureau, Huxley College, Western Washington State University Dorothy...Buss M Sara Jordan Lynn Phillips 282 (3) Jose (Mrs. C. L.) Taylor (3) Ned Weaver 3) Judith R. Dearden 3) L. R. and Margorie T. Montgomery (3) Sue H

  2. Implementación de juegos educativos virtuales como estrategia complementaria para la enseñanza-aprendizaje de la nomenclatura inorgánica

    OpenAIRE

    Murillo Gómez, Yamileth

    2014-01-01

    Abstract : This research is about, the educative virtual games, base on the constructivism, as a an educative tool to help in the learning- teaching process of the inorganic chemistry list, applied in the Educative Center Sara Ospina Grisales, located in the municipality of Salamina, Department of Caldas. The creation and implementation of TIC’s into the classroom, are generating a challenge, an ethical and pedagogical commitment, to teachers, in order to modify traditional classes, for al...

  3. Abattoir (Slaughterhouse) in Qaladze Sulaymaniyah, Iraq

    Science.gov (United States)

    2009-10-16

    daily reports. Further, the QC representatives were also present for all significant pours and testing and followed up on the test results. The...Sagrma, Sara, Gmo , and Qandil. Sulaymaniyah is geographically dominated by its rolling terrain, lying at the foothills of the Zagros Mountain range...to as a slaughterhouse, an abattoir 7 is a facility in which animals are killed and processed for meat or meat food products. These animals are

  4. Natsionalistlike meeleolude kaardistamine jätkub / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2008-01-01

    "Public Preparation Social Club. Natsionalismi sümptomid ja kriitika kaasaegses kunstis" 11. VII Pärnu Kunstnike Majas ja 12.-16. VII Pärnumaal. Korraldas ja modereeris Rael Artel, ettekannetega esinesid Kendra Ballingall (Winnipeg), Remco de Blaaij (Eindhoven), Övül Durmusoglu (Istanbul/Viin), Ronen Eidelman (Tel Aviv/Weimar), Claire Feeley (Dublin), Erden Kosova (Istanbul), Johannes Paul Raether (Berliin), Sara Stenczer (Budapest/Pariis) ja Tamara Zlobina (Kiiev)

  5. Ein bunter Hund, die tool-box und lipstick lesbians

    Directory of Open Access Journals (Sweden)

    Ruben Marc Hackler

    2007-11-01

    Full Text Available Sara Mills legt eine Einführung in die Diskursanalyse vor, die durch ihre Ausrichtung am Forschungsprozess und ihr Interesse an der Vielzahl von Diskursen überzeugt. Aus dem Wald von Einführungen ragt sie heraus durch ihre Konzentration auf gesellschaftskritische Fragen, wie sie unter anderem vom Feminismus aufgeworfen wurden, und vertritt ein engagiertes Wissenschaftsverständnis.

  6. Evaluation of DoD Information Analysis Centers Program: Representative Sample Study - Benefits to DoD from Use of DoD Information Analysis Centers

    Science.gov (United States)

    1990-06-01

    Defense Electronics Supply Center L. CoL Donald Haverkamp, Defense Electronics Supply Center Ms. Sara Williams , Defense Electronics Supply Center and...Kaman Sciences Corporation Dr. Cho-Yen Ho, Director P. O. Box 120 HTMIAC/ CINDAS Utica, NY 13503 Purdue University (315) 336-0937 2595 Yeager Road FAX...COMPOSITES RELIABILITY ANALYSIS CENTER INFORMATION ANALYSIS (RAC) CENTER (MMCIAC) Steven J. Flint, Technical Director Mr. William McNamara, Director

  7. A New End Tab Design for Off-Axis Tension Test of Composite Materials

    Science.gov (United States)

    1987-03-01

    City, State, and ZIP Code) CINDAS /Purdue University Attn: OUSDR&E (R&AT)(MST) 2595 Yeager Road Pentagon, Room 3DI089 West Lafayette, Indiana 47906...Undersecretary of Defense Research and Engineering. It is operated by the Center for Informa- tion and Numerical Data Analysis and Synthesis ( CINDAS ...Purdue by the Defense Electronics Supply Center (DESC), Dayton, Ohio 45444-5208, with Ms. Sara M. Williams as the Contracting Officer. HTMIAC is under

  8. Factors potentially influencing academic performance among medical students

    OpenAIRE

    Al Shawwa L; Abulaban AA; Merdad A; Baghlaf S; Algethami A; Abu-shanab J; Balkhoyor A

    2015-01-01

    Lana Al Shawwa,1 Ahmad A Abulaban,2 Abdulrhman A Abulaban,3 Anas Merdad,3 Sara Baghlaf,3 Ahmed Algethami,3 Joullanar Abu-shanab,3 Abdulrahman Balkhoyor3 1Department of Medical Education, College of Medicine, King Abdulaziz University, Jeddah, 2Department of Medicine-Neurology, King Fahad National Guard Hospital, King Abdulziz Medical City, Riyadh, 3Department of Medical Education, College of Medicine, King Abdulaziz University, Jeddah, Kingdom of Saudi Arabia Background: Studies are needed t...

  9. Salon: Zoo

    OpenAIRE

    Brown, Chloe

    2011-01-01

    A seminar organised by artists Andrea Roe, Lucy Powell and Sara Barnes to discuss issues around The Zoo, with presentations by Chloë Brown (artist), Ines Lechleitner (artist) and Dr. Olivia Judson (evolutionary biologist and writer). Guests: Dr. Frieder Mayer (Curator of Mammals at Naturkundemuseum, Berlin), Laura Schleusser (Independent Art Curator), Nora Lange (Mammal Collection Manager at Naturkundemuseum, Berlin) and Anne Hoelck (Scenographer - researching the design of zoo enclosures...

  10. Reclaimed Territory: Civil society against the Colombian war

    OpenAIRE

    Sara Cameron; Marina Curtis-Evans

    2000-01-01

    Sara Cameron and Marina Curtis-Evans look at the role civil society has played in Colombia to confront the long-term guerrilla war fed by drug and criminal activities. They argue that without civil society groups' efforts, particularly children, the peace process would never have reached the level it has today. Development (2000) 43, 52–57. doi:10.1057/palgrave.development.1110170

  11. HERO: a space based low frequency interferometric observatory for heliophysicsenabled by novel vector sensor technology

    Science.gov (United States)

    2017-04-07

    simultane-225 ously provide loop and dipole modes [ King , 1959; Robey et al., 2016]. A perimeter loop226 provides the third loop antenna along with mechanical... Stephen White, Kamen Kozarev, Sarah Klein, Sara Seager, Fash Azad, Will287 Rogers, Tom Brown.288 Generous support for the development of the vector...20th National Solar Physics Meeting, held 31 May - 4 June, 2010 in310 Papradno, Slovakia, p. 108-130, pp. 108–130, 2010.311 King , R. The rectangular

  12. Entrapment in phospholipid vesicles quenches photoactivity of quantum dots

    OpenAIRE

    Generalov R; Kavaliauskiene S; Westrøm S; Chen W; Kristensen S; Juzenas P

    2011-01-01

    Roman Generalov1,2, Simona Kavaliauskiene1, Sara Westrøm1, Wei Chen3, Solveig Kristensen2, Petras Juzenas11Department of Radiation Biology, Institute for Cancer Research, Norwegian Radium Hospital, Oslo University Hospital, Oslo, Norway; 2School of Pharmacy, University of Oslo, Oslo, Norway; 3Department of Physics, The University of Texas at Arlington, Arlington, TX, USAAbstract: Quantum dots have emerged with great promise for biological applications as fluorescent markers for imm...

  13. Chemical and thermal unfolding of a global staphylococcal virulence regulator with a flexible C-terminal end.

    Directory of Open Access Journals (Sweden)

    Avisek Mahapa

    Full Text Available SarA, a Staphylococcus aureus-specific dimeric protein, modulates the expression of numerous proteins including various virulence factors. Interestingly, S. aureus synthesizes multiple SarA paralogs seemingly for optimizing the expression of its virulence factors. To understand the domain structure/flexibility and the folding/unfolding mechanism of the SarA protein family, we have studied a recombinant SarA (designated rSarA using various in vitro probes. Limited proteolysis of rSarA and the subsequent analysis of the resulting protein fragments suggested it to be a single-domain protein with a long, flexible C-terminal end. rSarA was unfolded by different mechanisms in the presence of different chemical and physical denaturants. While urea-induced unfolding of rSarA occurred successively via the formation of a dimeric and a monomeric intermediate, GdnCl-induced unfolding of this protein proceeded through the production of two dimeric intermediates. The surface hydrophobicity and the structures of the intermediates were not identical and also differed significantly from those of native rSarA. Of the intermediates, the GdnCl-generated intermediates not only possessed a molten globule-like structure but also exhibited resistance to dissociation during their unfolding. Compared to the native rSarA, the intermediate that was originated at lower GdnCl concentration carried a compact shape, whereas, other intermediates owned a swelled shape. The chemical-induced unfolding, unlike thermal unfolding of rSarA, was completely reversible in nature.

  14. Information and Communication Technologies to Promote Social and Psychological Well-Being in the Air Force: A 2012 Survey of Airmen

    Science.gov (United States)

    2014-01-01

    on suicide prevention among LGBTQ youth , the Trevor Project operates a 24-hour lifeline for LGBTQ youth who wish to talk with trained counselors. The...Help On-line: Internet Chat Rooms and Suicide ,” Reclaiming Children and Youth , Vol. 13, No. 4, 2005, pp. 229–230. Bessiere, Katherine, Sara Kiesler...Health, Vol. 19, No. 6, 2013, pp. 444–454. Hinduja, Sameer, and Justin W. Patchin, “ Bullying , Cyberbullying, and Suicide ,” Archives of Suicide Research

  15. Potential drug–drug interactions in Alzheimer patients with behavioral symptoms

    OpenAIRE

    2015-01-01

    Giuseppe Pasqualetti, Sara Tognini, Valeria Calsolaro, Antonio Polini, Fabio Monzani Geriatrics Unit, Department of Clinical and Experimental Medicine, University of Pisa, Pisa, Italy Abstract: The use of multi drug regimens among the elderly population has increased tremendously over the last decade although the benefits of medications are always accompanied by potential harm, even when prescribed at recommended doses. The elderly populations are particularly at an increased risk of adverse ...

  16. Alleviating negative effects of irrigation-water salinity on growth and vase life of gerbera by foliar spray of calcium chloride and potassium silicate

    OpenAIRE

    A. Mohammadi Torkashvand

    2015-01-01

    The required water for greenhouses in Kishestan, Soume-e-Sara town, Guilan province, Iran, is mainly provided by underground resources that have inappropriate quality. One way to reduce the impact of salinity an plant growth is proper nutrition. This greenhouse research was conducted to evaluate the effect of water salinity and foliar spray of calcium (Ca) and silicon (Si) on growth and vase life of gerbera in a factorial experiment based on compeletly randomized design with two factors. The ...

  17. Effect of base bitumen composition on asphalt rubber binder properties

    OpenAIRE

    Partl, M.N.; Ould-Henia, M.; Dumont, A.-G.

    2008-01-01

    The asphalt rubber blend properties are strongly related to its base components properties. The base bitumen composition is considered as a key factor influencing the final rheological properties of asphalt rubber binder. This paper describes results from a laboratory investigation of the interaction between crumb rubber and different composition bitumen according to the wet process. The bitumen composition is determined according to the SARA decomposition approac...

  18. Rumen microbial and fermentation characteristics are affected differently by bacterial probiotic supplementation during induced lactic and subacute acidosis in sheep

    Science.gov (United States)

    2012-01-01

    Background Ruminal disbiosis induced by feeding is the cause of ruminal acidosis, a digestive disorder prevalent in high-producing ruminants. Because probiotic microorganisms can modulate the gastrointestinal microbiota, propionibacteria- and lactobacilli-based probiotics were tested for their effectiveness in preventing different forms of acidosis. Results Lactic acidosis, butyric and propionic subacute ruminal acidosis (SARA) were induced by feed chalenges in three groups of four wethers intraruminally dosed with wheat, corn or beet pulp. In each group, wethers were either not supplemented (C) or supplemented with Propionibacterium P63 alone (P) or combined with L. plantarum (Lp + P) or L. rhamnosus (Lr + P). Compared with C, all the probiotics stimulated lactobacilli proliferation, which reached up to 25% of total bacteria during wheat-induced lactic acidosis. This induced a large increase in lactate concentration, which decreased ruminal pH. During the corn-induced butyric SARA, Lp + P decreased Prevotella spp. proportion with a concomitant decrease in microbial amylase activity and total volatile fatty acids concentration, and an increase in xylanase activity and pH. Relative to the beet pulp-induced propionic SARA, P and Lr + P improved ruminal pH without affecting the microbial or fermentation characteristics. Regardless of acidosis type, denaturing gradient gel electrophoresis revealed that probiotic supplementations modified the bacterial community structure. Conclusion This work showed that the effectiveness of the bacterial probiotics tested depended on the acidosis type. Although these probiotics were ineffective in lactic acidosis because of a deeply disturbed rumen microbiota, some of the probiotics tested may be useful to minimize the occurrence of butyric and propionic SARA in sheep. However, their modes of action need to be further investigated. PMID:22812531

  19. A quick and easy-to-use clinical scale to assess balance in Parkinson's disease

    OpenAIRE

    Lieberman A; Dhanani S; Dhall R; Pan D

    2012-01-01

    Abraham Lieberman,1 Sara Dhanani,1 Rohit Dhall,1 Di Pan21Muhammad Ali Parkinson Center (MAPC) of Barrow Neurological Institute, St Joseph's Hospital and Medical Center, Phoenix, AZ, USA; 2Center for Health Information and Research, Arizona State University, Tempe, AZ, USABackground: Balance difficulty is a major contributor to falls in Parkinson's disease (PD). However, the new Movement Disorder Society Unified Parkinson's Disease Rating Scale (MDS-UPDRS) motor examina...

  20. Tselluloidi aura ja kaasaegne kunst / Hanno Soans

    Index Scriptorium Estoniae

    Soans, Hanno, 1974-

    2004-01-01

    Muutustest filmitegemises ja filmiesteetikas. Filmi sarnanemisest tehniliselt üha enam videoga. Kunstnike tegelemisest filmiga. 26. XI näeb kinos "Sõprus" "1+1=1" raames kaasaegsete kunstnike teoseid laiekraanil: Eija-Liisa Ahtila "If 6 was 9" (1995), "Today" (1996-97), "Consolation Service" (1999); Sara Lunden ja Henry Moore Selder (sünd. 1973, Stockholm) "Deadly Boring" (2001), "She is Dead" (2003)

  1. Understanding Formation and Structure of Peptide Nanofibers via Steered MD Simulations

    OpenAIRE

    Engin, Özge; Özgür, Beytullah; Sayar, Mehmet

    2012-01-01

    We suggest that antiparallel b-sheet structure might represent a distinctive sig-nature of amyloid oligomers (Cerf et al, Biochem J, 2009, 421:415-23) under-lying their common pathogenic action. 2236-Pos Board B6 Amyloid Beta Peptide: The Influence of Intrinsic Factors on Fibril Formation Risto Cukalevski1, Birgitta Frohm1, Barry Boland2, Sara Linse1. 1Lund University, Lund, Sweden, 2University College Dublin, Dublin, Ireland. Alzheimer’s disease (AD) is the most co...

  2. A Structured Approach for Reviewing Architecture Documentation

    Science.gov (United States)

    2009-12-01

    existing methods for that already [SARA 2002, Bass 2003, Clements 2002, Dobrica 2002, Babar 2004]. Rather, we are proposing an approach for evaluating the...understand which method to choose and its applicability to a particular situation [ Babar 2004, Dobrica 2002]. There is at least one attempt in the...http://webstore.ansi.org/RecordDetail.aspx?sku=ANSI%2fEIA-748-B (2007). [ Babar 2004] Babar M.A. & Gorton, I. ―Comparison of Scenario-Based Software

  3. MessyBoard: Lowering the Cost of Communication and Making it More Enjoyable

    Science.gov (United States)

    2005-05-02

    Thanks also to Mark Fichman, Bob Kraut and Sara Kiesler for their research advice. Thanks to Desney Tan, Andrew Faulring, Caitlin Kelleher, Dennis...Leduc, Hagström, & Bayley, 2001; JDH Technologies, 2005; Microsoft, 2005a; Moran , McCall, van Melle, Pederson, & Halasz, 1995; Netscape, 2005; RTZ... Moran et al., 1999; Rogers & Brignull, 2002; Russell, 2002; Russell, Trimble, & Wales, 2002). Other systems use smaller displays in key locations, such

  4. The neurocircuitry of illicit psychostimulant addiction: acute and chronic effects in humans

    OpenAIRE

    Taylor SB; Lewis CR; Olive MF

    2013-01-01

    Sara B Taylor,1 Candace R Lewis,1 M Foster Olive1,21Program in Behavioral Neuroscience, 2Interdisciplinary Graduate Program in Neuroscience, Arizona State University, Tempe, AZ, USAAbstract: Illicit psychostimulant addiction remains a significant problem worldwide, despite decades of research into the neural underpinnings and various treatment approaches. The purpose of this review is to provide a succinct overview of the neurocircuitry involved in drug addiction, as well as the acute and chr...

  5. Invasive Plant-Soil Feedbacks and Ecosystem Resistance and Resilience: A Comparison of Three Vegetation Types in California

    OpenAIRE

    Dickens, Sara Jo Myrtle

    2010-01-01

    ABSTRACT OF THE DISSERTATIONInvasive Plant-Soil Feedbacks and Ecosystem Resistance and Resilience: A Comparison of Three Vegetation Types in CaliforniaBy Sara Jo DickensDoctor of Philosophy, Graduate Program in Plant BiologyUniversity of California, Riverside, December 2010Dr Edith B. Allen, ChairpersonEcosystem processes are strongly dependant on plant-soil feedbacks. The invasion of exotic plant species can result in the introduction of novel traits capable of de-coupling native plant-soil ...

  6. Abstracts of Papers Presented at the Annual Meeting of the Society of General Physiologists (40th) Held in Woods Hole, Massachusetts on 4-7 September 1986,

    Science.gov (United States)

    1986-01-01

    Lymphocytes SERGIO GRIN- STEIN, Department of Cell Biology, Hospital for Sick Children, Toronto, Ontario, Canada The relationship between the...Rat Lymphocytes S. JEFFREY DIXON,* SARA COHEN,* EDWARD J. CRAGOE, JR.,* and SERGIO GRINSTEIN, Department of Cell Biology, The Hospital for Sick...LUSTIG,* G. A. WEISMAN,* F. A. GONZALES ,* D.J. GROSS,* and W. W. WEBB, Section of Biochemistry, Molecular and Cell Biology, and the School of Applied and

  7. Proposed Closure of Myrtle Beach AFB, South Carolina

    Science.gov (United States)

    1990-07-01

    people use the range three times per month to practice explosion and safing techniques on C-4 plastique , TNT, detonating cord, time fuses, shape...Strategic Air Command ( SAC ) base in 1947. In the same year, the Air Technical Service Command Storage Area was established at Davis-Monthan AFB for...Recovery Act RI Remedial Investigation SAC Strategic Air Command SARA Superfund Amendments and Reauthorization Act SCDHEC South Carolina Department

  8. Natsionalistlike meeleolude kaardistamine jätkub / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2008-01-01

    "Public Preparation Social Club. Natsionalismi sümptomid ja kriitika kaasaegses kunstis" 11. VII Pärnu Kunstnike Majas ja 12.-16. VII Pärnumaal. Korraldas ja modereeris Rael Artel, ettekannetega esinesid Kendra Ballingall (Winnipeg), Remco de Blaaij (Eindhoven), Övül Durmusoglu (Istanbul/Viin), Ronen Eidelman (Tel Aviv/Weimar), Claire Feeley (Dublin), Erden Kosova (Istanbul), Johannes Paul Raether (Berliin), Sara Stenczer (Budapest/Pariis) ja Tamara Zlobina (Kiiev)

  9. Southeast Asia Report. No. 1325

    Science.gov (United States)

    1983-08-15

    preoccupation with Bandar these days. The history of "modern" Brunei begins with its conversion to Islam by traders from Malacca. The fall of Malacca to the...Datuk Sudin Wahab was given the post of Central Information chief and former Kelantan PAS liaison Secretary Haji Salahuddin Mohamad appointed Exe...interesting, even exciting. Never before in the history of Sara- wak politics has the internal squabbles of a party been brought so out in the open

  10. Fenomorfología y variaciones estacionales de nitrógeno y carbohidratos en seis especies de caméfitos leñosos mediterráneos. Una aproximación funcional. = Pheno-morphology and seasonal dynamics of nitrogen and carbohydrates in six species of Mediterranean sub-shrubs. A functional approach.

    OpenAIRE

    Palacio, Sara

    2014-01-01

    211 páginas. Memoria presentada por Sara Palacio Blasco para optar al grado de Doctor en Biología. Programa de doctorado: “Biología Vegetal” (2001-2003). Trabajo realizado en el Instituto Pirenaico de Ecología (CSIC), bajo la dirección del Dr. Gabriel Montserrat Martí, y presentado en el Departamento de Biología Vegetal de la Universidad de Barcelona. Zaragoza, a 27 de febrero de 2006.

  11. Regulatory Mutations Impacting Antibiotic Susceptibility in an Established Staphylococcus aureus Biofilm.

    Science.gov (United States)

    Atwood, Danielle N; Beenken, Karen E; Lantz, Tamara L; Meeker, Daniel G; Lynn, William B; Mills, Weston B; Spencer, Horace J; Smeltzer, Mark S

    2016-01-11

    We previously determined the extent to which mutations of different Staphylococcus aureus regulatory loci impact biofilm formation as assessed under in vitro conditions. Here we extend these studies to determine the extent to which those regulatory loci that had the greatest effect on biofilm formation also impact antibiotic susceptibility. The experiments were done under in vitro and in vivo conditions using two clinical isolates of S. aureus (LAC and UAMS-1) and two functionally diverse antibiotics (daptomycin and ceftaroline). Mutation of the staphylococcal accessory regulator (sarA) or sigB was found to significantly increase susceptibilities to both antibiotics and in both strains in a manner that could not be explained by changes in the MICs. The impact of a mutation in sarA was comparable to that of a mutation in sigB and greater than the impact observed with any other mutant. These results suggest that therapeutic strategies targeting sarA and/or sigB have the greatest potential to facilitate the ability to overcome the intrinsic antibiotic resistance that defines S. aureus biofilm-associated infections.

  12. A patient's perspective of chronic pain.

    Science.gov (United States)

    Nadler, Sara G

    2017-07-01

    Sara Gilbert Nadler speaks to Jade Parker, Commissioning Editor: Sara has obtained a Bachelor's Degree and Master's in social work. Her field of practice in social work has been in the field of medical social work. Sara has worked in the field of medical social work for over 20 years; her work has spanned from acute care hospitals to skilled nursing facilities. Her professional responsibilities include case management, discharge planning, financial management, counselling patients and their families in regard to their medical conditions as well as making referrals to home care agencies and other care providers if necessary. At present she is a volunteer at Community Health Advocates, New York. She works on the telephone help line, handles health insurance issues along with answering questions in regard to the affordable care act. She also advocates if a client is having issues with their health insurance company in terms of coverage issues. She works with the client and their insurance company and any other agency that needs to advocate on their behalf.

  13. Reliability and discriminant validity of ataxia rating scales in early onset ataxia.

    Science.gov (United States)

    Brandsma, Rick; Lawerman, Tjitske F; Kuiper, Marieke J; Lunsing, Roelineke J; Burger, Huibert; Sival, Deborah A

    2017-04-01

    To determine whether ataxia rating scales are reliable disease biomarkers for early onset ataxia (EOA). In 40 patients clinically identified with EOA (28 males, 12 females; mean age 15y 3mo [range 5-34y]), we determined interobserver and intraobserver agreement (interclass correlation coefficient [ICC]) and discriminant validity of ataxia rating scales (International Cooperative Ataxia Rating Scale [ICARS], Scale for Assessment and Rating of Ataxia [SARA], and Brief Ataxia Rating Scale [BARS]). Three paediatric neurologists independently scored ICARS, SARA and BARS performances recorded on video, and also phenotyped the primary and secondary movement disorder features. When ataxia was the primary movement disorder feature, we assigned patients to the subgroup 'EOA with core ataxia' (n=26). When ataxia concurred with other prevailing movement disorders (such as dystonia, myoclonus, and chorea), we assigned patients to the subgroup 'EOA with comorbid ataxia' (n=12). ICC values were similar in both EOA subgroups of 'core' and 'comorbid' ataxia (0.92-0.99; ICARS, SARA, and BARS). Independent of the phenotype, the severity of the prevailing movement disorder predicted the ataxia rating scale scores (β=0.83-0.88; pataxia rating scales is high. However, the discriminative validity for 'ataxia' is low. For adequate interpretation of ataxia rating scale scores, application in uniform movement disorder phenotypes is essential. © 2016 Mac Keith Press.

  14. Clinical and genetic characteristics of sporadic adult-onset degenerative ataxia.

    Science.gov (United States)

    Giordano, Ilaria; Harmuth, Florian; Jacobi, Heike; Paap, Brigitte; Vielhaber, Stefan; Machts, Judith; Schöls, Ludger; Synofzik, Matthis; Sturm, Marc; Tallaksen, Chantal; Wedding, Iselin M; Boesch, Sylvia; Eigentler, Andreas; van de Warrenburg, Bart; van Gaalen, Judith; Kamm, Christoph; Dudesek, Ales; Kang, Jun-Suk; Timmann, Dagmar; Silvestri, Gabriella; Masciullo, Marcella; Klopstock, Thomas; Neuhofer, Christiane; Ganos, Christos; Filla, Alessandro; Bauer, Peter; Tezenas du Montcel, Sophie; Klockgether, Thomas

    2017-09-05

    To define the clinical phenotype and natural history of sporadic adult-onset degenerative ataxia and to identify putative disease-causing mutations. The primary measure of disease severity was the Scale for the Assessment and Rating of Ataxia (SARA). DNA samples were screened for mutations using a high-coverage ataxia-specific gene panel in combination with next-generation sequencing. The analysis was performed on 249 participants. Among them, 83 met diagnostic criteria of clinically probable multiple system atrophy cerebellar type (MSA-C) at baseline and another 12 during follow-up. Positive MSA-C criteria (4.94 ± 0.74, p 10 years were designated sporadic adult-onset ataxia of unknown etiology/non-MSA (SAOA/non-MSA). Compared with MSA-C, SAOA/non-MSA patients had lower SARA scores (13.6 ± 6.0 vs 16.0 ± 5.8, p = 0.0200) and a slower annual SARA increase (1.1 ± 2.3 vs 3.3 ± 3.2, p = 0.0013). In 11 of 194 tested participants (6%), a definitive or probable genetic diagnosis was made. Our study provides quantitative data on the clinical phenotype and progression of sporadic ataxia with adult onset. Screening for causative mutations with a gene panel approach yielded a genetic diagnosis in 6% of the cohort. NCT02701036. © 2017 American Academy of Neurology.

  15. Voice-Activated Lightweight Reacher to Assist with Upper Extremity Movement Limitations: A Case Study.

    Science.gov (United States)

    Khalid, Umer; Conti, Gerry E; Erlandson, Robert F; Ellis, Richard D; Brown, Vince; Pandya, Abhilash K

    2015-01-01

    The focus of this research was to design a functional and user-friendly reacher for people with spinal cord injuries (SCIs). Engineering advancements have taken assistive robotics to new dimensions. Technologies such as wheelchair robotics and myo-electronically controlled systems have opened up a wide range of new applications to assist people with physical disabilities. Similarly, exo-skeletal limbs and body suits have provided new foundations from which technologies can aid function. Unfortunately, these devices have issues of usability, weight, and discomfort with donning. The Smart Assistive Reacher Arm (SARA) system, developed in this research, is a voice-activated, lightweight, mobile device that can be used when needed. SARA was built to help overcome daily reach challenges faced by individuals with limited arm and hand movement capability, such as people with cervical level 5-6 (C5-6) SCI. This article shows that a functional reacher arm with voice control can be beneficial for this population. Comparison study with healthy participants and an SCI participant shows that, when using SARA, a person with SCI can perform simple reach and grasp tasks independently, without someone else's help. This suggests that the interface is intuitive and can be easily used to a high level of proficiency by a SCI individual.

  16. CAG repeat length does not associate with the rate of cerebellar degeneration in spinocerebellar ataxia type 3

    Directory of Open Access Journals (Sweden)

    Shang-Ran Huang

    2017-01-01

    Full Text Available This cross-sectional study investigated the correlation between the CAG repeat length and the degeneration of cerebellum in spinocerebellar ataxia type 3 (SCA3 patients based on neuroimaging approaches. Forty SCA3 patients were recruited and classified into two subgroups according to their CAG repeat lengths (≥74 and <74. We measured each patient's Scale for the Assessment and Rating of Ataxia (SARA score, N-acetylaspartate (NAA/creatine (Cr ratios based on magnetic resonance spectroscopy (MRS, and 3-dimensional fractal dimension (3D-FD values derived from magnetic resonance imaging (MRI results. Furthermore, the 3D-FD values were used to construct structural covariance networks based on graph theoretical analysis. The results revealed that SCA3 patients with a longer CAG repeat length demonstrated earlier disease onset. However, the CAG repeat length did not significantly correlate with their SARA scores, cerebellar NAA/Cr ratios or cerebellar 3D-FD values. Network dissociation between cerebellar regions and parietal-occipital regions was found in SCA3 patients with CAG ≥ 74, but not in those with CAG < 74. In conclusion, the CAG repeat length is uncorrelated with the change of SARA score, cerebellar function and cerebellar structure in SCA3. Nevertheless, a longer CAG repeat length may indicate early structural covariance network dissociation.

  17. Quantitative analysis of upper-limb ataxia in patients with spinocerebellar degeneration.

    Science.gov (United States)

    Ueda, Naohisa; Hakii, Yasuhito; Koyano, Shigeru; Higashiyama, Yuichi; Joki, Hideto; Baba, Yasuhisa; Suzuki, Yume; Kuroiwa, Yoshiyuki; Tanaka, Fumiaki

    2014-07-01

    Spinocerebellar degeneration (SCD) is a progressive neurodegenerative disorder in which cerebellar ataxia causes motor disability. There are no widely applicable methods for objective evaluation of ataxia in SCD. An objective system to evaluate ataxia is necessary for use in clinical trials of newly developed medication and rehabilitation. The aim of this study was to develop a simple method to quantify the degree of upper-limb ataxia. Forty-nine patients with SCD participated in this study. Patients were instructed to trace an Archimedean spiral template, and the gap between the template spiral and the drawn spiral (gap area; GA) was measured using Image J software. Ataxia was rated using the Scale for the Assessment and Rating of Ataxia (SARA) and cerebellar volume was evaluated in 37 patients using an axial cross-section of magnetic resonance images that were obtained within 6 months of clinical evaluation. Regression analysis was performed to assess the relation between GA and patient age, disease duration, SARA score, and cerebellar volume. GA was significantly related to total SARA score (r = 0.660, p ataxia, especially upper-limb ataxia, and can be widely adopted in various settings, including clinical trials.

  18. Cerebrospinal Fluid Biomarkers in Spinocerebellar Ataxia: A Pilot Study

    Directory of Open Access Journals (Sweden)

    Ashley M. Brouillette

    2015-01-01

    Full Text Available Neurodegenerative diseases, including the spinocerebellar ataxias (SCA, would benefit from the identification of reliable biomarkers that could serve as disease subtype-specific and stage-specific indicators for the development and monitoring of treatments. We analyzed the cerebrospinal fluid (CSF level of tau, α-synuclein, DJ-1, and glial fibrillary acidic protein (GFAP, proteins previously associated with neurodegenerative processes, in patients with the autosomal dominant SCA1, SCA2, and SCA6, and the sporadic disease multiple system atrophy, cerebellar type (MSA-C, compared with age-matched controls. We estimated disease severity using the Scale for the Assessment and Rating of Ataxia (SARA. Most proteins measured trended higher in disease versus control group yet did not reach statistical significance. We found the levels of tau in both SCA2 and MSA-C patients were significantly higher than control. We found that α-synuclein levels were lower with higher SARA scores in SCA1 and tau levels were higher with greater SARA in MSA-C, although this final correlation did not reach statistical significance after post hoc correction. Additional studies with larger sample sizes are needed to improve the power of these studies and validate the use of CSF biomarkers in SCA and MSA-C.

  19. Coenzyme Q10 and spinocerebellar ataxias.

    Science.gov (United States)

    Lo, Raymond Y; Figueroa, Karla P; Pulst, Stefan M; Lin, Chi-Ying; Perlman, Susan; Wilmot, George; Gomez, Christopher; Schmahmann, Jeremy; Paulson, Henry; Shakkottai, Vikram G; Ying, Sarah; Zesiewicz, Theresa; Bushara, Khalaf; Geschwind, Michael; Xia, Guangbin; Subramony, S H; Ashizawa, Tetsuo; Kuo, Sheng-Han

    2015-02-01

    The aim of this study was to investigate the association between drug exposure and disease severity in SCA types 1, 2, 3 and 6. The Clinical Research Consortium for Spinocerebellar Ataxias (CRC-SCA) enrolled 319 participants with SCA1, 2, 3, and 6 from 12 medical centers in the United States and repeatedly measured clinical severity by the Scale for Assessment and Rating of Ataxia (SARA), the Unified Huntington's Disease Rating Scale part IV (UHDRS-IV), and the 9-item Patient Health Questionnaire during July 2009 to May 2012. We employed generalized estimating equations in regression models to study the longitudinal effects of coenzyme Q10 (CoQ10), statin, and vitamin E on clinical severity of ataxia after adjusting for age, sex, and pathological CAG repeat number. Cross-sectionally, exposure to CoQ10 was associated with lower SARA and higher UHDRS-IV scores in SCA1 and 3. No association was found between statins, vitamin E, and clinical outcome. Longitudinally, CoQ10, statins, and vitamin E did not change the rates of clinical deterioration indexed by SARA and UHDRS-IV scores within 2 years. CoQ10 is associated with better clinical outcome in SCA1 and 3. These drug exposures did not appear to influence clinical progression within 2 years. Further studies are warranted to confirm the association.

  20. Development of a biofilm inhibitor molecule against multidrug resistant Staphylococcus aureus associated with gestational urinary tract infections

    Directory of Open Access Journals (Sweden)

    Balamurugan eP

    2015-08-01

    Full Text Available Urinary Tract Infection (UTI is a globally widespread human infection caused by an infestation of uropathogens. Eventhough, Escherichia coli is often quoted as being the chief among them, Staphylococcus aureus involvement in UTI especially in gestational UTI is often understated. Staphylococcal accessory regulator A (SarA is a quorum regulator of S. aureus that controls the expression of various virulence and biofilm phenotypes. Since SarA had been a focussed target for antibiofilm agent development, the study aims to develop a potential drug molecule targeting the SarA of S. aureus to combat biofilm associated infections in which it is involved. In our previous studies, we have reported the antibiofilm activity of SarA based biofilm inhibitor, (SarABI with a 50% minimum biofilm inhibitory concentration (MBIC50 value of 200 µg/mL against S. aureus associated with vascular graft infections and also the antibiofilm activity of the root ethanolic extracts of Melia dubia against uropathogenic E. coli. In the present study, in silico design of a hybrid molecule composed of a molecule screened from M. dubia root ethanolic extracts and a modified SarA based inhibitor (SarABIM was undertaken. SarABIM is a modified form of SarABI where the fluorine groups are absent in SarABIM. Chemical synthesis of the hybrid molecule, 4-(Benzylaminocyclohexyl 2-hydroxycinnamate (henceforth referred to as UTI Quorum-Quencher, UTIQQ was then performed, followed by in vitro and in vivo validation. The MBIC¬50 and MBIC90 of UTIQQ were found to be 15 µg/mL and 65 µg/mL respectively. Confocal laser scanning microscopy (CLSM images witnessed biofilm reduction and bacterial killing in either UTIQQ or in combined use of antibiotic gentamicin and UTIQQ. Similar results were observed with in vivo studies of experimental UTI in rat model. So, we propose that the drug UTIQQ would be a promising candidate when used alone or, in combination with an antibiotic for staphylococcal

  1. Association between proton magnetic resonance spectroscopy measurements and CAG repeat number in patients with spinocerebellar ataxias 2, 3, or 6.

    Directory of Open Access Journals (Sweden)

    Po-Shan Wang

    Full Text Available The aim of this study was to correlate magnetic resonance spectroscopy (MRS measurements, including that for the N-acetyl aspartate (NAA/creatine (Cr ratio in the vermis (denoted V-NAA, right cerebellar hemisphere (R-NAA, and left (L-NAA cerebellar hemisphere, with the clinical scale for the assessment and rating of ataxia (SARA score for patients with spinocerebellar ataxia (SCA types 2, 3, and 6. A total of 24 patients with SCA2, 48 with SCA3, and 16 with SCA6 were recruited; 12 patients with SCA2, 43 with SCA3, and 8 with SCA6 underwent detailed magnetic resonance neuroimaging. Forty-four healthy, age-matched individuals without history of neurologic disease served as control subjects. V-NAA and patient age were used to calculate the predicted age at which a patient with SCA2 or SCA3 would reach an onset V-NAA value. Results showed the following: the NAA/Cr ratio decreased with increasing age in patients with SCA but not in control subjects; the SARA score increased progressively with age and duration of illness; V-NAA showed a better correlation with SARA score than R-NAA in patients with SCA2 or SCA3; the ratio of age to V-NAA correlated well with CAG repeat number; the retrospectively predicted age of onset for SCA2 and SCA3 was consistent with patient-reported age of onset; R-NAA showed a better correlation with SARA score than V-NAA in patients with SCA6; V-NAA and R-NAA correlated with clinical severity (SARA score in patients with SCA. The correlation between CAG repeat number and age could be expressed as a simple linear function, which might explain previous observations claiming that the greater the CAG repeat number, the earlier the onset of illness and the faster the disease progression. These findings support the use of MRS values to predict age of disease onset and to retrospectively evaluate the actual age of disease onset in SCA.

  2. Association between proton magnetic resonance spectroscopy measurements and CAG repeat number in patients with spinocerebellar ataxias 2, 3, or 6.

    Science.gov (United States)

    Wang, Po-Shan; Chen, Hung-Chieh; Wu, Hsiu-Mei; Lirng, Jiing-Feng; Wu, Yu-Te; Soong, Bing-Wen

    2012-01-01

    The aim of this study was to correlate magnetic resonance spectroscopy (MRS) measurements, including that for the N-acetyl aspartate (NAA)/creatine (Cr) ratio in the vermis (denoted V-NAA), right cerebellar hemisphere (R-NAA), and left (L-NAA) cerebellar hemisphere, with the clinical scale for the assessment and rating of ataxia (SARA) score for patients with spinocerebellar ataxia (SCA) types 2, 3, and 6. A total of 24 patients with SCA2, 48 with SCA3, and 16 with SCA6 were recruited; 12 patients with SCA2, 43 with SCA3, and 8 with SCA6 underwent detailed magnetic resonance neuroimaging. Forty-four healthy, age-matched individuals without history of neurologic disease served as control subjects. V-NAA and patient age were used to calculate the predicted age at which a patient with SCA2 or SCA3 would reach an onset V-NAA value. Results showed the following: the NAA/Cr ratio decreased with increasing age in patients with SCA but not in control subjects; the SARA score increased progressively with age and duration of illness; V-NAA showed a better correlation with SARA score than R-NAA in patients with SCA2 or SCA3; the ratio of age to V-NAA correlated well with CAG repeat number; the retrospectively predicted age of onset for SCA2 and SCA3 was consistent with patient-reported age of onset; R-NAA showed a better correlation with SARA score than V-NAA in patients with SCA6; V-NAA and R-NAA correlated with clinical severity (SARA score) in patients with SCA. The correlation between CAG repeat number and age could be expressed as a simple linear function, which might explain previous observations claiming that the greater the CAG repeat number, the earlier the onset of illness and the faster the disease progression. These findings support the use of MRS values to predict age of disease onset and to retrospectively evaluate the actual age of disease onset in SCA.

  3. Progression characteristics of the European Friedreich's Ataxia Consortium for Translational Studies (EFACTS): a 2 year cohort study.

    Science.gov (United States)

    Reetz, Kathrin; Dogan, Imis; Hilgers, Ralf-Dieter; Giunti, Paola; Mariotti, Caterina; Durr, Alexandra; Boesch, Sylvia; Klopstock, Thomas; de Rivera, Francisco Javier Rodriguez; Schöls, Ludger; Klockgether, Thomas; Bürk, Katrin; Rai, Myriam; Pandolfo, Massimo; Schulz, Jörg B

    2016-12-01

    The European Friedreich's Ataxia Consortium for Translational Studies (EFACTS) is a prospective international registry investigating the natural history of Friedreich's ataxia. We used data from EFACTS to assess disease progression and the predictive value of disease-related factors on progression, and estimated sample sizes for interventional randomised clinical trials. We enrolled patients with genetically confirmed Friedreich's ataxia from 11 European study sites in Austria, Belgium, France, Germany, Italy, Spain, and the UK. Patients were seen at three visits-baseline, 1 year, and 2 years. Our primary endpoint was the Scale for the Assessment and Rating of Ataxia (SARA). Secondary outcomes were the Inventory of Non-Ataxia Signs (INAS), the Spinocerebellar Ataxia Functional Index (SCAFI), phonemic verbal fluency (PVF), and the quality of life measures activities of daily living (ADL) and EQ-5D-3L index. We estimated the yearly progression for each outcome with linear mixed-effect modelling. This study is registered with ClinicalTrials.gov, number NCT02069509, and follow-up assessments and recruitment of new patients are ongoing. Between Sept 15, 2010, and Nov 21, 2013, we enrolled 605 patients with Friedreich's ataxia. 546 patients (90%) contributed data with at least one follow-up visit. The progression rate on SARA was 0·77 points per year (SE 0·06) in the overall cohort. Deterioration in SARA was associated with younger age of onset (-0·02 points per year [0·01] per year of age) and lower SARA baseline scores (-0·07 points per year [0·01] per baseline point). Patients with more than 353 GAA repeats on the shorter allele of the FXN locus had a higher SARA progression rate (0·09 points per year [0·02] per additional 100 repeats) than did patients with fewer than 353 repeats. Annual worsening was 0·10 points per year (0·03) for INAS, -0·04 points per year (0·01) for SCAFI, 0·93 points per year (0·06) for ADL, and -0·02 points per year (0·004) for

  4. Astragalus eerqisiensis and A. shadiensis, Two New Species of Leguminosae from Xinjiang, China%中国黄耆属(豆科)丁字毛类群2新种——额尔齐斯黄耆和沙地黄耆

    Institute of Scientific and Technical Information of China (English)

    常朝阳; 徐朗然; DIETER Podlech

    2007-01-01

    Astragalus eerqisiensis Z. Y. Chang, L. R. Xu & D. Podlech and A. shadiensis L. R. Xu, Z. Y.Chang & D. Podlech (Leguminosae) are described and illustrated from Xinjiang,China. Of these,A. eerqisiensis is known only from Burqin County, Xinjiang, and closely related to A. habaheensis, but differs by having rhomboid,obovate or elliptic leaflets which are 15~25(30) mm long, (3) 7~12(15) mm broad,and standard 20~22(25) mm long,wings bilobed at apex. A. shadiensis occurs in Tuokexun County,Xinjiang,and is similar to A. variabilis Bunge ex Maxim.,but differs by its leaves with 5~7(9) leaflets (not 11~19),standard constrict in the middle,and plant very distinctly gray in color. Both species are endemic to China,with A. eerqisiensis belonging to Sect. Helmia Bunge, and A. shadiensis to Sect. Craccina (Stev.)Bunge.%描述了产于中国新疆的黄耆属(Astragalus)丁字毛类群2新种,即额尔齐斯黄耆(Astragalus eerqisiensis Z.Y.Chang,L. R. Xu & D.Podlech)和沙地黄耆(A.shadiensis L. R. Xu,Z.Y.Chang & D.Podlech).其中,额尔齐斯黄耆仅见于新疆布尔津县的额尔齐斯河流域,与哈巴河黄耆(A.habaheensis)近缘,区别在于前者小叶菱形、倒卵形或椭圆形,长15~25(30)mm,宽(3)7~12(15)mm,旗瓣长20~22(25)mm,翼瓣顶端2裂;沙地黄耆产于新疆托克逊县东北部,散生于沙地荒漠,形态上与变异黄耆(A. variabilis Bunge ex Maxim.)接近,区别在于小叶5~7(9)枚而非11~19枚,旗瓣在中部收缩,植株全体被灰色毛而呈灰色.2新种均系中国特有种,其中额尔齐斯黄耆隶属于乌拉尔组(A. Sect.Helmia Bunge),沙地黄耆隶属于旱生组[A. Sect.Craccina(Stev.)Bunge].

  5. Alfalfa pellet-induced subacute ruminal acidosis in dairy cows increases bacterial endotoxin in the rumen without causing inflammation.

    Science.gov (United States)

    Khafipour, E; Krause, D O; Plaizier, J C

    2009-04-01

    A study was conducted to determine if subacute ruminal acidosis (SARA) induced by feeding alfalfa pellets results in increases in free bacterial lipopolysaccharide (LPS) in rumen fluid and peripheral blood, and acute phase proteins in plasma, and to determine the effect of alfalfa pellet-induced SARA on feed intake, rumen fermentation characteristics, milk production and composition, and blood metabolites. Eight lactating Holstein cows, 4 of which were ruminally cannulated, were used in a 6-wk experiment and were fed once daily at 0900 h. During wk 1, cows received a diet containing 50% of DM as concentrate and 50% of DM chopped alfalfa hay. Between wk 2 and wk 6, alfalfa hay was gradually replaced with alfalfa pellets at the rate of 8% per week to reduce rumen pH. Rumen pH was monitored continuously in the ruminally cannulated cows using indwelling pH probes. Rumen fluid and peripheral blood were sampled 15 min before feed delivery and at 6 h after feed delivery. Based on adopted threshold of SARA of at least 180 min/d below pH 5.6, SARA was induced from wk 3 onwards. Replacing 40% of alfalfa hay with alfalfa pellets quadratically increased the DMI from 18.1 kg/d in wk 1 to 23.4 kg/d in wk 6. This replacement linearly decreased milk yield (32.7 vs. 35.9 kg/d) and milk fat percentage and yield (2.32 vs. 3.22%, and 0.77 vs. 1.14 kg/d, respectively), but increased milk protein percentage and yield (3.80 vs. 3.04%, and 1.23 vs. 1.07 kg/d, respectively). This gradual replacement also linearly increased the daily averages of total volatile fatty acids (90 to 121.9 mM), acetate (53.9 to 66.8 mM), propionate (21.5 to 39.6 mM), and osmolality (277.7 to 293.8 mmol/kg) in the rumen and decreased the acetate to propionate ratio from 2.62 to 1.73. Replacing alfalfa hay with alfalfa pellets linearly increased blood lactate from 1.00 mM in wk 1 to a peak of 3.46 mM in wk 5. Induction of SARA in this study increased free rumen LPS concentration from 42,122 endotoxin unit (EU

  6. A grain-based subacute ruminal acidosis challenge causes translocation of lipopolysaccharide and triggers inflammation.

    Science.gov (United States)

    Khafipour, E; Krause, D O; Plaizier, J C

    2009-03-01

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on translocation of lipopolysaccharide (LPS) into the peripheral circulation, acute phase proteins in blood and milk, feed intake, milk production and composition, and blood metabolites were determined in 8 lactating Holstein cows. Between wk 1 and 5 of 2 successive 6-wk periods, cows received a total mixed ration ad libitum with a forage to concentrate (F:C) ratio of 50:50. In wk 6 of both periods, the SARA challenge was conducted by replacing 21% of the dry matter of the total mixed ration with pellets containing 50% wheat and 50% barley. Rumen pH was monitored continuously using indwelling pH probes in 4 rumen cannulated cows. Rumen fluid samples were collected 15 min before feed delivery and at 2, 4, 6, 12, 14, 16, 18, and 24 h after feed delivery for 2 d during wk 5 (control) and wk 6 (SARA). Peripheral blood samples were collected using jugular catheters 15 min before feeding and at 6 and 12 h after feeding at the same days of the rumen fluid collections. The SARA challenge significantly reduced average daily pH from 6.17 to 5.97 and increased the duration of rumen pH below pH 5.6 from 118 to 279 min/d. The challenge reduced dry matter intake (16.5 vs. 19 kg/d), milk yield (28.3 vs. 31.6 kg/d), and milk fat (2.93 vs. 3.30%, 0.85 vs. 0.97 kg/d), and tended to increase milk protein percentage (3.42 vs. 3.29%), without affecting milk protein yield (1.00 vs. 0.98 kg/d). The challenge also increased the concentration of free LPS in rumen fluid from 28,184 to 107,152 endotoxin units (EU)/mL. This was accompanied by an increase in LPS in peripheral blood plasma (0.52 vs. <0.05 EU/mL) with a peak at 12 h after feeding (0.81 EU/mL). Concentrations of the acute phase proteins serum amyloid A, haptoglobin, and LPS-binding protein (LBP) in peripheral blood as well as LBP concentration in milk increased (438.5 vs. 167.4, 475.6 vs. 0, 53.1 vs. 18.2, and 6.94 vs. 3.02 microg/mL, respectively) during

  7. Active dry Saccharomyces cerevisiae can alleviate the effect of subacute ruminal acidosis in lactating dairy cows.

    Science.gov (United States)

    AlZahal, O; Dionissopoulos, L; Laarman, A H; Walker, N; McBride, B W

    2014-12-01

    The objective of the study was to determine the effect of active dry Saccharomyces cerevisiae (ADSC) supplementation on dry matter intake, milk yield, milk components, ruminal pH, and microbial community during a dietary regimen that leads to subacute ruminal acidosis (SARA). Sixteen multiparous, rumen-cannulated lactating Holstein cows were randomly assigned to 1 of 2 dietary treatments that included ADSC (Biomate; AB Vista, Marlborough, UK; 8 × 10(10) cfu/head per day) or control. During wk 1 to 6, all cows received a high-forage (HF) diet (77:23, forage:concentrate). Cows were then abruptly switched during wk 7 to a high-grain (HG) diet (49:51, forage:concentrate) and remained on the HG until the end of wk 10. Feed intake and milk yields were recorded daily. Ruminal pH was recorded continuously using an indwelling system for 1 to 2 d per week during the pre-experimental phase, and wk 6, 7, and 10. Ruminal digesta samples were collected at the end of the experiment and analyzed for relative change in microbial communities using real-time quantitative PCR. Cows were considered to have SARA if the duration below pH 5.6 was ≥300 min/d. Ruminal pH during wk 6 (HF plateau) was not different across treatments (15 ± 46 min/d at pH inflammation within the rumen. Cows supplemented with ADSC had a 2.3-fold increase in Streptococcus bovis and a 12-fold reduction in Megasphaera elsdenii. The reduction in M. elsdenii may reflect lower concentration of lactic acid within the rumen for ADSC cows. In conclusion, ADSC supplementation to dairy cows was demonstrated to alleviate the condition of SARA caused by abrupt dietary changes from HF to HG, and can potentially improve rumen function, as indicated by greater numbers of cellulolytic microorganisms within the rumen.

  8. Trends in extinction risk for imperiled species in Canada.

    Directory of Open Access Journals (Sweden)

    Brett Favaro

    Full Text Available Protecting and promoting recovery of species at risk of extinction is a critical component of biodiversity conservation. In Canada, the Committee on the Status of Endangered Wildlife in Canada (COSEWIC determines whether species are at risk of extinction or extirpation, and has conducted these assessments since 1977. We examined trends in COSEWIC assessments to identify whether at-risk species that have been assessed more than once tended to improve, remain constant, or deteriorate in status, as a way of assessing the effectiveness of biodiversity conservation in Canada. Of 369 species that met our criteria for examination, 115 deteriorated, 202 remained unchanged, and 52 improved in status. Only 20 species (5.4% improved to the point where they were 'not at risk', and five of those were due to increased sampling efforts rather than an increase in population size. Species outcomes were also dependent on the severity of their initial assessment; for example, 47% of species that were initially listed as special concern deteriorated between assessments. After receiving an at-risk assessment by COSEWIC, a species is considered for listing under the federal Species at Risk Act (SARA, which is the primary national tool that mandates protection for at-risk species. We examined whether SARA-listing was associated with improved COSEWIC assessment outcomes relative to unlisted species. Of 305 species that had multiple assessments and were SARA-listed, 221 were listed at a level that required identification and protection of critical habitat; however, critical habitat was fully identified for only 56 of these species. We suggest that the Canadian government should formally identify and protect critical habitat, as is required by existing legislation. In addition, our finding that at-risk species in Canada rarely recover leads us to recommend that every effort be made to actively prevent species from becoming at-risk in the first place.

  9. Environmental management

    Energy Technology Data Exchange (ETDEWEB)

    Simpson, R.

    2001-04-01

    The Alberta Chamber of Resources (ACR) believes that resource development and environmental management should be achieved through consultation and cooperation processes. The ACR, through the Land and Resource Partnership (LRP) regarding the Species at Risk Act (SARA), is involved in the consultation process with the Federal government. The aim is to achieve consensus and equilibrium between the interests of environmental organizations and industry while protecting species at risk. One of the important issues examined concerns regulatory takings (restrictions on the use of land) and compensation for the loss of use of land, which has no precedent in Canada. At the request of the government, Dr. Pearse, a scientist specializing in economics and forestry at the University of British Columbia (UBC), conducted a study on the topic and submitted a report to the government. Representatives of the ACR had met with Dr. Pearse to make their views known. The ACR disagrees with a proposal included in the report, which states that above a 10 per cent threshold of loss of value of land, 50 per cent of the remaining loss should be compensated by the government, instead of full government compensation advocated by the ACR. In the case of private rights on crown land, Dr. Pearse recommended that no compensation be offered to the energy industry for incremental costs resulting from restrictions. In the SARA legislation, the government favors a collaborative approach with all parties affected, thereby eliminating the requirement for compensation. The Civil Cause of Action was removed from SARA. The legislation still includes strict liability offences, which are considered troublesome by the ACR in the case of accidental disturbance of a protected species. The ACR believes that the resource industries are responsible and perform their activities in a way which protects species at risk. Management through consultation and cooperation will accomplish the goals. Environmental concerns

  10. Spinocerebellar ataxia type 3/Machado-Joseph disease starting before adolescence.

    Science.gov (United States)

    Donis, Karina Carvalho; Saute, Jonas Alex Morales; Krum-Santos, Ana Carolina; Furtado, Gabriel Vasata; Mattos, Eduardo Preusser; Saraiva-Pereira, Maria Luiza; Torman, Vanessa Leotti; Jardim, Laura Bannach

    2016-04-01

    Onset of Machado-Joseph disease (SCA3/MJD) before adolescence has been rarely reported. This study aims to describe a cohort of SCA3/MJD with onset before 12 years of age, comparing their disease progression with the progression observed in patients with usual disease onset. We identified all cases from our cohort whose onset was before adolescence. After consent, patients were examined with clinical scales Scale for the Assessment and Rating of Ataxia (SARA) and Neurological Examination Score for Spinocerebellar Ataxia (NESSCA). Gender, age, age at onset, disease duration, CAG expanded repeats, transmitting parent, and anticipation of cases with infantile and adult onset were studied. Progression of NESSCA and SARA scores was estimated through a mixed model, and was compared with a historical group with onset after adolescence. Between 2000 and 2014, 461 symptomatic individuals from our region were diagnosed as SCA3/MJD. Onset of eight cases (2.2%), all heterozygotes, was before adolescence: seven were females (p = 0.054). CAG expanded repeats--75 ± 3 versus 84 ± 4--and anticipations--7 ± 9.7 versus 14.4 ± 7.2 years--were different between early childhood and adult onset groups (p < 0.03). The median survival of early childhood onset group was 23 years of age. The annual progression of SARA--2.3 and 0.6 points/year (p = 0.001)--and NESSCA--2.04 and 0.88 points/year (p = 0.043)--was faster in childhood than in adult onset group. Onset of SCA3/MJD before adolescence was related to larger expanded CAG repeats in heterozygosis; females seemed to be at higher risk. Disease progression was faster than in SCA3/MJD starting after 12 years.

  11. The Off-Site Rule. CERCLA Information Brief

    Energy Technology Data Exchange (ETDEWEB)

    Whitehead, B.

    1994-03-01

    Under Section 121(d)(3) of the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), as amended by the Superfund Amendments and Reauthorization Act (SARA) of 1986, wastes generated as a result of CERCLA remediation activities and transferred off-site must be managed at a facility operating in compliance with federal laws. EPA issued its Off-Site Policy (OSWER Directive No. 9834, 11), which gave guidance on complying with this particular requirement. Specifically, EPA requires off-site waste management facilities to fulfill EPA`s definition of acceptability and has established detailed procedures for issuing and reviewing unacceptability determinations. EPA proposed amending the National Contingency Plan (NCP) (40 CFR part 300) to include the requirements contained in the Off-Site Policy (53 FR 48218). On September 22, 1993 EPA published the Off-Site Rules [58 FR 49200], which became effective on October 22, 1993. The primary purpose of the Off-Site Rule is to clarify and codify CERCLA`s requirement to prevent wastes generated from remediation activities conducted under CERCLA from contributing to present or future environmental problems at off-site waste management facilities that receive them. Thus, the Off-Site Rule requires that CERCLA wastes only be sent to off-site facilities that meet EPA`s acceptability criteria. The final Off-Site Rule makes two major changes to the proposed Off-Site Rule: (1) only EPA, not an authorized State, can make determinations of the acceptability of off-site facilities that manage CERCLA wastes, and (2) the Off-Site eliminate the distinction between CERCLA wastes governed under pre-SARA and post-SARA agreements. The purpose of this information Brief is to highlight and clarify EPA`s final Off-Site and its implications on DOE remedial actions under CERCLA.

  12. Nerve Growth Factor for the Treatment of Spinocerebellar Ataxia Type 3: An Open-label Study

    Institute of Scientific and Technical Information of China (English)

    Song Tan; Rui-Hao Wang; Hui-Xia Niu; Chang-He Shi; Cheng-Yuan Mao; Rui Zhang; Bo Song

    2015-01-01

    Background:Spinocerebellar ataxia type 3 (SCA3) is the most common subtype of SCA worldwide,and runs a slowly progressive and unremitting disease course.There is currently no curable treatment available.Growing evidence has suggested that nerve growth factor (NGF) may have therapeutic effects in neurodegenerative diseases,and possibly also in SCA3.The objective of this study was to test the efficacy of NGF in SCA3 patients.Methods:We performed an open-label prospective study in genetically confirmed adult (>18 years old) SCA3 patients.NGF was administered by intramuscular injection (18 μg once daily) for 28 days consecutively.All the patients were evaluated at baseline and 2 and 4 weeks after treatment using the Chinese version of the scale for assessment and rating of ataxia (SARA).Results:Twenty-one SCA3 patients (10 men and 11 women,mean age 39.14 ± 7.81 years,mean disease duration 4.14 ± 1.90 years,mean CAG repeats number 77.57 ± 2.27) were enrolled.After 28 days of NGF treatment,the mean total SARA score decreased significantly from a baseline of 8.48 ± 2.40 to 6.30 ± 1.87 (P < 0.001).Subsections SARA scores also showed significant improvements in stance (P =0.003),speech (P =0.023),finger chase (P =0.015),fast alternating hand movements (P =0.009),and heel-shin slide (P =0.001).Conclusions:Our preliminary data suggest that NGF may be effective in treating patients with SCA3.

  13. Spinocerebellar ataxia types 1, 2, 3 and 6: the clinical spectrum of ataxia and morphometric brainstem and cerebellar findings.

    Science.gov (United States)

    Jacobi, Heike; Hauser, Till-Karsten; Giunti, Paola; Globas, Christoph; Bauer, Peter; Schmitz-Hübsch, Tanja; Baliko, László; Filla, Alessandro; Mariotti, Caterina; Rakowicz, Maria; Charles, Perine; Ribai, Pascale; Szymanski, Sandra; Infante, Jon; van de Warrenburg, Bart P C; Dürr, Alexandra; Timmann, Dagmar; Boesch, Sylvia; Fancellu, Roberto; Rola, Rafal; Depondt, Chantal; Schöls, Ludger; Zdzienicka, Elzbieta; Kang, Jun-Suk; Ratzka, Susanne; Kremer, Berry; Stephenson, Dennis A; Melegh, Béla; Pandolfo, Massimo; Tezenas du Montcel, Sophie; Borkert, Johannes; Schulz, Jörg B; Klockgether, Thomas

    2012-03-01

    To assess the clinical spectrum of ataxia and cerebellar oculomotor deficits in the most common spinocerebellar ataxias (SCAs), we analysed the baseline data of the EUROSCA natural history study, a multicentric cohort study of 526 patients with either spinocerebellar ataxia type 1, 2, 3 or 6. To quantify ataxia symptoms, we used the Scale for the Assessment and Rating of Ataxia (SARA). The presence of cerebellar oculomotor signs was assessed using the Inventory of Non-Ataxia Symptoms (INAS). In a subgroup of patients, in which magnetic resonance images (MRIs) were available, we correlated MRI morphometric measures with clinical signs on an exploratory basis. The SARA subscores posture and gait (items 1-3), speech (item 4) and the limb kinetic subscore (items 5-8) did not differ between the genotypes. The scores of SARA item 3 (sitting), 5 (finger chase) and 6 (nose-finger test) differed between the subtypes whereas the scores of the remaining items were not different. In SCA1, ataxia symptoms were correlated with brainstem atrophy and in SCA3 with both brainstem and cerebellar atrophy. Cerebellar oculomotor deficits were most frequent in SCA6 followed by SCA3, whereas these abnormalities were less frequent in SCA1 and SCA2. Our data suggest that vestibulocerebellar, spinocerebellar and pontocerebellar circuits in SCA1, SCA2, SCA3 and SCA6 are functionally impaired to almost the same degree, but at different anatomical levels. The seemingly low prevalence of cerebellar oculomotor deficits in SCA1 and SCA2 is most probably related to the defective saccadic system in these disorders.

  14. A Surfactant-Induced Functional Modulation of a Global Virulence Regulator from Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Sukhendu Mandal

    Full Text Available Triton X-100 (TX-100, a useful non-ionic surfactant, reduced the methicillin resistance in Staphylococcus aureus significantly. Many S. aureus proteins were expressed in the presence of TX-100. SarA, one of the TX-100-induced proteins, acts as a global virulence regulator in S. aureus. To understand the effects of TX-100 on the structure, and function of SarA, a recombinant S. aureus SarA (rSarA and its derivative (C9W have been investigated in the presence of varying concentrations of this surfactant using various probes. Our data have revealed that both rSarA and C9W bind to the cognate DNA with nearly similar affinity in the absence of TX-100. Interestingly, their DNA binding activities have been significantly increased in the presence of pre-micellar concentration of TX-100. The increase of TX-100 concentrations to micellar or post-micellar concentration did not greatly enhance their activities further. TX-100 molecules have altered the secondary and tertiary structures of both proteins to some extents. Size of the rSarA-TX-100 complex appears to be intermediate to those of rSarA and TX-100. Additional analyses show a relatively moderate interaction between C9W and TX-100. Binding of TX-100 to C9W has, however, occurred by a cooperative pathway particularly at micellar and higher concentrations of this surfactant. Taken together, TX-100-induced structural alteration of rSarA and C9W might be responsible for their increased DNA binding activity. As TX-100 has stabilized the somewhat weaker SarA-DNA complex effectively, it could be used to study its structure in the future.

  15. “I hvert fald ikke i Denmark”

    DEFF Research Database (Denmark)

    Frederiksen, Maja Mons Bissenbakker

    2012-01-01

    This article investigates how the affect shame orients the national subject and the nation towards one another in Danish debates on asylum politics. Taking its starting point in Silvan Tomkin’s studies of shame as well as in Sara Ahmed’s writing on the relation between emotion and the nation......, the article analyses the way in which shame creates a continuum between the nation and the national subject in asylum discourses – negative as well as positive. Specifically it is shown how shame functions as a temporal indicator that sustains narratives that idealise the nation. Reading Eve K. Sedgwick...

  16. A Modernist Approach to T.S Eliot’s The Love Song of J. Alfred Prufrock

    OpenAIRE

    Samet Güven

    2015-01-01

    A Modernist Approach to T.S Eliot’s “The Love Song of J. Alfred Prufrock" Abstract  T.S. Eliot’s The Love Song of J. Alfred Prufrock carries the characteristics of modernist poetry such as objective correlative, fragmentation, free verse and irregular rhyming. It suggests a direct break with English romantic poets such as Coleridge and Wordsworth (Levis 75). Sara Thorne states that unlike the Romantic poets, Eliot attempts to convey the essence of life; and the content represents actu...

  17. Reviews of recent publications

    Directory of Open Access Journals (Sweden)

    1994-06-01

    Full Text Available Bjornson, Richard. The African Quest for Freedom and Identity: Cameroonian Writing and the National Experience by Thomas A. Hale Cixous, Hélène. 'Coming to Wrting' and Other Essays by Randi Brox Birn Derwin, Susan. The Ambivalence of Form: Lukacs, Freud, and the Novel by Eva L. Corredor Kaminsky, Amy K. Reading the Body Politic: Feminist Criticism and Latin American Women Writers by Naomi Lindstrom Nägele, Rainer. Theater, Theory, Speculation: Walter Benjamin and the Scenes of Modernity by Alice A. Kuzniar Tomlinson, John. Cultural Imperialism by Michael Filcher Weisberg, Richard. Poethics and Other Strategies of Law and Literature by Sara B. Blair

  18. El Sistema inspirerede projekter

    DEFF Research Database (Denmark)

    Holst, Finn; Chemi, Tatiana

    Rapporten er resultat af pilotprojektet ”Forundersøgelse El Sistema DK” gennemført af Ph.D. Finn Holst (DPU, Aarhus Universitet) og Ph.D. Tatiana Chemi (Aalborg Universitet) i 2015. I rapporten indgår desuden bidrag fra Sofie Holm, Sara Fink Søndergaard og Stine Møgelbjerg Johansen. Pilotprojektet...... er gennemført for DMKLs El Sistema-udvalg med støtte fra Statens Kunstfond, Projektstøtteudvalget for Musik....

  19. Der er en særlig plads i Helvede for dovne børn

    DEFF Research Database (Denmark)

    Eriksen, Camilla Bruun

    2015-01-01

    in the process. Inspired also by Sara Ahmed and her claim that emotions are cultural practices that hold affective power and organize our modes of life, this article is interested in the ways the ‘healthy’ body is understood as tied to life and therefore gets to count as life. The article concludes that health......This article takes a closer look at the educational computer game Life Calculator (2010) and its attempts to inform young people about health risks and it argues that the game becomes a biopolitical and disciplinary tool. Drawing on the work of Foucault, the article claims that specific bodies...

  20. Nova Talenta: 2014-2015

    OpenAIRE

    Aguilera Velandia, Mónica Natalia; Álvarez Rodríguez, María Isabel; Báez Millán, Christian Danilo; Cuestas Díaz, Andrea Patricia; Escobar Campos, Lina Marcela; Galindo Londoño, Ana María; García Sierra, María Camila; García, Lina María; Jaramillo Barrios, María Paola; Mesa Torres, Karen Eliana; Mora Barrero, Daniel; Morales Morales, Ángela Beatriz; Moreno, Ana María; Naranjo Pinilla, Juan Sebastian; Ochoa Rodríguez, Ángela Marcela

    2015-01-01

    Contenido Introducción 1. Inteligencia emocional, liderazgo transformacional y género: factores que influencian el desempeño organizacional / Ana María Galindo Londoño, Sara Urrego Mayorga; Director: Juan Carlos Espinosa Méndez. 2. El rol de la mujer en el liderazgo / Andrea Patricia Cuestas Díaz; Directora: Francoise Venezia Contreras Torres. 3. Liderazgo transformacional, clima organizacional, satisfacción laboral y desempeño. Una revisión de la literatura / Juliana Restrepo O...