WorldWideScience

Sample records for sara gowan student

  1. 2012 SARA Students Technical Report

    International Nuclear Information System (INIS)

    Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet

    2012-01-01

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of

  2. 2012 SARA Students Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

    2012-07-30

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the

  3. The SARA REU Site Program

    Science.gov (United States)

    Wood, M. A.; Oswalt, T. D.; SARA Collaboration

    2000-12-01

    We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.

  4. News developments at Sara

    International Nuclear Information System (INIS)

    Belmont, J.L.; Fruneau, M.; Martin, P.

    1989-05-01

    SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration

  5. Sara

    International Nuclear Information System (INIS)

    Aparo, M.; Dionisi, M.; Vicini, C.; Zeppa, P.; Frazzoli, F.V.; Remetti, R.; Portale, C.

    1989-01-01

    Nuclear Material Accountability, supported by Containment and Surveillance measures, is a foundamental means for an effective International Safeguard implemention in nuclear plants. Accountability is based on the verification that difference between a material quantity entering a given material balance and the quantity leaving that area in a given period of time, correspond and the amount of material actually present at the moment of the inspection. In the recent years International Safeguards appealing to the needs of timeliness in detecting diversion and concealing activities, devoted ReD efforts on a new Dynamic Accountability procedures (NRTMA) with particular concern with reprocessing plants. The present paper, which is the result of a research activity carried out in the frame of the Italian Support Programme to IAEA for Safeguards implementation, deals with a feasibility study of a NRTMA system to be applied to the EUREX pilot reprocessing plant. Such a feasibility study was performed by developing a computer program based on simulated plant generated data

  6. Severe Accident Recriticality Analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  7. Severe accident recriticality analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H

    2001-11-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated

  8. Severe accident recriticality analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.

    2001-01-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady

  9. Severe Accident Recriticality Analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  10. Interpreting the SARA and RCRA training requirements

    International Nuclear Information System (INIS)

    Moreland, W.M.; Wells, S.M.

    1987-01-01

    The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements

  11. System Analysis and Risk Assessment (SARA) system

    International Nuclear Information System (INIS)

    Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

    1986-01-01

    Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable

  12. The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

    Science.gov (United States)

    Wood, M. A.

    2003-12-01

    The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.

  13. The relationship between SARA fractions and crude oil stability

    Directory of Open Access Journals (Sweden)

    Siavash Ashoori

    2017-03-01

    Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.

  14. Layering of life (Sara novel of Peter Sarić

    Directory of Open Access Journals (Sweden)

    Kostić Dragomir J.

    2015-01-01

    Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safe­guard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.

  15. Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.

    Science.gov (United States)

    O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J

    2008-04-01

    Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.

  16. Gene : CBRC-SARA-01-1996 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

  17. SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS

    International Nuclear Information System (INIS)

    Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.

    2015-01-01

    SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index

  18. Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

    Directory of Open Access Journals (Sweden)

    M. Sidi Ritau'din

    2017-06-01

    Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.

  19. Layering of life (Sara novel of Peter Sarić)

    OpenAIRE

    Kostić, Dragomir J.

    2015-01-01

    Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...

  20. A simple blowdown code for SUPER-SARA loop conditions

    International Nuclear Information System (INIS)

    Fritz, G.

    1981-01-01

    The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section

  1. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...

  2. A Critical Appraisal of Peter Gowan’s “Contemporary Intra-Core Relations and World-Systems Theory”: A Capitalist World-Empire or U.S.-East Asian Geo-Economic Integration?

    Directory of Open Access Journals (Sweden)

    John Gulick

    2015-08-01

    Full Text Available This paper evaluates Peter Gowan’s musings on the topic of a U.S.-centered “capitalist world-empire.” Gowan’s heterodox concept of a “capitalist world-empire” is intellectually defensible. And his claim that U.S. hegemony is historically unique, because unlike previous dominant powers the U.S. has been able to distinctly mold the accumulation regimes and security environments of its would-be rivals in the core, is more than convincing. However, Gowan tends to overstate the degree to which the U.S. in the 1990’s enjoyed a productive sector revival, rather than a mere super-inflation of dollar-denominated assets. This tendency prevents him from anticipating just how summarily the U.S. would ditch consensual approaches to managing the capitalistworld-economy once the Wall Street bubble collapsed, and hence from appreciating just how fed up Western European and East Asian elites would become with the predatory character of U.S. hegemony in decay. In conclusion the paper argues that while the U.S. may have neither the resources nor the credibility to politically control the global division of labor, something akin to a U.S.-East Asian geo-economic bloc may be in the process of forming. This is so because the Chinese and Japanese economic growth models remain wedded to the underwriting of the U.S.’ seigniorage privileges', and because past and present frictions between China and Japan stand in the way of tighter Sino-Japanese political coordination.

  3. Sara, a patient with borderline personality structure: A "crisis" management

    Directory of Open Access Journals (Sweden)

    Paola Marinelli

    2015-05-01

    Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma. 

  4. Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

    Directory of Open Access Journals (Sweden)

    Jessica N Snowden

    Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.

  5. System Analysis and Risk Assessment system (SARA) Version 4.0

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1992-01-01

    This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis

  6. The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...

  7. Calculations for the design and modification of the 2 cyclotrons of S.A.R.A

    International Nuclear Information System (INIS)

    Albrand, P.S.; Belmont, J.L.; Ripouteau, F.

    1983-09-01

    S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron

  8. Social humanoid robot SARA: development of the wrist mechanism

    Science.gov (United States)

    Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.

    2018-01-01

    This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.

  9. Mengukur Politisasi Agama dalam Ruang Publik: Komunikasi SARA dalam Perdebatan Rational Choice Theory

    Directory of Open Access Journals (Sweden)

    Mohammad Supriyadi

    2015-12-01

    Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.

  10. Concurrent software system design supported by SARA at the age of one

    Energy Technology Data Exchange (ETDEWEB)

    Campos, I.M.; Estrin, G.

    A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.

  11. ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

    Directory of Open Access Journals (Sweden)

    Sulistyastuti Sutomo

    2015-01-01

    Full Text Available Not only does art   have   self-fullfillment, but  it also has axiological  benefits both socially, culturally, religiously, and economiclally.  So does Sara Douda dance.  Sara Douda aesthetics  is first contained  in its whole dance movements. In addition, it  can also be found in the whole dance equipments.  Moreover,  this dance aesthetics  may  also be contained in the verbal symbols in the speech forms  prior to the dance performance. However,  both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and  religious values in the Loli community about  their honoring their ancestors,  having social harmony, and  highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance.   Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...

  18. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    Science.gov (United States)

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...

  6. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  15. Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural

    Directory of Open Access Journals (Sweden)

    Tiara Kharisma

    2017-12-01

    Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

  19. Transferring generic SARA/OSHA training to US Department of Energy facilities

    International Nuclear Information System (INIS)

    White, A.; McKinley, T.

    1989-01-01

    The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs

  20. SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

    DEFF Research Database (Denmark)

    Martin, Christer; Heinze, C.; Busch, M.

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...

  4. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    OpenAIRE

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...

  6. Identification of Differentially Expressed Proteins in Liver in Response to Subacute Ruminal Acidosis (SARA Induced by High-concentrate Diet

    Directory of Open Access Journals (Sweden)

    X. Y. Jiang

    2014-08-01

    Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.

  7. SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-05-01

    Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.

  8. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    Science.gov (United States)

    Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

    2017-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.

  9. System Analysis and Risk Assessment System (SARA), Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.

    1992-02-01

    This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs

  10. Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

    2009-07-01

    Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench

  11. Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

    Science.gov (United States)

    Thomas, S. M.; Su, Y. C.; Hummel, P. R.

    2016-12-01

    Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance

  12. Development of an ion guide coupled to an on-line isotope separation system on Sara. Identification and study of isospin exotic nuclei at Isolde and Sara

    International Nuclear Information System (INIS)

    Bouldjedri, A.

    1992-06-01

    This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements

  13. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  14. Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.

    1995-01-01

    Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...

  16. Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010

    OpenAIRE

    Beaulé, Sophie

    2014-01-01

    With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w

  18. Lepidoptera, Nymphalidae, Heliconiinae, Heliconius sara apseudes (Hübner, 1813: Distribution extension

    Directory of Open Access Journals (Sweden)

    Iserhard, C. A.

    2010-01-01

    Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.

  19. PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

    Directory of Open Access Journals (Sweden)

    Jorge A. Orrego-Ruiz

    2014-06-01

    Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.

  20. Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.

    Science.gov (United States)

    Zhao, Bryan M; Hoffmann, F Michael

    2006-09-01

    Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.

  1. Sara John: Ethnisierte Arbeit. Eine feministische Perspektive. Marburg: Tectum Wissenschaftsverlag 2009.

    Directory of Open Access Journals (Sweden)

    Grit Grigoleit

    2011-03-01

    Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.

  2. A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

    Science.gov (United States)

    Worthen, Helena Harlow

    2012-01-01

    The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…

  3. Hemolytic disease of the fetus and newborn caused by an antibody to a low-prevalence antigen, anti-SARA.

    Science.gov (United States)

    Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy

    2011-09-01

    The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.

  4. Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

    Science.gov (United States)

    Goldrick-Rab, Sara; Kelly, Andrew P.

    2016-01-01

    In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

  6. NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r

  11. Escribiendo el silencio: la contemplación poética de Sara Pujol

    Directory of Open Access Journals (Sweden)

    Gala, Candelas

    2005-06-01

    Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.

  12. Intravenous immunoglobulin in the management of a rare cause of hemolytic disease of the newborn: Anti-SARA antibodies.

    Science.gov (United States)

    Venkataraman, Rohini; Yusuf, Kamran

    2017-01-01

    Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.

  13. Student Pressure Subject of Debate

    Science.gov (United States)

    Gewertz, Catherine

    2006-01-01

    This article discusses student pressure as a subject of debate. The latest debate about schoolwork is being fueled by three recent books: "The Homework Myth" by Alfie Kohn, "The Case Against Homework" by Sara Bennett and Nancy Kalish, and "The Overachievers", by Alexandra Robbins, which depicts overextended high…

  14. Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

    Directory of Open Access Journals (Sweden)

    Tirshem Kumar Kaushik

    2015-05-01

    Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.

  15. Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge

    DEFF Research Database (Denmark)

    Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette

    2017-01-01

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...

  16. TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

    Energy Technology Data Exchange (ETDEWEB)

    1989-03-01

    This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.

  17. Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.

    1994-11-01

    The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)

  18. Instructional materials for SARA/OSHA training. Volume 1, General site working training

    Energy Technology Data Exchange (ETDEWEB)

    Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)

    1988-04-01

    This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.

  19. La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli

    Directory of Open Access Journals (Sweden)

    Umberto Fortis

    2014-04-01

    Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.

  20. Reading Sara Pujol Russell’s Poetry of Contemplation and Connection

    Directory of Open Access Journals (Sweden)

    Anita M. Hart

    2012-06-01

    Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.

  1. SAPHIRE technical reference manual: IRRAS/SARA Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.

    1993-01-01

    This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix

  2. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    Directory of Open Access Journals (Sweden)

    Abdullah K. Shehabat

    2016-09-01

    Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.

  3. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0. Volume 5, Systems Analysis and Risk Assessment (SARA) tutorial manual

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities

  4. SARA South Observations and Analysis of the Solar Type, Totally Eclipsing, Over Contact Binary, PY Aquarii

    Science.gov (United States)

    Chamberlain, Heather; Samec, Ronald G.; Caton, Daniel Bruce; Van Hamme, Walter

    2018-01-01

    PY Aqr (GSC 05191-00853) is a solar Type (T ~ 5750K) eclipsing binary. It was observed in July to October, 2017 at Cerro Tololo in remote mode with the 0.6-m SARA South reflector. Two times of minimum light were calculated from our present observations, a primary and a secondary eclipse:HJD Min I = 2457951.7762±0.0006 HJD Min II = 2458019.5295±00.0003. Both weighted as 1.0.In addition, four timings were determined from online data given in IBVS 5600 and five observations at minima were determined from archived All Sky Automated Survey Data:HJD Min I = 2452908.3165, 2452912.33612 HJD Min II = 2452877.5621, 2452913.34465. All weighted as 0.5.ASAS Observations at minima: 2452094.688, 2453478.882, 2453266.576, 2452093.685 and 54729.600. Each weighted as 0.10The following linear and quadratic ephemerides were determined from all available times of minimum light:JD Hel Min I=2452951.7443±0.0008d + 0.402093441±0.000000099 X E {1} JD Hel Min I=2452951.7439±0.0007d + 0.4020912±0.0000007 X E +0.00000000018 ± 0.00000000006 X E2 {2}A BVRI Bessell filtered simultaneous Wilson-Devinney Program (W-D) solution reveals that the system has a mass ratio of ~0.34 and a component temperature difference of only ~40 K. One low luminosity (Tfact ~ 0.94, ~66 degree radius) large cool region of spots was iterated on the primary component in the WD Synthetic Light Curve computations. It appears in the Southern Hemisphere (colatitude 155 degrees). The Roche Lobe fill-out of the binary is ~17%. The inclination is ~86 degrees. An eclipse duration of ~10 minutes was determined for the primary eclipse and the light curve solution. Additional and more detailed information is given in this report.

  5. DETERMINACIÓN DE LAS FRACCIONES SARA DE ASFALTOS COLOMBIANOS ENVEJECIDOS AL MEDIO AMBIENTE EMPLEANDO CROMATOGRAFÍA LÍQUIDA EN COLUMNA DETERMINAÇÃO DAS FRAÇÕES SARA DE ASFALTOS COLOMBIANOS ENVELHECIDOS AO MÉDIO AMBIENTE EMPREGANDO CROMATOGRAFIA LÍQUIDA EM COLUNA DETERMINATION OF SARA FRACTIONS OF ENVIRONMENTALLY AGED COLOMBIAN ASPHALTS USING LIQUID CHROMATOGRAPHY COLUMN

    Directory of Open Access Journals (Sweden)

    Fredy Alberto Reyes

    2012-06-01

    Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p

  6. Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia

    Directory of Open Access Journals (Sweden)

    Tjitske F. Lawerman

    2017-12-01

    Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced

  7. sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

    DEFF Research Database (Denmark)

    Christner, Martin; Heinze, Constanze; Busch, Michael

    2012-01-01

    to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...

  8. Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

    Science.gov (United States)

    Godwin, Allison; Potvin, Geoff

    2017-01-01

    This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…

  9. Staphylococcus aureus Quorum Regulator SarA Targeted Compound, 2-[(Methylaminomethyl]phenol Inhibits Biofilm and Down-Regulates Virulence Genes

    Directory of Open Access Journals (Sweden)

    P. Balamurugan

    2017-07-01

    Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.

  10. The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters

    International Nuclear Information System (INIS)

    Iazzourene, F.

    1982-01-01

    The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr

  11. Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

    Directory of Open Access Journals (Sweden)

    Helena López

    2013-07-01

    Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.

  12. Os suínos da raça Bísara – oportunidades e desafios

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...

  13. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  14. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Diego O Andrey

    Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  15. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    OpenAIRE

    Abdullah K. Shehabat

    2016-01-01

    This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...

  16. Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests

    International Nuclear Information System (INIS)

    Eifler, W.; Shepherd, I.M.

    1983-01-01

    Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix

  17. Land-use evaluation for sustainable construction in a protected area: A case of Sara mountain national park.

    Science.gov (United States)

    Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena

    2018-01-15

    The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Probabilistic model fitting for spatio-temporal variability studies of precipitation: the Sara-Brut system - a case study

    International Nuclear Information System (INIS)

    Dorado Delgado, Jennifer; Burbano Criollo, Juan Carlos; Molina Tabares, Jose Manuel; Carvajal Escobar, Yesid; Aristizabal, Hector Fabio

    2006-01-01

    In this study, space and time variability of monthly and annual rainfall was analyzed for the downstream influence zone of a Colombian supply-regulation reservoir, Sara-Brut, located on the Cauca valley department. Monthly precipitation data from 18 gauge stations and for a 29-year record (1975-2003) were used. These data were processed by means of time series completion, consistency analyses and sample statistics computations. Theoretical probabilistic distribution models such as Gumbel, normal, lognormal and wake by, and other empirical distributions such as Weibull and Landwehr were applied in order to fit the historical precipitation data set. The fit standard error (FSE) was used to test the goodness of fit of the theoretical distribution models and to choose the best of this probabilistic function. The wake by approach showed the best goodness of fit in 89% of the total gauges taken into account. Time variability was analyzed by means of wake by estimated values of monthly and annual precipitation associated with return periods of 1,052, 1,25, 2, 10, 20 and 50 years. Precipitation space variability is presents by means of ArcGis v8.3 and using krigging as interpolation method. In general terms the results obtained from this study show significant distribution variability in precipitation over the whole area, and particularity, the formation of dry and humid nucleus over the northeastern strip and microclimates at the southwestern and central zone of the study area were observed, depending on the season of year. The mentioned distribution pattern is likely caused by the influence of pacific wind streams, which come from the Andean western mountain range. It is expected that the results from this work be helpful for future planning and hydrologic project design

  19. The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

    International Nuclear Information System (INIS)

    Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan

    2013-01-01

    Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques

  20. SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-04-01

    The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

  1. A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta

    OpenAIRE

    Carvalho, Marieta

    2014-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...

  2. The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

    Directory of Open Access Journals (Sweden)

    John M Morrison

    2012-03-01

    Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.

  3. Identification of new proton-rich rare earth nuclei by means of the coupled system helium jet-isotope separator of SARA

    International Nuclear Information System (INIS)

    Ollivier, T.

    1986-01-01

    In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr

  4. Análise SWOT global da exploração dos suínos da raça Bísara

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...

  5. Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973

    Directory of Open Access Journals (Sweden)

    Guillermina Feudal

    2017-12-01

    Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.

  6. Sharing AIS Related Anomalies (SARA)

    Science.gov (United States)

    2016-03-01

    78 6.3.7 SQL Versus NoSQL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 6.4 Data Processing...43 6.1 Overview of SQL and NoSQL differences, from [56]. . . . . . . . . . . . . . . . . . 82 A.1 Description of the ship anomaly upload use...constraints must be considered. These requirements, however, can only be defined when lower level implementation decisions, such as SQL versus NoSQL

  7. Severe accident recriticality analyses (SARA)

    DEFF Research Database (Denmark)

    Frid, W.; Højerup, C.F.; Lindholm, I.

    2001-01-01

    with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality-both super-prompt power bursts and quasi steady-state power......Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies......, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g(-1), was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s(-1). In most cases, however, the predicted energy deposition was smaller, below...

  8. Notas sobre Feral y las cigüeñas, de Fernando Alonso, y la "Historia del califa cigüeña" (Wilhelm Hauff, Sara Cone Bryant

    Directory of Open Access Journals (Sweden)

    Hans Christian Hagedorn

    2011-01-01

    Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.

  9. Ergenlik Dönemi Okuma Tutumu Ölçeği’nin Türkçe’ye Uyarlanması The Adaptasyon Of Survey Of Adolescent Reading Attitudes (Sara Into Turkish

    Directory of Open Access Journals (Sweden)

    Muhammet BAŞTUĞ

    2013-07-01

    Full Text Available The aim of this study is to adapt the Survey of Adolescent Reading Attitudes SARA to Turkish, which was developed by McKenna, Conradi, Lawrance, Jang, and Meyer (2012, and to test it for validity and reliability. The rationale is that the scale involves one’s attitude towards digital reading. The sample was comprised of 702 sixth,seventh and eighth grade students in Konya- 343 of them being femaleand the remaining 359 being male. The original scale had 18 items infour sub-dimensions, namely academic reading in digital settings (AD,recreational reading in digital settings (RD, academic reading in printsettings (AP and recreational reading in print settings (RP. Theexploratory factor analysis and confirmatory factor analysis revealedthat the four original sub-dimensions were retained when two itemswere omitted. Cronbach’s alpha coefficients were 0.691, 0.802, 0.690,0.660 and 0.623 for the overall scale, RD, RP, AP and AD respectively.The results suggest that the adapted scale is reliable and valid. The 15-item finalized version is appropriate for the Turkish language and use inTurkey. In the development of reading environments and materials,identification of students’ attitudes toward reading in a multidimensionalway is expected to make great contributions to morequalified learning environments. Bu araştırmanın amacı, McKenna, Conradi, Lawrence, Jang ve Meyer (2012 tarafından geliştirilen Ergenlik Dönemi Okuma Tutumu Ölçeği’nin geçerlik ve güvenirliğinin yapılarak Türkçe’ye uyarlanmasıdır. Ölçeğin dijital okumaya karşı tutumu da kapsaması sebebiyle uyarlama çalışmasının uygun olacağı düşünülmüştür. Çalışma grubunu Konya ilinde yer alan ve 6,7 ve 8. Sınıflara devam eden 343’ü kız, 359’u erkek toplam 702 öğrenci oluşturmuştur. Ölçeğin orjinali 18 maddeden ve “Akademik Dijital, Serbest Dijital, Akademik Kağıt ve Serbest Kağıt” olmak üzere 4 alt boyuttan olu

  10. 1980 Annual status report: super-SARA

    International Nuclear Information System (INIS)

    1981-01-01

    The essential tasks of the JRC for the SUPERSARA project during 1980 were therefore twofold: 1. Actuation of an international Task Force with which to: a. discuss in depth the test objectives and the relationships between the SSTP and the world mosaic of activities in the field of LWR fuel behaviour; b. establish a consensus test matrix; c. identify and discuss the major technological problems affecting the feasibility of attaining the consensus test objectives, especially for the boil-down SFD tests. A Task Force with these objectives was necessary in order to provide the elements for a Council decision on phase II. 2. Conservation of the rythm of the main contractor (UKAEA-Harwell) and subcontractors for the timely fabrication of loop components and the timely design of those new aspects of the plant necessary for the boil-down SFD tests

  11. Multidimensional representations: The knowledge domain of germs held by students, teachers and medical professionals

    Science.gov (United States)

    Rua, Melissa Jo

    The present study examined the understandings held by 5th, 8th, and 11th-grade students, their teachers and medical professionals about germs. Specifically, this study describes the content and structure of students' and adults' conceptions in the areas of germ contraction, transmission, and treatment of infectious and non-infectious diseases caused by microorganisms. Naturalistic and empirical research methods were used to investigate participants' conceptions. Between and within group similarities were found using data from concept maps on the topic "flu," drawings of germs, a 20 word card sort related to germs and illness, and a semi-structured interview. Concept maps were coded according to techniques by Novak and Gowan (1984). Drawings of germs were coded into four main categories (bacteria, viruses, animal cell, other) and five subcategories (disease, caricature, insect, protozoa, unclassified). Cluster patterns for the card sorts of each group were found using multidimensional scaling techniques. Six coding categories emerged from the interview transcripts: (a) transmission, (b) treatment, (c) effect of weather on illness, (d) immune response, (e) location of germs, and (f) similarities and differences between bacteria and viruses. The findings showed students, teachers and medical professionals have different understandings about bacteria and viruses and the structures of those understandings vary. Gaps or holes in the participants knowledge were found in areas such as: (a) how germs are transmitted, (b) where germs are found, (c) how the body transports and uses medicine, (d) how the immune system functions, (e) the difference between vaccines and non-prescription medicines, (f) differences that exist between bacteria and viruses, and (g) bacterial resistance to medication. The youngest students relied heavily upon personal experiences with germs rather than formal instruction when explaining their conceptions. As a result, the influence of media was

  12. CERN welcomes its first doctoral students from Morocco

    CERN Multimedia

    Laëtitia Pedroso

    2010-01-01

    This year marks the start of a new phase between CERN and Morocco with the arrival of the first two Moroccan students.   Mohamed Gouighri and Sara Boutouil, the first two Moroccan students at CERN. Thanks to the efforts of a small group of Moroccan academics, Morocco has been participating in the LHC programme for over ten years. About ten Moroccan physicists are members of the ATLAS collaboration, which comprises over 2000 physicists and 165 research institutes from 37 different countries. The arrival of the first Moroccan doctoral students at CERN was the logical next step. The new programme is the result of a multi-party agreement between CERN, the Sharing Knowledge Foundation, the Moroccan universities participating in the LHC programme and the Hassan II Academy of Science and Technology. Mohamed Gouighri is the first Moroccan to obtain a scholarship to study at CERN, which is being funded by the Hassan II Academy of Science and Technology. He has been studying physics at the Faculty of S...

  13. The prevalence and causes of decreased visual acuity – a study based on vision screening conducted at Enukweni and Mzuzu Foundation Primary Schools, Malawi

    OpenAIRE

    Thom L; Jogessar S; McGowan SL; Lawless F

    2016-01-01

    Leaveson Thom,1 Sanchia Jogessar,1,2 Sara L McGowan,1 Fiona Lawless,1,2 1Department of Optometry, Mzuzu University, Mzuzu, Malawi; 2Brienholden Vision Institute, Durban, South Africa Aim: To determine the prevalence and causes of decreased visual acuity (VA) among pupils recruited in two primary schools in Mzimba district, northern region of Malawi.Materials and methods: The study was based on the vision screening which was conducted by optometrists at Enukweni and Mzuzu Foundation Primary Sc...

  14. The prevalence and causes of decreased visual acuity – a study based on vision screening conducted at Enukweni and Mzuzu Foundation Primary Schools, Malawi

    OpenAIRE

    Thom,Leaveson; Jogessar,Sanchia; McGowan,Sara L; Lawless,Fiona

    2016-01-01

    Leaveson Thom,1 Sanchia Jogessar,1,2 Sara L McGowan,1 Fiona Lawless,1,2 1Department of Optometry, Mzuzu University, Mzuzu, Malawi; 2Brienholden Vision Institute, Durban, South Africa Aim: To determine the prevalence and causes of decreased visual acuity (VA) among pupils recruited in two primary schools in Mzimba district, northern region of Malawi.Materials and methods: The study was based on the vision screening which was conducted by optometrists at Enukweni and Mzuzu Foundation Primary Sc...

  15. Factors potentially influencing academic performance among medical students

    Directory of Open Access Journals (Sweden)

    Al Shawwa L

    2015-01-01

    Full Text Available Lana Al Shawwa,1 Ahmad A Abulaban,2 Abdulrhman A Abulaban,3 Anas Merdad,3 Sara Baghlaf,3 Ahmed Algethami,3 Joullanar Abu-shanab,3 Abdulrahman Balkhoyor3 1Department of Medical Education, College of Medicine, King Abdulaziz University, Jeddah, 2Department of Medicine-Neurology, King Fahad National Guard Hospital, King Abdulziz Medical City, Riyadh, 3Department of Medical Education, College of Medicine, King Abdulaziz University, Jeddah, Kingdom of Saudi Arabia Background: Studies are needed to examine predictors of success in medical school. The aim of this work is to explore factors that potentially influence excellence of medical students. Methods: The study was conducted in the Medical Faculty of King Abdulaziz University during October 2012. A self-administered questionnaire was used. Medical students with a grade point average (GPA ≥4.5 (out of 5 were included and compared to randomly selected medical students with a GPA <4.5, who were available at the time of the study. Results: A total of 359 undergraduate students participated in the study. 50.4% of the sample was students with a GPA ≥4.5. No statistically significant difference regarding the time spent on outings and social events was found. However, 60.7% of high GPA students spend less than 2 hours on social networking per day as compared to 42.6% of the lower GPA students (P<0.01. In addition, 79% of high GPA students prefer to study alone (P=0.02, 68.0% required silence and no interruptions during studying time (P=0.013, and 47% revise their material at least once before an exam (P=0.02. Conclusion: Excellent medical students have many different characteristics. For example, they do not use social networking for prolonged periods of time, and they have strong motivation and study enjoyment. Further studies are needed to examine whether these differences have a real impact on GPA or not. Keyword: King Abdulaziz University KAU, medical school, study habits, exam habits 

  16. A simple McGowan specific volume correction for branching in hydrocarbons and its consequences for some other solvation parameter values

    NARCIS (Netherlands)

    van Noort, P.C.M.; Haftka, J.J.H.; Parsons, J.R.

    2011-01-01

    Differences in molecular properties between linear and branched alkanes as well as between compounds with branched alkyl groups is of relevance due to the large number of branched isomers of environmentally relevant compounds (e.g. fuels, fuel additives, surfactants). For branched alkane vapor

  17. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    Directory of Open Access Journals (Sweden)

    Mihael Černetič

    2015-02-01

    Full Text Available The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is analysed from the perspective of mindfulness. Within the course of therapy, parallels were observed between the client's increased mindfulness, improved internal and external contact, strengthened Adult ego state, mastery of introjections, as well as diminished feelings of guilt, improved mood, self care and ability to engage in appropriate separation and individuation. These gains support the conclusion that Integrative Psychotherapy and mindfulness are inherently related and that explicit incorporation of mindfulness may enhance the therapeutic process of Integrative Psychotherapy.

  18. Discovery of carbon nanotubes. Sara ni carbon nanotube e

    Energy Technology Data Exchange (ETDEWEB)

    Iijima, S

    1994-01-20

    This paper describes the following matters on carbon nanotubes (CNt): CNt is discovered in carbon deposits generated in the tip of a negative electrode during DC arc discharge between carbon electrodes. CNt has a construction in which cylinders made of normally several layers are superposed, based on cylindrical crystals in a single layer with six-member rings of carbon atoms laid out. Spiral arrangement of carbon six-member rings has been discovered in the single-layered crystals. Five-member rings exist in a location where the CNt tip is closed, and seven-member rings in a location where the CNt presents a saddle-like curve, without exceptions. It is introduced theoretically that the electronic structure of the single-layered CNt depends on the cylinder diameter and spiral pitch. Replacing part of the carbon negative electrode with iron, and vaporizing iron and carbon simultaneously through arc discharge can result in a single-layered CNt with a diameter of 1 nm. Heating the CNt deposited with metallic lead in an oxygen atmosphere can form CNt containing lead compounds. 19 refs., 9 figs.

  19. AFSC/REFM: Alaska Stock Assessment Results Archive (SARA)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Each year over 50 Alaskan groundfish stock assessments report the condition of Alaskan fisheries resources in the U.S. Exclusive Economic Zone. Stock assessment...

  20. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    OpenAIRE

    Mihael Černetič

    2015-01-01

    The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is ana...

  1. Gene : CBRC-SARA-01-0604 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available and polyadenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82107.1| cleavage and poly...adenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82108.1| cleavage and polyadenylat...ion specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] 3e-16 77% MSTVPTVSCTS...TDRWGLVGTGRCYGSGRGGSMLASCGELSQAIALPKPVLSGHQAGSDPAGSSLYLVLPEGRCLPSVPAHVCPGTAEPAQHSQTPLQRELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVCPWAGVPRAGRPGPQAQPALSFRCMQWPPAPIRHAPASHA ...

  2. Student Violence.

    Science.gov (United States)

    Bloomberg, Edward

    This report discusses student violence within the framework of causes, issues, and false and true solutions. The author decries the abdication of responsibilities by both college administrators, who have permitted students to "do their thing," and leftwing students, who crusade thoughtlessly against educational institutions. Some true solutions…

  3. STUDENT PLACEMENT

    African Journals Online (AJOL)

    User

    students express lack of interest in the field they are placed, it ... be highly motivated to learn than students placed in a department ... the following research questions. Research Questions. •. Did the criteria used by Mekelle. University for placement of students into different departments affect the academic performance of ...

  4. Student employment

    DEFF Research Database (Denmark)

    Jacob, Marita; Gerth, Maria; Weiss, Felix

    2018-01-01

    , according to social origins, in student employment from first-year students through graduating students. We show that inequality in job quality exists and is partly attributable to the need for students from lower social origins to work to finance their studies. We hypothesise that initial inequalities......In this article, we examine social origin differences in employment patterns across different stages of higher education and compare these differences between vocational and academic fields of study. Using data from a large-scale German student survey, we study the development of inequality...

  5. Student-to-Student Diplomacy

    DEFF Research Database (Denmark)

    Bislev, Ane Katrine

    2017-01-01

    Chinese international students have become an increasingly visible presence around the globe, and interest in these students has consequently increased among universities, researchers, and policy-makers, who often see international students as a source of increased soft power. This article...... questions the idea of Chinese international students as a soft-power tool. This is done through a critical discussion of the concept of soft power and the rather limited research on educational diplomacy, demonstrating that the analytical vagueness of the concept of soft power leads to an oversimplified...... understanding of the linkage between international students and soft power. In order to provide a more nuanced understanding of this linkage, the article examines the actual overseas experience of Chinese international students and argues that the linkage between international students and soft power is highly...

  6. Students developing resources for students.

    Science.gov (United States)

    Pearce, Michael; Evans, Darrell

    2012-06-01

    The development of new technologies has provided medical education with the ability to enhance the student learning experience and meet the needs of changing curricula. Students quickly adapt to using multimedia learning resources, but these need to be well designed, learner-centred and interactive for students to become significantly engaged. One way to ensure that students become committed users and that resources become distinct elements of the learning cycle is to involve students in resource design and production. Such an approach enables resources to accommodate student needs and preferences, but also provides opportunities for them to develop their own teaching and training skills. The aim of the medical student research project was to design and produce an electronic resource that was focused on a particular anatomical region. The views of other medical students were used to decide what features were suitable for inclusion and the resulting package contained basic principles and clinical relevance, and used a variety of approaches such as images of cadaveric material, living anatomy movies and quizzes. The completed package was assessed using a survey matrix and found to compare well with commercially available products. Given the ever-diversifying arena of multimedia instruction and the ability of students to be fully conversant with technology, this project demonstrates that students are ideal participants and creators of multimedia resources. It is hoped that such an approach will help to further develop the skill base of students, but will also provide an avenue of developing packages that are student user friendly, and that are focused towards particular curricula requirements. © Blackwell Publishing Ltd 2012.

  7. Undocumented Students

    Science.gov (United States)

    Fields, Cheryl

    2005-01-01

    This article reports on the plight of undocumented immigrant students in the United States. Fights have been waged in various state legislatures over the past few years concerning whether undocumented immigrant students should be able to benefit from in-state tuition rates at public colleges and universities. But a story in The Wall Street Journal…

  8. Student Engagement

    DEFF Research Database (Denmark)

    Conduit, Jodie; Karpen, Ingo; Farrelly, Francis

    2017-01-01

    system (the university), the narrow service system (the course), and the individual dyadic level of engagement (the student-lecturer interaction). These findings could be further considered and empirically tested in other engagement contexts (e.g. employee engagement, customer engagement).......Universities are seeking to actively and strategically manage student engagement through providing opportunities for students to interact and engage with the institution on a range of levels and in different ways. However, this increasingly complex and multi-layered nature of student engagement...... within a tertiary education environment is not well understood. Through qualitative focus groups and a series of interviews with undergraduate and postgraduate students, this study explores and articulates the cognitive, emotional, behavioural and social dimensions of engagement that depict the nature...

  9. Student-Led Conferences: Students Taking Responsibility

    Science.gov (United States)

    Nauss, Sherri A.

    2010-01-01

    One of the many challenges that face middle grade students, parents, and teachers is the student's lack of ownership of their academic achievements. Student-led conferences are a unique way to engage the student and the parent in the academic progress. Parents and teachers discuss the student's attitude toward the work, the student's work ethic in…

  10. Student perception as moderator for student wellbeing

    NARCIS (Netherlands)

    Van Petegem, Karen; Aelterman, Antonia; Rosseel, Yves; Creemers, Bert

    Student motivation as well as student perception of interpersonal teacher behaviour are linked to the sense of wellbeing at student level. However, while most of the variance in the measurement of student wellbeing was situated at student level, eleven percent of variance was found at classroom

  11. Summer Students

    CERN Multimedia

    2005-01-01

    SUMMER STUDENT LECTURE PROGRAMME Main Auditorium, bldg. 500 Monday 8 August 09:15 - 10:00 A. Höcker CP Violation (3/4) 10:15 - 12:00 J-J. GOMEZ-CADENAS Neutrino Physics (1-2/4) 12:00 Discussion Session Tuesday 9 August 09:15 - 10:00 A. Höcker CP Violation (4/4) 10:15 - 11:00 J-J. GOMEZ-CADENAS Neutrino Physics (3/4) 11:15 - 12:00 F. GREY The GRID 12:00 Discussion Session 14:15 - 17:00 Student Sessions Wednesday 10 August 09:15 - 10:00 J-J. GOMEZ-CADENAS Neutrino Physics (4/4) 10:15 - 12:00 J. LESGOURGUES Introduction to Cosmology (1-2/5) 12:00 Discussion Session 14:15 - 17:00 Student Sessions Thursday 11 August 09:15 - 11:00 J. LESGOURGUES Introduction to Cosmology (3-4/5) 11:15 - 12:00 G. KALMUS The ILC Story 12:00 Discussion Session Friday 12 August 09:15 - 10:00 J. LESGOURGUES Introduction to Cosmology (5/5) 10:15 - 11:00 G. VENEZIANO String theory: has Einstein's dream come true? 11:00  Discussion...

  12. Teacher Ethnicity, Student Ethnicity, and Student Outcomes

    Science.gov (United States)

    Driessen, Geert

    2015-01-01

    A review of the empirical literature was conducted to establish the relation between teacher and student ethnicity, and cognitive and noncognitive student outcomes. It was hypothesized that ethnic teacher-student congruence results in more favorable outcomes for especially minority students. A total of 24 quantitative studies focusing on primary…

  13. International Students: A Vulnerable Student Population

    Science.gov (United States)

    Sherry, Mark; Thomas, Peter; Chui, Wing Hong

    2010-01-01

    This study examines the experiences of international students at The University of Toledo, where international students comprise approximately 10% of the student population. It highlights problems international students experience such as adapting to a new culture, English language problems, financial problems and lack of understanding from the…

  14. Student-on-Student Sexual Harassment

    Science.gov (United States)

    Rogers, Frances E.

    2011-01-01

    No school board member, administrator, or teacher wants to see a student suffering from taunts of the student's peers, but with budget cutbacks, reductions in force, and increased class size, teachers and administrators are stretched too thin to easily identify, investigate, and remedy student-on-student harassment. But school districts must…

  15. Student Club

    CERN Multimedia

    2009-01-01

    They know where the work is, but where’s all the fun? CERN’s new student club provides a much-needed social outlet for all young people coming to CERN for any length of time. Some of the participants on the trip to Chamonix enjoy the breath-taking scenery.For many young people, their time at CERN can be filled not only with exciting opportunities but also anxious uncertainty. Whether your stay is for just a few months or a few years, it can be quite daunting to arrive at a new place and try to find your way around – and let’s face it, CERN is not an easy place to find your way around! Much of their time here is spent on doing analysis or technical work on the experiments or the LHC; but even at the end of the day or on weekends there are few social outlets at CERN geared just towards young people. Fortunately, some young people have decided to come together and make their time here not just productive, but fun! Doctoral student, Omer Khalid, Marie Curie fell...

  16. Summer Students

    CERN Multimedia

    2005-01-01

    SUMMER STUDENT LECTURE PROGRAMME Main Auditorium, bldg. 500 DATE TIME LECTURER TITLE Wednesday 6 July 09:15 - 10:00 F. CERUTTI (CERN) Presentation of the Summer Student Programme D. Heagerty (CERN) Computer rules O. ULLALAND (CERN) Workshops presentation 10:15 - 11:00 D. SCHLATTER (CERN) Introduction to CERN 11:15 Film on CERN Thursday 7 July 09:15 - 11:00 L. Di Lella (CERN) Introduction to Particle Physics (1-2/4) 11:15 - 12:00 P. Chomaz (GANIL / CERN) Introduction to Nuclear Physics (1/3) 12:00 Discussion Session 14:00 - 14:45 M. Lindroos (CERN) ISOLDE Facility 15:00 M. Lindroos (CERN) ISOLDE Visit Friday 8 July 09:15 - 10:00 L. Di Lella (CERN) Introduction to Particle Physics (3/4) 10:15 - 11:00 P. Chomaz (GANIL / CERN) Introduction to Nuclear Physics (2/3) 11:15 - 12:00 G. ROLANDI (CERN) How an experiment is designed (1/2) 12:00 Discussion Session Monday 11 July 09:15 - 10:00 L. Di Lella (CERN) Introduction to Particle Physi...

  17. Student Power in Africa

    African Journals Online (AJOL)

    Sociology, Faculty of Arts and Sciences, Harvard University, USA. ... publication, the book Student Politics in Africa: Representation and Activism, published .... reference to two moments in the country's student political history: the 1973 student.

  18. Eating habits of students

    OpenAIRE

    Hoyer, Silvestra; Zupančič, Andreja

    2015-01-01

    The article deals with eating habits of students. Its purpose was to ascertaineating habits of students living outside their primary home and are under different forms of stress. Methods: the pattern is represented by students living in student homer where they can cook and prepare their own meals. In the research, 81 students living in the students home on Cesta v Mestni log in Ljubljana. The inquiry was composed from 34 questions. The data were processed with Microsoft Excel. Body mass inde...

  19. SUMMER STUDENT LECTURE PROGRAMME

    CERN Multimedia

    2004-01-01

    Main Auditorium, bldg. 500 DATE TIME LECTURER TITLE Monday 16 August 09:15 - 10:00 Student sessions (1/6) 10:15 - 11:00 Student sessions (2/6 11:15 - 12:00 Student sessions (3/6) Tuesday 17 August 09:15 - 10:00 Student sessions (4/6) 10:15 - 11:00 Student sessions (5/6) 11:15 - 12:00 Student sessions (6/6

  20. UNDERSTANDING UNDERGRADUATE STUDENTS PRACTICUM ...

    African Journals Online (AJOL)

    User

    student misbehavior as the most stressful experience of student teacher practicum experience. ... adequate support, rethinking assessment mechanism, provision of adequate fund, strengthening ..... provide regular formative feedback, have.

  1. Supporting Deaf Students--and All Students

    Science.gov (United States)

    Yuknis, Christina; Santini, Joseph; Appanah, Thangi

    2017-01-01

    Two faculty members and a Ph.D. student at Gallaudet University, the world's only university for the deaf, explain the concept of Deaf-Gain, which reframes the idea of hearing loss into one of gaining deafness and recognizes the contributions that deaf people make to society. This narrative assumes that deaf students and all students bring…

  2. College Freshmen Students' Perspectives on Weight Gain Prevention in the Digital Age: Web-Based Survey.

    Science.gov (United States)

    Monroe, Courtney M; Turner-McGrievy, Gabrielle; Larsen, Chelsea A; Magradey, Karen; Brandt, Heather M; Wilcox, Sara; Sundstrom, Beth; West, Delia Smith

    2017-10-12

    healthy diet and staying physically active). Email was the most frequently used electronic platform, with 96% (48/50) of students reporting current use of it. Email was also the most frequently cited preferred eHealth delivery platform, with 86% (43/50) of students selecting it. Facebook was preferred by the second greatest proportion of students (40%, 20/50). Most college freshmen have concerns about an array of weight gain prevention topics and are generally open to the possibility of receiving eHealth interventions designed to address their concerns, preferably via email compared with popular social media platforms. These preliminary findings offer a foundation to build upon when it comes to future descriptive investigations focused on behavioral weight gain prevention among college freshmen in the digital age. ©Courtney M Monroe, Gabrielle Turner-McGrievy, Chelsea A Larsen, Karen Magradey, Heather M Brandt, Sara Wilcox, Beth Sundstrom, Delia Smith West. Originally published in JMIR Public Health and Surveillance (http://publichealth.jmir.org), 12.10.2017.

  3. Summer Students

    CERN Multimedia

    2005-01-01

    SUMMER STUDENT LECTURE PROGRAMME Main Auditorium, bldg. 500 DATE TIME LECTURER TITLE Monday 1 August 09:15 - 10:00 P. WELLS The Higgs Saga at LEP 10:15 - 11:00 E. KIRITSIS Beyond the Standard Model (1/4) 11:15 - 12:00 G. COWAN Introduction to Statistics (1/3) 12:00 Discussion Session Tuesday 2 August 09:15 - 11:00 E. KIRITSIS Beyond the Standard Model (2-3/4) 11:15 - 12:00 G. COWAN Introduction to Statistics (2/3) 12:00 Discussion Session Wednesday 3 August 09:15 - 10:00 G. COWAN Introduction to Statistics (3/3) 10:15 - 11:00 E. KIRITSIS Beyond the Standard Model (4/4) 11:15 - 12:00 K. JAKOBS Physics at Hadronic Colliders (1/4) 12:00 Discussion Session Thursday 4 August 09:15 - 11:00 K. JAKOBS Physics at Hadronic Colliders (2-3/4) 11:15 - 12:00 A. WEINSTEIN Gravitation Waves 12:00 Discussion Session 16:30 - 18:00 Poster Session Friday 5 August 09:15 - 11:00 A. Höcker CP Violation (1-2/4) 11:15 - 12:00 K. JA...

  4. Summer Students

    CERN Multimedia

    2005-01-01

    SUMMER STUDENT LECTURE PROGRAMME Main Auditorium, bldg. 500 DATE TIME LECTURER TITLE Monday 18 July 09:15 - 11:00 G. ROSS Fundamental concepts in Particle Physics (1-2/6) 11:15 - 12:00 N. PALANQUE-DELABROUILLE Astroparticle Physics (1/3) 12:00 Discussion Session Tuesday 19 July 09:15 - 10:00 G. ROSS Fundamental concepts in Particle Physics (3/6) 10:15 - 12:00 N. PALANQUE-DELABROUILLE Astroparticle Physics (2-3/3) 12:00 Discussion Session Wednesday 20 July 09:15 - 10:00 G. ROSS Fundamental concepts in Particle Physics (4/6) 10:15 - 11:00 F. RADEMAKERS ROOT 11:15 - 12:00 L. ROSSI Super-conducting magnet technology for particle accelerators and detectors 12:00 Discussion Session Thursday 21 July 09:15 - 10:00 G. ROSS Fundamental concepts in Particle Physics (5/6) 10:15 - 12:00 C. DE LA TAILLE Introduction to Electronics (1-2/3) 12:00 Discussion Session Friday 22 July 09:15 - 10:00 C. DE LA TAILLE Introduction to Electronics (3/3) 10:15 -...

  5. Summer Students

    CERN Multimedia

    2005-01-01

    SUMMER STUDENT LECTURE PROGRAMME Main Auditorium, bldg. 500 DATE TIME LECTURER TITLE Monday 25 July 09:15 - 11:00 A. PICH The Standard Model (2-3/8) 11:15 - 12:00 J. STACHEL Quark Gluon Plasma Physics (1/3) 12:00 Discussion Session Tuesday 26 July 09:15 - 10:00 A. PICH The Standard Model (4/8) 10:15 - 12:00 J. STACHEL Quark Gluon Plasma Physics (2-3/3) 12:00 Discussion Session Wednesday 27 July 09:15 - 11:00 A. PICH The Standard Model (5-6/8) 11:15 - 12:00 J-P. DELAHAYE The CLIC Concept and Technology for an e+e-Collider at the Energy Frontier 11:15 - 12:00 Discussion Session Thursday 28 July 09:15 - 10:00 A. PICH The Standard Model (7/8) 10:15 - 11:00 P. SPHICAS Data Acquisition Systems (1/2) 11:15 - 12:00 R. JACOBSEN From Raw data to Physics Results (1/2) 12:00 Discussion Session Friday 29 July 09:15 - 10:00 A. PICH The Standard Model (8/8) 10:15 - 11:00 P. SPHICAS Data Acquisition Systems (2/2) 11:15 - 12:00 R. JACOBSEN Fr...

  6. Summer Students

    CERN Multimedia

    2005-01-01

    SUMMER STUDENT LECTURE PROGRAMME Main Auditorium, bldg. 500 DATE TIME LECTURER TITLE Monday 11 July 09:15 - 10:00 L. Di Lella (CERN) Introduction to Particle Physics (4/4) 10:15 - 11:00 P. Chomaz (GANIL / CERN) Introduction to Nuclear Physics (3/3) 11:15 - 12:00 G. ROLANDI (CERN) How an experiment is designed (2/2) 12:00 Discussion Session Tuesday 12 July  09:15 - 11:00 O. BrÜning (CERN) Accelerators (1-2/5) 11:15 - 12:00 O. ULLALAND (CERN) Detectors (1/5) 12:00 Discussion Session Wednesday 13 July 09:15 - 10:00 O. BrÜning (CERN) Accelerators (3/5) 10:15 - 11:00 R. LANDUA (CERN) Antimatter in the Lab (1/2) 11:15 - 12:00 O. ULLALAND (CERN) Detectors (2/5) 12:00 Discussion Session Thursday 14 July 09:15 - 10:00 O. ULLALAND (CERN) Detectors (3/5) 10:15 - 11:00 G. ROLANDI (CERN) Antimatter in the Lab (2/2) 11:15 - 12:00 O. BrÜning (CERN) Accelerators (4/5) 12:00 Discussion Session Friday 1...

  7. Chinese Student Life.

    Science.gov (United States)

    Braswell, James; Boone, Jerry N.

    1991-01-01

    Places life of university students in China in context of Tiananmen Square and Cultural Revolution, with implications of serving them as students in the United States. Presents basic facts of student life in China. Although the emphasis is on college life, some attention is paid to earlier student experiences as well. (Author/NB)

  8. SAAs: The Student's View.

    Science.gov (United States)

    Olson, Beth

    1992-01-01

    A student member of the University of Nebraska-Lincoln's student alumni association discusses numerous advantages of student participation with alumni, including contacts with campus officials, friendships, valuable networking opportunities, job-hunting assistance, and a sense of loyalty; the characteristics of good student members; and factors in…

  9. Periodic Table of Students.

    Science.gov (United States)

    Johnson, Mike

    1998-01-01

    Presents an exercise in which an eighth-grade science teacher decorated the classroom with a periodic table of students. Student photographs were arranged according to similarities into vertical columns. Students were each assigned an atomic number according to their placement in the table. The table is then used to teach students about…

  10. Students Engaged in Teaching

    Science.gov (United States)

    Ford, Channing R.; Wilkins, Emily B.; Groccia, James E.

    2018-01-01

    The role of peer teaching has long been established in academia as a means to foster student engagement in the classroom, increase student learning, and as a way to reduce faculty workload. This chapter highlights the direct and powerful positive impacts of engaging students as teachers upon the student providing the instruction, those receiving…

  11. University Student Online Plagiarism

    Science.gov (United States)

    Wang, Yu-mei

    2008-01-01

    This article reports a study investigating university student online plagiarism. The following questions are investigated: (a) What is the incidence of student online plagiarism? (b) What are student perceptions regarding online plagiarism? (c) Are there any differences in terms of student perceptions of online plagiarism and print plagiarism? (d)…

  12. College Student Suicide

    Science.gov (United States)

    Taub, Deborah J.; Thompson, Jalonda

    2013-01-01

    Suicide is the second-leading cause of death among college students, and it is estimated that 1,088 college students die by suicide each year (National Mental Health Association and the Jed Foundation, 2002). This chapter presents the context of college student mental health within which the problem of college student suicide is situated. Because…

  13. Motivating Students by Increasing Student Choice

    Science.gov (United States)

    Birdsell, Becky S.; Ream, Sarah M.; Seyller, Ann M.; Zobott, Pam L.

    2009-01-01

    The purpose of this study was to increase motivation in 7th grade students. Four teacher researchers examined the change in motivational levels as a result of choice strategies. They gathered data from four different classes, 101 students in all, to track levels of motivation. They monitored their levels of observable behavioral patterns with a…

  14. Students 'Weigh' Atmospheric Pollution.

    Science.gov (United States)

    Caporaloni, Marina

    1998-01-01

    Describes a procedure developed by students that measures the mass concentration of particles in a polluted urban atmosphere. Uses a portable fan and filters of various materials. Compares students' data with official data. (DDR)

  15. Credentialism among Graduate Students.

    Science.gov (United States)

    Stodt, Martha McGinty; Thielens, Wagner, Jr.

    1985-01-01

    An exploratory study of students entering four elite fields found that most sought both credentials and competence. Stiff competition within chosen occupations led the majority of students to seek every advantage that graduate education could provide. (Author/MLW)

  16. International Student Mental Health

    Science.gov (United States)

    Prieto-Welch, Susan L.

    2016-01-01

    This chapter describes the mental health status of international students in institutions of higher education, unique challenges these students face and their impact on mental health, and suggestions for ways to address these challenges.

  17. Teaching Culturally Diverse Students.

    Science.gov (United States)

    Correa, Vivian; Tulbert, Beth

    1991-01-01

    Characteristics of culturally diverse students are discussed in terms of language, culture, and socioeconomic factors. Meeting the educational needs of culturally diverse students can involve interactive teaming of professionals; parent involvement; and providing appropriate services, assessment, curriculum, and instruction. (JDD)

  18. Student Engagement with Community

    Science.gov (United States)

    Knight-McKenna, Mary; Felten, Peter; Darby, Alexa

    2018-01-01

    Student engagement in the local community comes with both risks and rewards. This chapter explains the cognitive, behavioral, and affective outcomes of student learning in the community, along with noting the importance of preparation and reflection.

  19. Students in Action Initiative

    OpenAIRE

    Ryan, Theresa; Mottiar, Ziene; Quinn, Bernadette; Gorman, Catherine; Griffin, Kevin; Craggs, Ruth; Quinn, Deirdre

    2015-01-01

    The Students in Action Project in the School of Hospitality Management and Tourism was established in 2012 as a way of engaging students and working with stakeholders in a destination. The overall aim of the project was to immerse students in an active collaborative learning environment within the destination to identify ways in which tourism could be enhanced. In the 2014/2015 academic year the project involved over 300 students from a variety of programmes and modules working with local sta...

  20. Students, Butterflies, and Cancer

    Science.gov (United States)

    Marcus, Jeffrey

    2005-01-01

    It is not always easy for a teacher to relate to his or her students. To communicate with students, it is important for a teacher to relate the subject that he or she is trying to teach is something that the students know, or at least to something that the students care about. In this article, the author, a genetics teacher, relates how he used…

  1. Online Learning for Students from Diverse Backgrounds: Learning Disability Students, Excellent Students and Average Students

    Directory of Open Access Journals (Sweden)

    Miri Shonfeld

    2015-09-01

    Full Text Available The perceived contribution of science education online course to pre-service students (N=121 from diverse backgrounds - students with learning disabilities (25 LD students, 28 excellent students and 68 average students is presented in this five years research. During the online course students were asked to choose a scientific subject; to map it and to plan teaching activities; to carry out the proposed activities with students in a classroom experience; and to reflect the process. The assumption was that adapting the online course by using information and communication technology following formative assessment will improve students' self-learning ability as well as broaden their science knowledge, their lab performance and teaching skills. Data were collected using quantitative and qualitative tools including: pre and post questionnaires and nine (three students from each group depth interviews upon completion of the course. Findings, based on students` perceived evaluation, pinpointed on the advantages of the online course for students of the three groups. LD students’ achievements were not inferior to those of their peers, excellent students and average students. Yet, it carefully reports on a slight but explicitly marginal perceived evaluation of the LD students in comparison to excellent students and average students regarding: forum participation, authentic task and water lab performance. The article discusses the affordance of the online course via additional features that can be grouped into two categories: knowledge construction and flexibility in time, interaction and knowledge. Further research is suggested to extend the current study by examine the effect of other courses and different contents and by considering various evaluation methods of online courses, such as: observation, the think aloud, text and tasks analysis, and reflection.

  2. Students' Differentiated Translation Processes

    Science.gov (United States)

    Bossé, Michael J.; Adu-Gyamfi, Kwaku; Chandler, Kayla

    2014-01-01

    Understanding how students translate between mathematical representations is of both practical and theoretical importance. This study examined students' processes in their generation of symbolic and graphic representations of given polynomial functions. The purpose was to investigate how students perform these translations. The result of the study…

  3. Learning from Student Data

    Science.gov (United States)

    Pruitt, Kobie

    2016-01-01

    Just as adults' personal lives and data are increasingly inhabiting online spaces, so are students. While this shift brings many benefits and the possibility of learning tailored to individual students' needs, it is also brings new challenges. Students create an electronic trail of information that creates an obvious concern: How can they enjoy…

  4. Together in student success

    African Journals Online (AJOL)

    Journal of Student Affairs in Africa | Volume 2 (1) 2014, v–vi | 2307-6267 | DOI: 10.14426/jsaa.v2i1.45. I have had two opportunities to ... student affairs staff, as well as faculty and students, at a number of universities, including. Stellenbosch University, the .... The role of research and scholarship in the professionalisation of ...

  5. Rules of (Student) Engagement

    Science.gov (United States)

    Buskist, William; Busler, Jessica N.; Kirby, Lauren A. J.

    2018-01-01

    Teachers often think of student engagement in terms of hands-on activities that get students involved in their courses. They seldom consider the larger aspects of the teaching--learning environment that often influence the extent to which students are willing to become engaged in their coursework. In this chapter, we describe five "rules of…

  6. Students Engaged in Learning

    Science.gov (United States)

    Ismail, Emad A.; Groccia, James E.

    2018-01-01

    Engaging students in learning is a basic principle of effective undergraduate education. Outcomes of engaging students include meaningful learning experiences and enhanced skills in all learning domains. This chapter reviews the influence of engaging students in different forms of active learning on cognitive, psychomotor, and affective skill…

  7. School Students' Leisure.

    Science.gov (United States)

    Bozhenko, Liudmila Fedorovna

    1990-01-01

    Reports on a survey involving 700 students and 300 parents in Volgodonsk, Russia. Itemizes types of leisure activities and hours per week of leisure time enjoyed by students and examines amount of organized leisure. Notes that television viewing consumed much of students' leisure time. Underscores parents' critical influence in determining student…

  8. Federal Student Loan Programs

    Science.gov (United States)

    Federal Student Aid, US Department of Education, 2014

    2014-01-01

    For those needing a loan to attend college, think federal aid first. Federal student loans usually offer borrowers lower interest rates and have more flexible repayment terms and options than private student loans. This brief report answers the following questions about federal aid: (1) What is a federal student loan?; (2) What is a private…

  9. Mobile Student Information System

    Science.gov (United States)

    Asif, Muhammad; Krogstie, John

    2011-01-01

    Purpose: A mobile student information system (MSIS) based on mobile computing and context-aware application concepts can provide more user-centric information services to students. The purpose of this paper is to describe a system for providing relevant information to students on a mobile platform. Design/methodology/approach: The research…

  10. How students use Facebook

    NARCIS (Netherlands)

    Wesseling-Weijers, N.F.

    2012-01-01

    This study investigates the way in which first year students use Facebook. An overview of recent studies on Facebook usage and a survey is presented. The latter is an online questionnaire on the Facebook activities of 618 students (78.6 % of all first year students) of the Media department of

  11. Measures of Student Growth

    Science.gov (United States)

    Texas Education Agency, 2016

    2016-01-01

    Beginning in the 2017-2018 school year, appraisal systems in Texas, whether the state-recommended system or a locally developed system, will need to include a measure of student growth at the individual teacher level. Student growth measures how much a student progresses academically during his or her time with a particular teacher. It takes into…

  12. Becoming a smart student

    DEFF Research Database (Denmark)

    Lundqvist, Ulla

    English abstract When teachers and students interact in everyday academic activities, some students are ascribed social roles as “smart”, which lead other students to contest these roles. Such struggles around what it means to be smart and which students come to be viewed as smart are a pertinent...... as smart and favoured by the teacher are at risk of being ostracized by peers, of encountering greater pressure for classroom performance and of suffering reduced learning opportunities. The study inspires teachers to create wiggle room for their students by becoming aware of the conventional definitions...

  13. Supporting Transparency between Students

    DEFF Research Database (Denmark)

    Dalsgaard, Christian

    The paper presents the results of a case study that explores the potentials of weblogs and social bookmarking to support transparency in a university course. In the course, groups of students used weblogs and social bookmarking in their work. The objective of the case was to empower students...... by providing them with tools that would be visible to the other students in the course, thus, making students’ ideas, thoughts and questions visible to the other students in the course. The paper concludes that use of digital media for transparency can support empowerment of students and inspiration among...... students in a course, but that the challenge is to create a balance between personal tools and tools for collaborative group work that are also suitable for transparency between students....

  14. THE LINK BETWEEN STUDENTS' SATISFACTION WITH FACULTY, OVERALL STUDENTS' SATISFACTION WITH STUDENT LIFE AND STUDENT PERFORMANCES

    Directory of Open Access Journals (Sweden)

    Zoran Mihanović

    2016-03-01

    Full Text Available Customer satisfaction has long been recognized as a central concept of all business activities. Satisfaction can serve as an indicator of success of the company, both in the past and present, as well as an indicator of future performance. High quality service to students is a prerequisite of maintaining competitiveness in the market of higher education. A relationship that is created between the expectations of students and their satisfaction with the quality of service that provides educational institution plays an important role in shaping the reputation of academic institutions. Academic institutions are becoming aware of the importance of student satisfaction, because satisfaction positively influences their decision to continue their education at this institution, and the positive word of mouth that will attract prospective students. Satisfaction will affect student motivation, and therefore their performance. This paper provides insight into the marketing aspects of customer satisfaction, primarily insight into the satisfaction of students in the educational sector. The aim is to establish the influence of satisfaction various factors related to the university and higher education to the satisfaction of student life, and does student life satisfaction affect the overall happiness and student performance. The research was conducted on the student population of the University of Split, on a sample of 191 respondents. The research was conducted with the help of online survey questionnaire. The claim that student’s satisfactions with housing affect the satisfaction with the quality of student life is rejected. The results confirmed that the student’s satisfaction with university contents, university bodies and services, teaching, teaching methods and academic reputation affects the satisfaction of student life and student life satisfaction affect the student performance.

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1| unnamed protein product [Mus musculus] gb|EAW65549.1| non imprinted in Prader-Willi/Angelman syndrome 1, ...isoform CRA_a [Homo sapiens] gb|EAW65551.1| non imprinted in Prader-Willi/Angelman syndrome 1, isoform CRA_a... [Homo sapiens] gb|ABM82178.1| non imprinted in Prader-Willi/Angelman syndrome 1 ...[synthetic construct] gb|ABM85364.1| non imprinted in Prader-Willi/Angelman syndrome 1 [synthetic construct] CAD97953.1 1e-113 81% ...

  16. Sara Lipton in Conversation with Eva Janáčová. [Interview

    Czech Academy of Sciences Publication Activity Database

    Janáčová, Eva; Lipton, S.

    2017-01-01

    Roč. 65, č. 1 (2017), s. 66-70 ISSN 0049-5123 Institutional support: RVO:68378033 Keywords : Judaism * Middle Ages * art Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Arts, Art history

  17. Low energy neutral atom imaging on the Moon with the SARA ...

    Indian Academy of Sciences (India)

    (LENA) imaging mass spectrometer, which will perform remote sensing of the lunar surface via detection of neutral atoms in the energy range from 10eV to 3keV from a 100km polar orbit. ..... as studying the existence of ion void regions around.

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1549 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndent protein export [Herminiimonas arsenicoxydans] emb|CAL63167.1| twin-arginine translocase subunit, sec-i...ndependent protein export [Herminiimonas arsenicoxydans] YP_001101288.1 2.0 37% ...

  19. The State Authorization Reciprocity Agreement (SARA): A Good Idea Whose Time Has Come

    Science.gov (United States)

    Longanecker, David; Hill, Marshall A.

    2014-01-01

    In this article the authors argue that states need a new way to oversee the delivery of postsecondary distance education across state borders. They assert that the current process is too spotty to assure consistent consumer protection and too cumbersome and expensive for institutions. Because education is not specified in the US Constitution as a…

  20. Becoming a Smart Student

    DEFF Research Database (Denmark)

    Lundqvist, Ulla

    identification” and “participation framework”. Methodologically, the study is based on three years of linguistic ethnographic fieldwork in a public primary school in Copenhagen and with students and their families. This study documents -in broad ethnographic scope and interactional detail -how smart student...... through future explorations of children’s academic trajectories in and out of school, and on how those trajectories often become linked to the trajectories of siblings, vis-à-vis institutional conceptions of smartness.......When teachers and students interact in everyday academic activities, some students are ascribed social roles as “smart”, which lead other students to contest these roles. Such struggles around what it means to be smart and which students come to be viewed as smart are a pertinent problem...

  1. School Liability: Student to Student Injuries Involving Students with Disabilities.

    Science.gov (United States)

    Bettenhausen, Sherrie

    In the absence of immunity, courts have held schools and school personnel liable for personal injury by a student with a disability that resulted from negligent failure to provide a reasonable safe environment, failure to warn of known hazards, or failure to provide adequate supervision. Case law is presented to demonstrate the extent that school…

  2. Stress in Nursing Students

    Directory of Open Access Journals (Sweden)

    Sofia Zyga

    2013-01-01

    Full Text Available Throughout a Nursing academic course, students are confronted by situations that generate stress. Students from professionalizing Nursing courses are especially demanded at practical skills, such asperforming invasive procedures with venous punctures, bandaging, hygiene, and comfort care in patients with different degrees of illness. For these students, stress levels may render learning difficulty with the possibility of leading to errors, lack of concentration and oscillation of attention levels.

  3. The Student Plan

    DEFF Research Database (Denmark)

    Krejsler, John B.

    2009-01-01

    that must reconcile the challenges of student diversity, differentiated teaching, the documentation of achievement and so forth. Social technologies reduce complexity by coding procedures, thus signalling what is expected in terms of learning activities, and by coding subject positions, thereby guiding...... teachers and students in terms of the roles they may position themselves in. Some of the most prevalent social technologies adopted by schools today include project work, logbooks, social contracts, interactive testing, and student and personal action plans....

  4. Comparing Community College Student and Faculty Perceptions of Student Engagement

    Science.gov (United States)

    Senn-Carter, Darian

    2017-01-01

    The purpose of this quantitative study was to compare faculty and student perceptions of "student engagement" at a mid-Atlantic community college to determine the level of correlation between student experiences and faculty practices in five benchmark areas of student engagement: "academic challenge, student-faculty interaction,…

  5. Fieldwork students under stress.

    Science.gov (United States)

    Yuen, H K

    1990-01-01

    Many times there are no ideal answers to any of the interpersonal conflicts addressed. Often the solutions to these situations may depend on an individual's characteristics or personality. By analyzing the situation and the supervisor's attitude and then changing his or her way of responding to that situation, however, the student may improve his or her problem-solving skills. The student can modify the strategies taught in these seminars to suit his or her individual needs and particular situations. A seminar like this can provide students, and thus future therapists and student supervisors, with a solid background in dealing more tactfully with a variety of conflict-ridden situations in the workplace.

  6. Maslow's Hierarchy and Student Retention.

    Science.gov (United States)

    Brookman, David M.

    1989-01-01

    Abraham Maslow's hierarchy of needs offers perspective on student motivation and a rationale for college retention programing. Student affairs and faculty interventions addressing student safety needs and engaging students' sense of purpose reinforce persistence. A mentor program is a possible cooperative effort between student personnel and…

  7. Taking Advantage of Student Engagement Results in Student Affairs

    Science.gov (United States)

    Kinzie, Jillian; Hurtado, Sarah S.

    2017-01-01

    This chapter urges student affairs professionals committed to enhancing student success through data-informed decision making to take full advantage of opportunities to apply and use student engagement results.

  8. Asian American Student Engagement in Student Leadership and Activism

    Science.gov (United States)

    Manzano, Lester J.; Poon, OiYan A.; Na, Vanessa S.

    2017-01-01

    Conceptual models for understanding the ways in which Asian American students engage in leadership and activism are interrogated. The chapter provides a discussion of implications for student affairs professionals working with Asian American student leaders and activists.

  9. Student figures in friction

    DEFF Research Database (Denmark)

    Nielsen, Gritt B.

    , students' room for participation in their own learning, influenced by demands for efficiency, flexibility and student-centred education. The thesis recasts the anthropological endeavour as one of ‘figuration work'. That is, ‘frictional events' are explored as moments when conflicting figures...

  10. Considering Student Coaching

    Science.gov (United States)

    Keen, James P.

    2014-01-01

    What does student coaching involve and what considerations make sense in deciding to engage an outside contractor to provide personal coaching? The author explores coaching in light of his own professional experience and uses this reflection as a platform from which to consider the pros and cons of student coaching when deciding whether to choose…

  11. Dental Hygiene Student Attrition.

    Science.gov (United States)

    Young, Lynda J.; Fellows, Avis L.

    1981-01-01

    A study to determine differences between graduating and withdrawing students in the University of Minnesota Dental Hygiene program is discussed. The identification of differences may prove useful in the selection process for future classes through identification of students likely to complete their education. (MLW)

  12. Welding. Student Learning Guide.

    Science.gov (United States)

    Palm Beach County Board of Public Instruction, West Palm Beach, FL.

    This student learning guide contains 30 modules for completing a course in welding. It is designed especially for use in secondary schools in Palm Beach County, Florida. Each module covers one task, and consists of a purpose, performance objective, enabling objectives, learning activities keyed to resources, information sheets, student self-check…

  13. Automated Student Model Improvement

    Science.gov (United States)

    Koedinger, Kenneth R.; McLaughlin, Elizabeth A.; Stamper, John C.

    2012-01-01

    Student modeling plays a critical role in developing and improving instruction and instructional technologies. We present a technique for automated improvement of student models that leverages the DataShop repository, crowd sourcing, and a version of the Learning Factors Analysis algorithm. We demonstrate this method on eleven educational…

  14. Theme: Motivating Students.

    Science.gov (United States)

    Gartin, Stacy A.; And Others

    1993-01-01

    Includes "How Do I Turn Your Crank to Get You Going?" (Gartin); "How Do You Say 'I Don't Know' and Not Feel Guilty?" (Dickson); "Basics of Motivation" (Rankin); "Challenge to Lead Motivates Students" (D'Haem, Krueger); "Don't Just Tell Me, Teach Me!" (Custer, Leugers); "The 'I' in Motivation" (Woody); and "Student Self Discipline Scale" (Coffman).…

  15. Listening to Students

    Science.gov (United States)

    Phillips, Vicki

    2013-01-01

    Good teaching involves knowing the course content and how to teach it; building a strong, trusting relationship with students; setting and supporting high expectations; and continually monitoring students' understanding and adjusting instruction accordingly. Of course, those things must be done while maintaining classroom control and managing…

  16. International Student Success

    Science.gov (United States)

    Smith, Clayton

    2016-01-01

    This article, with a focus on North American postsecondary education, identifies international students as a strategic enrollment management institutional priority; presents themes in the international student retention, satisfaction, and success research literature; and describes related best practices. It also presents the findings from an…

  17. Giving Students the Business.

    Science.gov (United States)

    Brown, Dan

    1995-01-01

    Examples of school-based enterprises in Kentucky illustrate how schools can provide vital work-based learning experiences for high school students. The necessity of exposing students to career opportunities as early as possible and of developing empathy between teachers and employers is stressed. (SK)

  18. Sexual Harassment of Students.

    Science.gov (United States)

    Elgart, Lloyd D.; Schanfield, Lillian

    1991-01-01

    Sexual harassment in American higher education is currently a problem of ethics and morals rather than of law. Any meaningful remedy for the student victim must be created and implemented by the institution, because courts, legislatures, and administrative agencies do not offer a remedy to student victims of sexual harassment. (MSE)

  19. Eliciting Student-Talk.

    Science.gov (United States)

    Rudder, Michael E.

    1999-01-01

    The communicative approach to language instruction emphasizes ways to increase student-talk and decrease teacher-talk. It necessitates including the production or performance stage in lesson plans to give students the opportunity to use the new language in simulated real-life situations. (Author/VWL)

  20. The students' voice

    DEFF Research Database (Denmark)

    Jørgensen, Frances

    2004-01-01

    The article presents data collected from interviews with students at Aalborg University in relation to their experiences working with the problem-based and project-organized (PBL) approach.......The article presents data collected from interviews with students at Aalborg University in relation to their experiences working with the problem-based and project-organized (PBL) approach....

  1. Sexting and Student Discipline

    Science.gov (United States)

    O'Donovan, Eamonn

    2010-01-01

    Cell phones are ubiquitous on campus, and the anytime anywhere nature of teenage communications means that students see no separation between life inside and outside of school, at least when it comes to activities such as texting. Allowing cell phones on campus will have students in possession of cell phones with sexually oriented messages,…

  2. Student Problems with Documentation.

    Science.gov (United States)

    Freimer, Gloria R.; Perry, Margaret M.

    1986-01-01

    Interviews with faculty, a survey of 20 students, and examination of style manuals revealed that students are confused by inconsistencies in and multiplicity of styles when confronted with writing and documenting a research paper. Librarians are urged to teach various citation formats and work for adoption of standardization. (17 references) (EJS)

  3. Gamification and Student Motivation

    Science.gov (United States)

    Buckley, Patrick; Doyle, Elaine

    2016-01-01

    The literature suggests that gamified learning interventions may increase student engagement and enhance learning. We empirically investigate this by exploring the impact of intrinsic and extrinsic motivation on the participation and performance of over 100 undergraduate students in an online gamified learning intervention. The paper makes a…

  4. Helping Students Avoid Plagiarism.

    Science.gov (United States)

    Wilhoit, Stephen

    1994-01-01

    Discusses how and why college students commit plagiarism, suggesting techniques that instructors can use to help student avoid plagiarism. Instructors should define and discuss plagiarism thoroughly; discuss hypothetical cases; review the conventions of quoting and documenting material; require multiple drafts of essays; and offer responses…

  5. Plagiarism explainer for students

    OpenAIRE

    Barba, Lorena A.

    2016-01-01

    A slide deck to serve as an explainer of plagiarism in academic settings, with a personal viewpoint. For my students.Also on SpeakerDeck:https://speakerdeck.com/labarba/plagiarism-explainer-for-students(The slide viewer on SpeakerDeck is much nicer.)

  6. Symposium: Student Life

    Science.gov (United States)

    Academic Questions, 2010

    2010-01-01

    To get an inside view of campus life today, the Intercollegiate Studies Institute (whose purpose is to foster in college students an appreciation of the values that sustain a free society) was approached and asked to supply a list of their Collegiate Network editors--students who are active on their campuses, interested in the issues facing higher…

  7. EKG Student Workbook.

    Science.gov (United States)

    Webb, Sandra M.

    This student workbook is designed to assist advanced medical-surgical nursing students in understanding and making electrocardiographic (EKG) interpretations. Addressed in the seven units of the workbook are the following topics: EKG indicators, EKG ruled paper divisions, the normal cardiac cycle and pathophysiology, abnormal cardiac waves, atrial…

  8. The Student Perspective.

    Science.gov (United States)

    Oltmanns, Gail V.

    1995-01-01

    Addresses the students' perspective of library employment. Discusses a study conducted at the University of Virginia (1987) on student attitudes and library employment practices, and provides 12 recommendations for better management. Also notes the implication of part-time work, the importance of using performance measures, and the benefits of…

  9. Student Participation in Governance

    Science.gov (United States)

    Deegan, William L.; And Others

    1970-01-01

    The success of student government activities on any campus is significantly affected by the amount of student participation permitted in the institution's decision-making processes. The traditional" model of government--characterized by tokenism--often results in the separate jurisdictions" model-- characterized by fragmentation and interest…

  10. Entrepreneurship and Student Motivation

    Science.gov (United States)

    Vorholt, Julie; Harris, Erica

    2014-01-01

    This article describes a three-week project-based unit on entrepreneurship conducted with students in communications classes in an Academic English context. A detailed road map of the project is given, starting with an introduction and ending with final presentations and poster sessions. Students were motivated by their own interests in business…

  11. Improving Student Behavior.

    Science.gov (United States)

    Green, Pamela; Gilbert, Janice T.

    This report describes a program for improving the behavior of seventh and eighth grade students with learning disabilities in a self-contained classroom setting. Analysis of probable causes revealed that students demonstrated a lack of problem-solving skills, showed a low frustration tolerance, and exhibited poor self-concepts. Two major…

  12. Connecting with Today's Students

    Science.gov (United States)

    Spanier, Graham B.

    2009-01-01

    The Kellogg Commission on the Future of State and Land-Grant Universities released "Returning to Our Roots: The Student Experience," which found "a critical need to reform undergraduate education" and to "focus on universities as genuine learning communities" that put students first. As chair of the Kellogg Commission, the author embraced that…

  13. Improving Student Question Classification

    Science.gov (United States)

    Heiner, Cecily; Zachary, Joseph L.

    2009-01-01

    Students in introductory programming classes often articulate their questions and information needs incompletely. Consequently, the automatic classification of student questions to provide automated tutorial responses is a challenging problem. This paper analyzes 411 questions from an introductory Java programming course by reducing the natural…

  14. Empowering Students through Literature.

    Science.gov (United States)

    Cukras, Grace-Ann Gorga

    2000-01-01

    A literary club formed a community of readers among underserved and nontraditional community college students. Members meet to discuss literature and host authors' visits. The environment enables students to share their perspectives and develop deeper understanding of literature and of themselves. (SK)

  15. Administrators Confront Student "Sexting"

    Science.gov (United States)

    Manzo, Kathleen Kennedy

    2009-01-01

    Cellphone-savvy students have created instructional and disciplinary challenges for educators for years. But the recent emergence of "sexting" by adolescents over their mobile phones caught many school administrators off guard, and the practice is prompting efforts around the country to craft policy responses. Students' sharing of nude or…

  16. Stress Among Dental Students

    NARCIS (Netherlands)

    A.M. Alzahem (Abdullah)

    2015-01-01

    markdownabstractAbstract Dental students are facing many stressors in dental education, causing many negative outcomes. The most common are the exams and the clinical requirements. We suggest exposing the dental students to patient care as early as possible in their curriculum. This can help to

  17. Teaching Millennial Students

    Science.gov (United States)

    Nikirk, Martin

    2012-01-01

    The "Millennial Generation" includes students enrolled in primary grades through high school. These students are also known as Digital Natives, Generation Why, the Net Generation, Generation Me, and i-Kids. The generation includes ages ranging from approximately 7 to 30. This is the generation who have always had technology integrated into their…

  18. Student Engagement with Feedback

    Science.gov (United States)

    Scott, Jon; Shields, Cathy; Gardner, James; Hancock, Alysoun; Nutt, Alex

    2011-01-01

    This report considers Biological Sciences students' perceptions of feedback, compared with those of the University as a whole, this includes what forms of feedback were considered most useful and how feedback used. Compared with data from previous studies, Biological Sciences students gave much greater recognition to oral feedback, placing it on a…

  19. Pregnant Field Students' Guilt

    Science.gov (United States)

    Baum, Nehami

    2006-01-01

    This study examined guilt feelings among social work students who were pregnant for the first time during field work training. Semi-structured interviews were conducted either in the 9th month (n=5) or 2-12 months after delivery (n=5). Content analysis revealed 6 main triggers, illustrated by excerpts, which stimulated field students' guilt…

  20. Medical Students Raising Concerns.

    Science.gov (United States)

    Druce, Maralyn R; Hickey, Andrea; Warrens, Anthony N; Westwood, Olwyn M R

    2016-09-16

    After a number of high-profile incidents and national reports, it has become clear that all health professionals and all medical students must be able to raise concerns about a colleague's behavior if this behavior puts patients, colleagues, or themselves at risk.Detailed evidence from medical students about their confidence to raise concerns is limited, together with examples of barriers, which impair their ability to do so. We describe a questionnaire survey of medical students in a single-center, examining self-reported confidence about raising concerns in a number of possible scenarios. Thematic analysis was applied to comments about barriers identified.Although 80% of respondents felt confident to report a patient safety issue, students were less confident around issues of probity, attitude, and conduct. This needs to be addressed to create clear mechanisms to raise concerns, as well as support for students during the process.

  1. CBI students: target hit!

    CERN Multimedia

    CERN Bulletin

    2015-01-01

    The students on the third Challenge Based Innovation (CBI) @CERN course have been working on their society-oriented projects since September. Last Thursday, 10 December, they finally presented all their proofs-of-concept and prototypes to a packed audience at IdeaSquare.   CBI students presenting their projects at IdeaSquare (Image: Carlos Yarza/IED Barcelona). Twenty-seven students from four universities and over ten countries have been working on the CERN CBI course since last September. Labour mobility, food safety, literacy and water safety are the four projects that the students have been working on. Thanks to help and inspiration from a wide range of people working at CERN, especially in the Knowledge Transfer group, the students have redefined and focused their original challenges and have developed four concepts to solve societal challenges: * Team Bohr developed a concept for encouraging labour mobility and talent exchange in Europe, combining data analysis and existing online ...

  2. [Homophobia among nursing students].

    Science.gov (United States)

    Campo-Arias, Adalberto; Herazo, Edwin; Cogollo, Zuleima

    2010-09-01

    Homophobia is defined as a general negative attitude towards homosexual persons, with implications on public health. This fact has been less investigated among nursing students. The objective of this review was to learn about the prevalence of homophobia and its associated variables among nursing students. A systematic review was performed on original articles published in EBSCO, Imbiomed, LILACS, MEDLINE, Ovid, and ProQuest, including articles published between 1998 and 2008 in English, Portuguese and Spanish. Keywords used were homophobia, homosexuality, and nursing students. Descriptive analysis was performed. Eight studies were analyzed. The incidence of homophobia in nursing students is between 7% and 16%. Homophobia is more common among males and religious conservatism people. Homophobia is quite frequent in nursing students. This negative attitude toward homosexuality may affect services and care giving by nursing professions and could have negative implications in nursing practice.

  3. Engineering students' sustainability approaches

    Science.gov (United States)

    Haase, S.

    2014-05-01

    Sustainability issues are increasingly important in engineering work all over the world. This article explores systematic differences in self-assessed competencies, interests, importance, engagement and practices of newly enrolled engineering students in Denmark in relation to environmental and non-environmental sustainability issues. The empirical base of the article is a nation-wide, web-based survey sent to all newly enrolled engineering students in Denmark commencing their education in the fall term 2010. The response rate was 46%. The survey focused on a variety of different aspects of what can be conceived as sustainability. By means of cluster analysis, three engineering student approaches to sustainability are identified and described. The article provides knowledge on the different prerequisites of engineering students in relation to the role of sustainability in engineering. This information is important input to educators trying to target new engineering students and contribute to the provision of engineers equipped to meet sustainability challenges.

  4. Researching with undergraduate students

    DEFF Research Database (Denmark)

    Wulf-Andersen, Trine Østergaard; Mogensen, Kevin; Hjort-Madsen, Peder

    2013-01-01

    The article presents a particular case of undergraduate students working on subprojects within the framework of their supervisors' (the authors') research project during Autumn Semester 2012 and Spring Semester 2013. The article's purpose is to show that an institutionalized focus on students...... as "research learners" rather than merely curriculum learners proves productive for both research and teaching. We describe the specific university learning context and the particular organization of undergraduate students' supervision and assistantships. The case builds on and further enhances a well......-established and proven university model of participant-directed, problem-oriented project work. We explore students' and researchers' experiences of being part of the collaboration, focusing on learning potentials and dilemmas associated with the multiple roles of researcher and student that characterized...

  5. Student Trust in Teachers and Student Perceptions of Safety: Positive Predictors of Student Identification with School

    Science.gov (United States)

    Mitchell, Roxanne M.; Kensler, Lisa; Tschannen-Moran, Megan

    2018-01-01

    This study examined the effects of student trust in teacher and student perceptions of safety on identification with school. Data were collected from one large urban district in an eastern state. Participants included 5441 students in 3rd through 12th grades from 49 schools. Students responded to surveys that assessed student trust in teachers,…

  6. The Healthy College Student

    Directory of Open Access Journals (Sweden)

    Virginia Adams O’Connell PhD

    2014-08-01

    Full Text Available Studies on the impact of health behaviors on morbidity often focus on the limited impact of a single behavior or a limited group of behaviors. In this study, we examine college student behaviors and investigate the link of these behaviors with a 2-week illness profile. Through self-reported surveys, we measure acute illness and a general illness burden, a cumulative measure of major and minor ailments. We explore how daily routines correlate with these illness measures. Eighty-four students from a random sample of 90 students attending a small liberal arts school completed the survey for a response rate of 93%. Living arrangements, exercise, sleep patterns, eating preferences and habits, and “social” behaviors were all significantly associated with illness burden. Students living in “singles” and those who got regular exercise and an average of 7 hr of sleep per night reported less illness. Most interesting is the effect of social behaviors. Students who greet others with a handshake reported higher illness rates, as did students who share food and/or drinks. While we can conceptualize why these behaviors would lead to a greater illness burden, students who engaged more frequently in these behaviors also reported being “happier.” In trying to reduce illness among college students, we might suggest less handshaking and food and beverage sharing, but these actions are ways in which college students express and maintain friendships. College administrators are challenged to discover ways to reduce illness while maintaining the positive aspects of local student culture. This study begins to explore some ways to balance health and camaraderie.

  7. Scrapping of student bursaries confirmed.

    Science.gov (United States)

    Longhurst, Chris

    2016-07-27

    Student bursaries for nurses will be scrapped from next year, the government has confirmed. Undergraduate nursing and midwifery students in England will now face tuition fees and student loans from August 2017.

  8. Student Attitudes Toward Mental Illness

    Science.gov (United States)

    Hare-Mustin, Rachel T.; Garvine, Richard

    1974-01-01

    Inquiry into the initial attitudes toward mental illness of students taking an abnormal psychology class indicates students' concerns and preconceptions and provides a basis for shaping the course to respond to student needs. (JH)

  9. Students fall for Fall Meeting

    Science.gov (United States)

    Smedley, Kara

    2012-02-01

    From Boston to Beijing, thousands of students traveled to San Francisco for the 2011 AGU Fall Meeting. Of those who participated, 183 students were able to attend thanks to AGU's student travel grant program, which assists students with travel costs and seeks to enrich the meeting through ethnic and gender diversity. Students at Fall Meeting enjoyed a variety of programs and activities designed to help them better network with their peers, learn about new fields, and disseminate their research to the interested public. More than 800 students attended AGU's first annual student mixer, sharing drinks and ideas with fellow student members and future colleagues as well as forging new friendships and intellectual relationships.

  10. Fourth Doctoral Student Assembly

    CERN Multimedia

    Ingrid Haug

    2016-01-01

    On 10 May, over 130 PhD students and their supervisors, from both CERN and partner universities, gathered for the 4th Doctoral Student Assembly in the Council Chamber.   The assembly was followed by a poster session, at which eighteen doctoral students presented the outcome of their scientific work. The CERN Doctoral Student Programme currently hosts just over 200 students in applied physics, engineering, computing and science communication/education. The programme has been in place since 1985. It enables students to do their research at CERN for a maximum of three years and to work on a PhD thesis, which they defend at their University. The programme is steered by the TSC committee, which holds two selection committees per year, in June and December. The Doctoral Student Assembly was opened by the Director-General, Fabiola Gianotti, who stressed the importance of the programme in the scientific environment at CERN, emphasising that there is no more rewarding activity than lear...

  11. Empowering Students in Transition

    Directory of Open Access Journals (Sweden)

    Ann-Catherine Sullivan

    2016-09-01

    Full Text Available The purpose of this study was to (a identify potential benefits for students with disabilities taking part in a physical activity program with same-age typical peers on a Midwest university campus, and (b to determine if the program impacted the students with disabilities empowerment. Empowerment theory was used to determine how transition students’ attitudes change over the course of the semester while participating in a workout buddy program with same-age college peers. The program was structured to provide a sense of empowerment to students to make their own decisions and learn for themselves so they don’t feel a lack of power in their lives. This study implemented elements of a quantitative design but a majority utilized a qualitative design based on the assumptions of the Interpretivist paradigm. The quantitative design elements focused on the analysis of two questionnaires: Sports Questionnaire; and The Perceived Control Scale Questionnaire. The analysis of the focus group data revealed the following themes as positive effects of the intervention; positive effect on empowerment, how happy the program made the students, what benefits the students gained from the program, the student’s familiarity with university students, and the environment and lastly the students ability to ask for assistance when need. Findings from the study determined that the empowerment of the students with disabilities was impacted while participating in the program. In general, the findings of gaining empowerment were similar to previous studies in that students with disabilities are able to gain empowerment from participation in fitness and recreation programs. The researcher noted during focus groups that some of the BOBW students were not confident in starting conversations with their university. Although the BOBW students felt a sense of losing empowerment with this specific instance, there was an overall positive impact on the BOBW students

  12. Cobol for students

    CERN Document Server

    Parkin, Andrew

    1995-01-01

    COBOL for Students has established itself as one of the most successful teaching texts on COBOL programming and is now in its fourth edition. The first part of the book concentrates on the fundamentals of the language and takes students to the point where they can write modestly sized programs using sequential files. Part two assumes competence in elementary COBOL and explains design and other programming techniques which should be part of the professional programmer's repertoire. Part three extends the student's knowledge of the language by explaining some of the more advanced features of COB

  13. ISEF Students 2016

    CERN Multimedia

    Purcell, Andrew Robert

    2016-01-01

    From 11 to 17 June, CERN hosted the 10 young students who won the CERN Special Award at the Intel International Science and Engineering Fair (ISEF) 2016). These winners were selected from the 1700 high-school students who participated in the competition. The competition, which is a programme of the Society for Science and the Public, is the world's largest pre-university science competition. It offers high school students from across the globe a chance to showcase their research into a range of fields.

  14. Solar Heliospheric and INterplanetary Environment (SHINE) Students - Student Representatives' Perspectives

    Science.gov (United States)

    Pahud, D. M.; Niembro, T.

    2014-12-01

    The SHINE workshop is an annual meeting of solar and heliospheric scientists which, in addition to aiming to improve understanding of solar disturbances and their propagation to, and effect, on the Earth (shinecon.org), is dedicated to actively supporting students. This dedication is substantiated in part through the National Science Foundation (NSF) providing funding for student attendance to the workshop, which enables student participation. Another example of SHINE's commitment to its student members is the incorporation of a Student Day prior to the workshop since 2003, entirely organized and run by two student representatives. While there are variations in format from year to year, Student Day consists of tutorials and research talks exclusively by student volunteers to an audience of only students. The day is intended to provide a low-stress environment for students to learn about the various topics addressed during the workshop, to ask questions freely, and to engage in scientific discussion with other students which hopefully is a catalyst for collaboration. As a result of positive experiences, over the past decade student attendance and participation in the workshop have increased. At the SHINE 2014 workshop, nearly a third of attendees were students. SHINE student visibility has increased over the years, with student posters being advertised at breakfast, inclusion of a student day summary by the student representatives during a plenary session, and continued support from the steering committee. Students are also promoting a broader impact of SHINE sciences via increased social media presence. From a student representative's perspective, SHINE has built and fostered a healthy student community and encourages students to engage in shaping the future of the field.

  15. Using Student Scholarship To Develop Student Research and Writing Skills.

    Science.gov (United States)

    Ware, Mark E.; Badura, Amy S.; Davis, Stephen F.

    2002-01-01

    Focuses on the use of student publications in journals as a teaching tool. Explores the use of this technique in three contexts: (1) enabling students to understand experimental methodology; (2) teaching students about statistics; and (3) helping students learn more about the American Psychological Association (APA) writing style. (CMK)

  16. The Relationship between Student Engagement and Professionalism in Pharmacy Students

    Science.gov (United States)

    Flaherty, Anne Guerin

    2011-01-01

    This study investigates the relationship between student engagement (as measured by the National Survey of Student Engagement benchmarks) and pharmacy student professionalism (as measured by the Pharmacy Professionalism Domain instrument) in first and third year pharmacy students at seven different schools of pharmacy. Engagement provides the…

  17. Collective Student Trust: A Social Resource for Urban Elementary Students

    Science.gov (United States)

    Adams, Curt M.

    2014-01-01

    Purpose: The purpose of this study was to determine if collective student trust functions as a resource for urban elementary students. Methods: Data from 1,646 students nested in 56 elementary schools in an urban school district were used to test the hypothesized effect of collective student trust on school identification, self-regulated…

  18. The Metaphorical Student.

    Science.gov (United States)

    Carger, Chris Liska

    1996-01-01

    The "patient" metaphor still thrives in teaching. Carl Rogers' concept of client, connoting a collaborative rather than directive relationship, may be more useful to conceptualize the relationship between teachers and students. (SK)

  19. What Is Student Engagement?

    Science.gov (United States)

    Groccia, James E.

    2018-01-01

    This chapter reviews the history and various definitions of student engagement and proposes a multidimensional model from which one can develop a variety of engagement opportunities that lead to a rich and challenging higher education experience.

  20. Student interaction in workshops

    DEFF Research Database (Denmark)

    Evers, Winie

    2014-01-01

    A kind of teaching for active learning has been experimented with at SDU Sønderborg as part of the course Supply Chain Dynamics. In this course the students learn about complex systems, system dynamics as well as supply chain instability and oscillation, the course lecturer invited the author...... to experiment with novel workshop methods and techniques, where objects are used to illustrate and model business issues (Heinemann et al, 2011, Buur et al, 2013). The idea was to see how students could be engaged in a different and more interactive way to learn about these topics, by assigning the students...... teaching should reflect this diversity by embracing and experimenting with multiple forms, including activation of students by students’ interaction and manipulation with objects....

  1. Organizing Independent Student Work

    Directory of Open Access Journals (Sweden)

    Zhadyra T. Zhumasheva

    2015-03-01

    Full Text Available This article addresses issues in organizing independent student work. The author defines the term “independence”, discusses the concepts of independent learner work and independent learner work under the guidance of an instructor, proposes a classification of assignments to be done independently, and provides methodological recommendations as to the organization of independent student work. The article discusses the need for turning the student from a passive consumer of knowledge into an active creator of it, capable of formulating a problem, analyzing the ways of solving it, coming up with an optimum outcome, and proving its correctness. The preparation of highly qualified human resources is the primary condition for boosting Kazakhstan’s competitiveness. Independent student work is a means of fostering the professional competence of future specialists. The primary form of self-education is independent work.

  2. Depression and College Students

    Science.gov (United States)

    ... depression and other mental health issues? Reference Share Depression and College Students Download PDF Download ePub Order ... Answers to college students’ frequently asked questions about depression Feeling moody, sad, or grouchy? Who doesn’t ...

  3. Mapping student online actions

    DEFF Research Database (Denmark)

    Bruun, Jesper; Jensen, Pia; Udby, Linda

    The Virtual Neutrons for Teaching project (vnt.nmi3.org) has converted traditional text book material into a wiki-style online text book that contains the same text and equations as the traditionally styled text book but has added features due to the online nature. Two of these features...... their problem solving strategy. In this study, we use web analytics software to track student online behavior by recording what particular objects on particular web-pages students click on and when each click occurs. For each recorded session, we create networks based on student clicks: A directed link between...... two nodes, 1 and 2, is drawn, if the object represented by node 2 is clicked right af the object represented by node 1. Preliminary analysis of these networks show two general types of behavior: In one type, there is little interaction with the online contents. The student navigates to the page...

  4. Student Rights Still Strong.

    Science.gov (United States)

    Adams, Julian

    1983-01-01

    Briefly reviews the development of freedom of student expression, including the 1969 "Tinker v. Des Moines" Supreme Court decision, and discusses the standards concerning educational disruption that have been developed since then. (AEA)

  5. Chinese students' great expectations

    DEFF Research Database (Denmark)

    Thøgersen, Stig

    2013-01-01

    The article focuses on Chinese students' hopes and expectations before leaving to study abroad. The national political environment for their decision to go abroad is shaped by an official narrative of China's transition to a more creative and innovative economy. Students draw on this narrative to...... system, they think of themselves as having a role in the transformation of Chinese attitudes to education and parent-child relations....

  6. THE LINK BETWEEN STUDENTS' SATISFACTION WITH FACULTY, OVERALL STUDENTS' SATISFACTION WITH STUDENT LIFE AND STUDENT PERFORMANCES

    OpenAIRE

    Mihanović, Zoran; Batinić, Ana Barbara; Pavičić, Jurica

    2016-01-01

    Customer satisfaction has long been recognized as a central concept of all business activities. Satisfaction can serve as an indicator of success of the company, both in the past and present, as well as an indicator of future performance. High quality service to students is a prerequisite of maintaining competitiveness in the market of higher education. A relationship that is created between the expectations of students and their satisfaction with the quality of service that provides educatio...

  7. Students' Perception on Plagiarism

    OpenAIRE

    Manalu, Mika Hatigoran

    2013-01-01

    This research is intended to find out how far college students' knowledge within act of plagiarism. Also, the issue of plagiarism was lifted to the surface because issues of plagiarism that have been revealed to the public is spread rapidly. One of the main reasons why plagiarism exists because teaching processing in classroom doesn't care on this issue. In this research, respondents were given a questionnaire that consists of 20 questions. Analysis of completed questionnaire showed student u...

  8. Reflections on Student Persistence

    Directory of Open Access Journals (Sweden)

    Vincent Tinto

    2017-07-01

    Full Text Available The Feature for this issue Reflections on Student Persistence has been prepared by Professor Vincent Tinto, Distinguished University Professor Emeritus at Syracuse University, United States of America (USA and a longtime friend and supporter of STARS. Vincent explores the case for motivation to be considered as a significant aspect of the tertiary student psyche by drawing on theoretical frameworks, research and practical experiences related to the issue. He synthesises this extensive, detailed, rich but often somewhat impenetrable data into a trilogy of clear and credible key dimensions of the motivation construct student self efficacy, sense of belonging and perceived value of the curriculum. This interpretation of the literature is a personal but informed reflection and is a timely piece which highlights the breadth and profundity of the presentations at this year's conference in Adelaide, Australia where students in all their diversity are central to our focus on enhancing the student experience. In this opening article, Vincent refers directly to the STARS papers selected for this Conference issue of the Journal which also address the importance of student persistence, self-efficacy and building the sense of belonging within their own institutional communities (Fernandes, Ford, Rayner & Pretorius; Kahu, Nelson, & Picton; McFarlane, Spes-Skrbis & Taib; Naylor; Smallhorn. Echoing his position on social justice and his advocacy for underserved students, Vincent reminds us that educational equity gaps still exist, and he encourages us to see the issue of persistence through the eyes of the students to support their perseverance and completion and thereby help reduce educational disadvantage.

  9. Role of Student Affairs in International Student Transition and Success

    OpenAIRE

    Christina W. Yao; Chrystal A. George Mwangi

    2017-01-01

    International student mobility has grown significantly in recent years, with over 4.1 million students in 2013 who studied abroad around the world (Institute of International Education [IIE], 2016). With the changes in student demographics and increased mobility, student affairs professionals are in a unique role to support international student transition and success. Unfortunately, current research and practice in higher education tends to place a high level of respo...

  10. Students: Customers, Clients or Pawns?

    Science.gov (United States)

    Tight, Malcolm

    2013-01-01

    The metaphor of the student as a consumer or customer is widely used within contemporary higher education, and impacts on the ways in which students, academics and institutions behave. These, and a number of alternative metaphors for the student, are critically reviewed. The alternatives considered include both contemporary (student as client or…

  11. When Students Take the Lead

    DEFF Research Database (Denmark)

    to the students. Student-centred problem-based active learning encourages students to work independently and constructively using academic staff as mentors and supervisors. It is a learning philosophy according to which the learning process is organized in such a way that the students actively engage in finding...

  12. Relationship quality and student engagement

    Science.gov (United States)

    Culver, Jennifer

    The purpose of this study was to examine the qualities of support, relatedness, and negative interaction within parent-child and teacher-student relationships and their association with cognitive, psychological, and behavioral engagement. Additionally, this study explored the contributions of cognitive and psychological engagement on behavioral engagement. The role of gender, grade, and ethnicity on relationship quality and engagement was also considered. Participants (n=311) were students in grades three through five from a suburban school district in southeastern Michigan. Perceptions of teacher-student relationship quality varied by grade level. In general, younger students reported greater teacher support and relatedness in comparison to older students. Conversely, older students perceived greater conflict within the teacher-student relationship. Student engagement also varied by grade level, with younger students reporting greater engagement than older students. Ethnicity also contributed to variance in student engagement, with African American students reporting significantly more engagement than Caucasian or Multiracial students. Teacher-student relationship quality was a significant predictor of student engagement, even after controlling for student characteristics and parent-child relationship variables. Results of path analysis revealed that cognitive and psychological engagement contributed significantly to behavioral engagement.

  13. Integrating Student Organizations into Typewriting.

    Science.gov (United States)

    Munday, Sandy

    1978-01-01

    The author states that typewriting activities related to student organizations may be integrated into typewriting and other classes in which typewriting skills are needed. She cites advantages of typing in student organizations and suggests selected classroom typing activities to motivate students and also benefit student organizations. (MF)

  14. Protecting Students from Each Other.

    Science.gov (United States)

    Imber, Michael

    2002-01-01

    Discuss implications for school-district student-on-student sexual harassment policies of "Davis v. Monroe County Board of Education, wherein the Supreme Court ruled that a school can be held liable for not protecting students from sexual harassment by other students. States that schools also have a moral and educational duty to prevent…

  15. Student Engagement through Digital Data

    Science.gov (United States)

    Gross, Liz; Meriwether, Jason L.

    2016-01-01

    This chapter suggests strategies and tools for student affairs professionals to leverage digital data to measure student engagement and learning outcomes, and refine programs that enhance institutional reputation and improve student persistence. The construct of student engagement is traced from its theoretical origins to recent research…

  16. A Model of Student Workload

    Science.gov (United States)

    Bowyer, Kyle

    2012-01-01

    Student workload is a contributing factor to students deciding to withdraw from their study before completion of the course, at significant cost to students, institutions and society. The aim of this paper is to create a basic workload model for a group of undergraduate students studying business law units at Curtin University in Western…

  17. Elementary Students' Metaphors for Democracy

    Science.gov (United States)

    Dundar, Hakan

    2012-01-01

    The purpose of the research was to reveal elementary 8th grade students' opinions concerning democracy with the aid of metaphors. The students were asked to produce metaphors about the concept of democracy. 140 students from 3 public schools in Ankara (Turkey) participated in the research. 55% of the students were females and 45% were males. The…

  18. Student Counselling at Utrecht University

    NARCIS (Netherlands)

    Herfs, Paul

    1995-01-01

    The enormous increase in the number of students at Dutch universities in the sixties and seventies made it impossible for professors to deal with the many different questions students confronted them with. New professionals, student counsellors/psychologists and student advisers entered the

  19. The dilemma for Japanese students

    DEFF Research Database (Denmark)

    Martinsen, Anders

    2014-01-01

    The Japanese job hunting system inhibits Japanese students from studying abroad. A Japanese professor says it is a huge dilemma for the students.......The Japanese job hunting system inhibits Japanese students from studying abroad. A Japanese professor says it is a huge dilemma for the students....

  20. Who Uses Student Data? (Infographic)

    Science.gov (United States)

    Phi Delta Kappan, 2015

    2015-01-01

    Who uses student data? is an infographic created by the Data Quality Campaign. (Used with permission) It answers important privacy-related questions about who collects, uses, and distributes student data. Most personal student information stays local. Districts, states, and the federal government all collect data about students for important…

  1. Student Modeling and Machine Learning

    OpenAIRE

    Sison , Raymund; Shimura , Masamichi

    1998-01-01

    After identifying essential student modeling issues and machine learning approaches, this paper examines how machine learning techniques have been used to automate the construction of student models as well as the background knowledge necessary for student modeling. In the process, the paper sheds light on the difficulty, suitability and potential of using machine learning for student modeling processes, and, to a lesser extent, the potential of using student modeling techniques in machine le...

  2. Student Engagement In Inclusive Classrooms

    DEFF Research Database (Denmark)

    Rangvid, Beatrice Schindler

    There is general agreement that to thrive and learn at their best, students must be engaged. However, schools face a particular challenge to provide a suitable and engaging learning environment for SEN (special educational needs) students who are educated in general education classes. Using data......-students as for other students. This highlights the need for better inclusion initiatives aimed at strengthening engagement of SEN-students in regular classrooms....

  3. EXPLORING THE RELATIONS BETWEEN STUDENT CYNICISM AND STUDENT BURNOUT.

    Science.gov (United States)

    Wei, Xueyan; Wang, Rongrong; Macdonald, Elizabeth

    2015-08-01

    Research on the negative effects of student cynicism has been limited, especially regarding its relation to student burnout. This study examined the relations among student cynicism (policy cynicism, academic cynicism, social cynicism, and institutional cynicism) and student burnout, as evidenced by emotional exhaustion, depersonalization, and reduced personal accomplishment, in a sample of 276 Chinese undergraduates. Hierarchical multiple regressions showed that four aspects of student cynicism together explained substantial variance in student burnout. Policy cynicism was the strongest contributor to emotional exhaustion. Social cynicism was the primary contributor to depersonalization, and also to reduced personal accomplishment. Student cynicism overall had the strongest relationship with reduced sense of personal achievement. The findings outline the negative functional relations between student cynicism and student burnout.

  4. GENDER CONFLICTS OF STUDENTS

    Directory of Open Access Journals (Sweden)

    H. F. Moskalyk

    2017-06-01

    Full Text Available Actuality of work. Student age has the most favourable conditions for psychological, biological and social development; however, there are reasons why such natural advantages over other social groups can be completely or partially levelled. One of them is the presence of conflicts in the life of a student, a special group, among which there are women. The causes of the emergence of gender conflicts in individual social groups and the strategies for their solution have not been sufficiently explored and require further study and, therefore, are relevant. Purpose of the article is to investigate the causes of gender conflicts among students as a separate social group and to develop measures to address them and prevent them. Methodology. The research conducted in the work is based on the analysis and generalization of the causes of the emergence of gender conflicts among students, the identification of the main sources of information that form the consciousness of children and adolescents, and also influence their attitude to gender equality. Originality. The nature of gender conflicts has been quite effectively studied for a long time. However, the scope of research is limited to the most numerous social groups, such as the family, labour collective, political and public organizations, etc. Being a dynamic and socio-demographic formation, the students perform an important function in society – it takes a direct part in the transformation of all spheres of the life activity of the society. Based on the study of the objective conditions of the social environment with certain models of socialization that form the consciousness of students from early childhood, a three-component system of influence was first proposed, which is aimed at overcoming gender inequality and preventing gender conflicts among students. At the same time, the interaction of the components of the system will allow to minimize the gender inequality index in our country

  5. ISS Robotic Student Programming

    Science.gov (United States)

    Barlow, J.; Benavides, J.; Hanson, R.; Cortez, J.; Le Vasseur, D.; Soloway, D.; Oyadomari, K.

    2016-01-01

    The SPHERES facility is a set of three free-flying satellites launched in 2006. In addition to scientists and engineering, middle- and high-school students program the SPHERES during the annual Zero Robotics programming competition. Zero Robotics conducts virtual competitions via simulator and on SPHERES aboard the ISS, with students doing the programming. A web interface allows teams to submit code, receive results, collaborate, and compete in simulator-based initial rounds and semi-final rounds. The final round of each competition is conducted with SPHERES aboard the ISS. At the end of 2017 a new robotic platform called Astrobee will launch, providing new game elements and new ground support for even more student interaction.

  6. Revisiting the student centered

    DEFF Research Database (Denmark)

    Sarauw, Laura Louise

    2018-01-01

    Has the orthodoxy of progressive pedagogy, or what praise as the student centered, become means of an overall managerial turn that erodes students’ freedom do learn? This is the main question in Bruce Macfarlane’s book Freedom to learn - The Threat to Student Academic Freedom and Why it Needs...... to be Reclaimed (2017). In eighth well-written chapters, Macfarlane explores an often-overlooked paradox in higher education teaching and learning: The idea of the student centered learning, deriving from humanist psychology and progressive pedagogy, has been hijacked by increased and continuous demands of bodily......, cognitive and emotional performance that restricts students’ freedom to develop as autonomous adults. Macfarlane’s catch 22 is, however, that his heritage from humanist psychology, i.e. the idea that we as humans are born with an inner potential that we should be free to realise though education...

  7. Students as Learning Designers

    DEFF Research Database (Denmark)

    Levinsen, Karin; Sørensen, Birgitte Holm

    2013-01-01

    This paper focuses on students in the youngest classes at primary school as learning designers of ICT-integrated productions. It is based on the project Netbook 1:1 (2009-2012) funded by the municipality of Gentofte and Microsoft Denmark. The paper presents a model for designing ICT-integrated st......This paper focuses on students in the youngest classes at primary school as learning designers of ICT-integrated productions. It is based on the project Netbook 1:1 (2009-2012) funded by the municipality of Gentofte and Microsoft Denmark. The paper presents a model for designing ICT......-integrated student productions which was developed during the project in relation to different subjects. Ownership, iteration and feedforward are the central concepts in this model. Two exemplary cases are presented illustrating the students’ and teachers’ roles as learning designers in relation to the model...

  8. Student Motivation in Science Subjects in Tanzania, Including Students' Voices

    Science.gov (United States)

    Mkimbili, Selina Thomas; Ødegaard, Marianne

    2017-12-01

    Fostering and maintaining students' interest in science is an important aspect of improving science learning. The focus of this paper is to listen to and reflect on students' voices regarding the sources of motivation for science subjects among students in community secondary schools with contextual challenges in Tanzania. We conducted a group-interview study of 46 Form 3 and Form 4 Tanzanian secondary school students. The study findings reveal that the major contextual challenges to student motivation for science in the studied schools are limited resources and students' insufficient competence in the language of instruction. Our results also reveal ways to enhance student motivation for science in schools with contextual challenges; these techniques include the use of questioning techniques and discourse, students' investigations and practical work using locally available materials, study tours, more integration of classroom science into students' daily lives and the use of real-life examples in science teaching. Also we noted that students' contemporary life, culture and familiar language can be utilised as a useful resource in facilitating meaningful learning in science in the school. Students suggested that, to make science interesting to a majority of students in a Tanzanian context, science education needs to be inclusive of students' experiences, culture and contemporary daily lives. Also, science teaching and learning in the classroom need to involve learners' voices.

  9. Student progression on time

    DEFF Research Database (Denmark)

    Sarauw, Laura Louise

    more quickly and make them more fit for the labour market like the Danish government presumes? Will this be at the expense of leaving students with fragmented knowledge and superficial understandings as suggested by the critics? And what happens to the dropout rates and the ‘Nordic’ ideals of equal...... by flexibility. Before the reform, the system was increasingly required to facilitate transfer of credits and make it easier for students to compose more personalized learning portfolios, which can include courses from different institutions and study programmes. The latter is very much in line with the ideas...

  10. Students' understandings of electrochemistry

    Science.gov (United States)

    O'Grady-Morris, Kathryn

    Electrochemistry is considered by students to be a difficult topic in chemistry. This research was a mixed methods study guided by the research question: At the end of a unit of study, what are students' understandings of electrochemistry? The framework of analysis used for the qualitative and quantitative data collected in this study was comprised of three categories: types of knowledge used in problem solving, levels of representation of knowledge in chemistry (macroscopic, symbolic, and particulate), and alternative conceptions. Although individually each of the three categories has been reported in previous studies, the contribution of this study is the inter-relationships among them. Semi-structured, task-based interviews were conducted while students were setting up and operating electrochemical cells in the laboratory, and a two-tiered, multiple-choice diagnostic instrument was designed to identify alternative conceptions that students held at the end of the unit. For familiar problems, those involving routine voltaic cells, students used a working-forwards problem-solving strategy, two or three levels of representation of knowledge during explanations, scored higher on both procedural and conceptual knowledge questions in the diagnostic instrument, and held fewer alternative conceptions related to the operation of these cells. For less familiar problems, those involving non-routine voltaic cells and electrolytic cells, students approached problem-solving with procedural knowledge, used only one level of representation of knowledge when explaining the operation of these cells, scored higher on procedural knowledge than conceptual knowledge questions in the diagnostic instrument, and held a greater number of alternative conceptions. Decision routines that involved memorized formulas and procedures were used to solve both quantitative and qualitative problems and the main source of alternative conceptions in this study was the overgeneralization of theory

  11. The modern Danish student

    DEFF Research Database (Denmark)

    Lassesen, Berit

    2007-01-01

    and personal aspects, 2) an internally motivated and existential "personal growth" orientation, 3) a process - rather than result-oriented attitude towards educational activities, 4) a short-term "here- and now" motivation, and 5) an ambivalent attitude towards who is responsible for the result of the learning......-oriented than short-term motivated, more pragmatically oriented than personal-growth motivated, and more motivated by external than internal factors. While the conclusions of Simonsen and Ulriksen perhaps can be generalized to students from humanistic faculties, they do not seem to be representative of students...

  12. Chinese students' perceptions of teacher-student interpersonal behavior

    NARCIS (Netherlands)

    Wei, M.; Zhou, Yalun; Barber, C. E.; Brok, den P.J.

    2015-01-01

    Students' perceptions are one of the most important elements in evaluating the learning environment. Although the literature is replete with studies investigating teacher-student interpersonal behavior in science classrooms, relatively few studies have been conducted in foreign language classrooms,

  13. Student Services and their Influence to Student Development

    Directory of Open Access Journals (Sweden)

    Charlito P. Cadag

    2017-05-01

    Full Text Available he study assessed the effectiveness of student services and their influen ce on student development in the four campuses of Central Bicol State University of Agriculture (CBSUA, SY 2013 - 2014. Descriptive, evaluative, comparative and correlational methods of research were employed. Respondents were administrators, faculty membe rs and student leaders. Data were gathered through questionnaire, interview, documentary analysis and ocular inspection and were treated statistically using weighted mean, ranking, one - way ANOVA, Pearson R correlation analysis and DMRT. Findings revealed t hat the four campuses of CBSUA were ”very effective” in managing the different student services. The social, cultural, political and intellectual aspects of students in the four campuses of CBSUA were “highly developed” through the various student services provided. Student services such as sports development, library, student organizations, arts and culture development, guidance and counseling, scholarship and financial assistance, campus ministry and health services did not vary among campuses.

  14. Students in Action: Engaging Students with Destination Stakeholders

    OpenAIRE

    Craggs, Ruth; Gorman, Catherine; Griffin, Kevin; mottiar, ziene; Quinn, Deirdre; Quinn, Bernadette; Ryan, Theresa

    2015-01-01

    The Students in Action Project in the School of Hospitality Management and Tourism was established in 2012 as a way of engaging students and working with stakeholders in a destination. The overall aim of the project was to immerse students in an active collaborative learning environment within the destination to identify ways in which tourism could be enhanced. In the 2014/2015 academic year the project involved over 300 students from a variety of programmes and modules working with local sta...

  15. Students Share Their Research at Student Poster Day | Poster

    Science.gov (United States)

    Students Share Their Research at Student Poster Day  By Ashley DeVine, Staff Writer More than 50 Werner H. Kirsten student interns and college interns presented their research at Summer Student Poster Day on August 6 in the Building 549 lobby.  Joseph Bergman, a high school intern in the Center for Cancer Research Nanobiology Laboratory, participated in the event “for the

  16. LACK OF OPTIMISM AMONG MARKETING STUDENTS VS. OTHER STUDENTS

    OpenAIRE

    Gregory S. BLACK; Angelica BAHL

    2010-01-01

    For the first time in American history, the current generation of college-age students may be destined for diminished financial opportunities than their parents. However, they may not realize that and may continue to have expectations higher than reality. Marketing students appear to be the least optimistic about their futures than students with other majors. This study utilizes a sample of 334 undergraduate students enrolled in marketing classes to find that dependent variables in three cate...

  17. Does Students' Expectation of Teachers Affect Students' Evaluation of Teachers?

    Science.gov (United States)

    Babski, Carl

    This report gives an extensive review of the literature dealing with student evaluation of faculty, and investigates the effect of a previously unexplored variable, students' expectations of the teaching-learning situation. Eight student perceptions of the teaching-learning situation were identified: dogmatic, erotic, moral, therapeutic,…

  18. Understanding the Relationship between Student Attitudes and Student Learning

    Science.gov (United States)

    Cahill, Michael J.; McDaniel, Mark A.; Frey, Regina F.; Hynes, K. Mairin; Repice, Michelle; Zhao, Jiuqing; Trousil, Rebecca

    2018-01-01

    Student attitudes, defined as the extent to which one holds expertlike beliefs about and approaches to physics, are a major research topic in physics education research. An implicit but rarely tested assumption underlying much of this research is that student attitudes play a significant part in student learning and performance. The current study…

  19. Student Diligence and Student Diligence Support: Predictors of Academic Success.

    Science.gov (United States)

    Arthur, Christon G.

    The purpose of this study was to examine ways in which students can become academically engaged and satisfied with their academic experience. A correlational study, using the survey method, was used to describe in quantitative terms, the degree of the relationships between student diligence, student support systems, other related factors, and…

  20. Linking Teacher Quality, Student Attendance, and Student Achievement

    Science.gov (United States)

    Gershenson, Seth

    2016-01-01

    Research on the effectiveness of educational inputs, particularly research on teacher effectiveness, typically overlooks teachers' potential impact on behavioral outcomes, such as student attendance. Using longitudinal data on teachers and students in North Carolina I estimate teacher effects on primary school student absences in a value-added…

  1. Student Affairs Capitalism and Early-Career Student Affairs Professionals

    Science.gov (United States)

    Lee, Jenny J.; Helm, Matthew

    2013-01-01

    This study explores student affairs capitalism as the alteration of professional practice towards the financial interests of institutions. Student affairs capitalism has the potential to create dynamics in which the interests of students become secondary to the institution's economic needs. This study examined this phenomenon from the perspectives…

  2. Interior design students win two IDEC Student Design Competition awards

    OpenAIRE

    Watson-Bloch, Cathy

    2005-01-01

    Interior Design students in the School of Architecture + Design at Virginia Tech won two of the four awards presented in the 2004-2005 Interior Design Educators Council (IDEC) Student Design Competition. Winners were selected at the International IDEC Conference in Savannah, Ga. with Virginia Tech Interior Design students winning second place and honorable mention.

  3. Instructor Attitudes toward Students: Job Satisfaction and Student Outcomes

    Science.gov (United States)

    Wilson, Janie H.

    2008-01-01

    The relational teaching approach suggests that instructors should develop positive relationships with students, with benefits including greater job satisfaction. One way to build positive relationships with students involves exhibiting immediacy behaviors. The author examined relationships among professors' attitudes toward students, immediacy…

  4. Student Engagement in Assessments: What Students and Teachers Find Engaging

    Science.gov (United States)

    Bae, Soung; Kokka, Kari

    2016-01-01

    Although research has shown that student engagement is strongly related to performance on assessment tasks, especially for traditionally underserved subgroups of students, increasing student engagement has not been the goal of standardized tests of content knowledge. Recent state and federal policies, however, are changing the assessment…

  5. General Education Students' Changing Perceptions of Students with Special Needs

    Science.gov (United States)

    Novak, Ashley D.; Bartelheim, Frederick J.

    2012-01-01

    Schools are becoming more inclusive and more students with special needs are accessing general education classrooms than ever. This action research study investigated general education students changing perceptions of students with special needs through the use of various interventions (e.g., classroom discussions, organized games, buddy reads,…

  6. Mathematics in Student-­Centred Inquiry Learning: Student Engagement

    Science.gov (United States)

    Calder, Nigel

    2013-01-01

    This paper examines how mathematical understandings might be facilitated through student-centred inquiry. Data is drawn from a research project on student-centred inquiry learning that situated mathematics within authentic problem-solving contexts and involved students in a collaboratively constructed curriculum. A contemporary interpretive frame…

  7. College Student Concerns: Perceptions of Student Affairs Practitioners

    Science.gov (United States)

    Reynolds, Amy L.

    2013-01-01

    The purpose of this study was to increase awareness of the perceptions of student affairs professionals regarding the most frequent and challenging concerns facing college students today. Using the Delphi method, 159 entry-level and mid-level student affairs administrators from institutions across the country were surveyed about their perceptions…

  8. Understanding Student Motivation

    Science.gov (United States)

    Seifert, Timothy

    2004-01-01

    Contemporary theories of academic motivation seek to explain students' behaviours in academic settings. While each theory seems to possess its own constructs and unique explanations, these theories are actually closely tied together. In this theoretical study of motivation, several theories of motivation were described and an underlying theme of…

  9. Limnology. Student Fieldbook.

    Science.gov (United States)

    Jones, Michael

    This student fieldbook provides exercises for a three-week course in limnology. Exercises emphasize applications of knowledge in chemistry, physics, and biology to understand the natural operation of freshwater systems. Fourteen field exercises include: (1) testing for water quality; (2) determination of water temperature, turbidity, dissolved…

  10. Mindfulness and Student Success

    Science.gov (United States)

    Leland, Matt

    2015-01-01

    Mindfulness has long been practiced in Eastern spiritual traditions for personal improvement, and educators and educational institutions have recently begun to explore its usefulness in schools. Mindfulness training can be valuable for helping students be more successful learners and more connected members of an educational community. To determine…

  11. Structuring Effective Student Teams.

    Science.gov (United States)

    Dickson, Ellen L.

    1997-01-01

    Experience with student teams working on policy analysis projects indicates the need for faculty supervision of teams in the process of addressing complex issues. The problem-solving approach adopted in one policy analysis course is described, including assignments and tasks, issues and sponsors, team dynamics, conflict management, and the…

  12. Engineering Students' Sustainability Approaches

    Science.gov (United States)

    Haase, S.

    2014-01-01

    Sustainability issues are increasingly important in engineering work all over the world. This article explores systematic differences in self-assessed competencies, interests, importance, engagement and practices of newly enrolled engineering students in Denmark in relation to environmental and non-environmental sustainability issues. The…

  13. Student Self-Disclosure

    Science.gov (United States)

    Lucas, Janet; DeGenaro, William

    2007-01-01

    This article presents two essays that focus on the challenges presented by students' self-disclosures in their writing. The authors have read each other's essays and provided their brief responses. This cross talk between the writers continues, in a more deliberate way, the cross talk generated by their essays.

  14. Students as Customers?

    Science.gov (United States)

    Cuthbert, Rob

    2010-01-01

    The idea that students might be treated as customers triggers academics' antipathy, which in turn can lead to managerial irritation and political frustration. There are different discourses which barely overlap as their protagonists speak past one another. This article argues that these differences can be reconciled by re-conceiving the…

  15. Student Drug Use.

    Science.gov (United States)

    Nowlis, Helen H.

    This paper discusses the nature and extent of student drug use, its meaning and significance, society's response to it, and some of the problems resulting from efforts to control it. Drugs are any substance which by its chemical nature affects the structure or function of the living organism. Abuse refers to any use of a non-medically approved…

  16. Disciplining Students with Disabilities.

    Science.gov (United States)

    Dwyer, Kevin P.

    This report discusses disciplining children with disabilities in schools, in the context of the legal requirements of the Individuals with Disabilities Education Act. Practical concepts are explained in terms of the school's responsibility to: (1) maintain a safe environment; (2) teach a code of discipline to all students; (3) use the…

  17. Students get wise about

    African Journals Online (AJOL)

    Perceptions of self-efficacy are based mainly on personal experiences and performance accomplishments. The programme aimed to give students this experience through role-play. Theoretical constructs from two psychosocial theories of health behaviour, viz. the Health Belief Modelll and the. Theory of Reasoned Action,'· ...

  18. Counseling Graduate Students.

    Science.gov (United States)

    Caple, Richard B.

    1995-01-01

    Explores how the understanding of graduate students' special needs and circumstances enhances counseling of this population. Looks at stress factors, educational preparation, delayed gratification, achieving autonomy, intellectual development, and the counseling process. Emphasizes the importance of establishing trust in the therapeutic dialog so…

  19. At Home with Students

    DEFF Research Database (Denmark)

    Lyngsø, Anita

    2015-01-01

    This article reflects the methodological challenges presented in the research process, where the principle of 'following the field’ means that the researcher must also follow students engaged in online activities in their own homes. The ethnographic studies are a part of a PhD project...

  20. International Students in China

    DEFF Research Database (Denmark)

    As the number of international students in Chinese higher education increases steadily, this volume is one of the first to focus on their many and varied experiences. With contributions focusing on such topics as intercultural adaptation, soft power and interculturality, language learning strateg...

  1. Student Perspectives on Burnout

    Science.gov (United States)

    Mazerolle, Stephanie M.; Pagnotta, Kelly D.

    2011-01-01

    Context: While burnout has received a great deal of attention within the athletic training profession, there is little data on how it affects athletic training students (ATSs). Objective: To determine what factors influence burnout among ATSs enrolled in accredited athletic training education programs. Design and Setting: Basic, interpretive…

  2. Medical students' financial dilemma

    African Journals Online (AJOL)

    1991-05-18

    May 18, 1991 ... A study conducted at the University of Cape Town. R. P. COLBORN ... The financial position of 5th- and 6th-year medical students at the University of .... USA and the UK10,ll appear to have similar problems. Subjects and ...

  3. Nurturing Young Student Mathematicians

    Science.gov (United States)

    Gavin, M. Katherine; Casa, Tutita M.

    2013-01-01

    Developing mathematical talent in our students should be of primary consideration in education today as nations respond to the challenges of economic crises and ever-changing technological advances. This paper describes two U.S. federally funded curriculum projects, Project M[superscript 3], Mentoring Mathematical Minds, and Project M[superscript…

  4. Students' communicative competence

    Directory of Open Access Journals (Sweden)

    Šafranj Jelisaveta

    2009-01-01

    Full Text Available Communicative competence is the ability to send messages which promote attainment of goals while maintaining social acceptability. Competent communicators attempt to align themselves with each others goals and methods to produce a smooth, productive and often enjoyable dialogue. The aim of this research was to investigate self-perceived communicative competence (SPCC of students of Engineering Management in General English and English for Specific Purposes (ESP. A longitudinal study was carried out starting with the first year students at the Faculty of Technical Sciences in Novi Sad and was repeated with the same sample of students during their second and third year of study. Participation was voluntary and took place during regular class time. The measure of communicative competence employed was the Self-perceived Communication Competence Scale. The results of the study indicated that differences in SPCC between the years do exist. The SPCC gradually improved between the first, the second and the third year. The research was also motivated by gaining better overview of the teaching activity. An anonymous questionnaire provided many useful hints and ideas for further work and thus, language teacher made a thorough analysis of the overall teaching procedure. However, it is essential to get some feedback and talk to students in order to evaluate both them and ourselves as well as the teaching syllabus.

  5. Weaving Together Student Supports

    Science.gov (United States)

    Benigni, Mark D.; Miller, Bruce A.

    2010-01-01

    Public schools must be the catalyst for achieving equity in education. Real equity is not simply achieving equality or about ensuring that everyone gets the same resources and receives the same instruction. Equity is about ensuring that all students get what they need to be successful. Fairness is not providing the same resources, instruction, and…

  6. Helping Students Analyze Revolutions

    Science.gov (United States)

    Armstrong, Stephen; Desrosiers, Marian

    2012-01-01

    A visitor to a random sampling of Modern World History classes in the United States will find that the subject of "revolution" is a favorite for many students. Reading about and researching individuals and topics such as Tsar Nicholas II, Rasputin, Marie Antoinette and guillotines is never boring. Unfortunately, in too many classrooms,…

  7. Student support infrastructure

    DEFF Research Database (Denmark)

    Nøhr, Christian

    2004-01-01

    The development and diffusion of distance learning programmes has made it possible for students to choose their preferred location to study and consequently, they are expected to be able to use new technologies in order to gain necessary support in a wide range of ares. When universities implement...

  8. Consumer Decisions. Student Manual.

    Science.gov (United States)

    Florida State Dept. of Education, Tallahassee. Div. of Vocational Education.

    This student manual covers five areas relating to consumer decisions. Titles of the five sections are Consumer Law, Consumer Decision Making, Buying a Car, Convenience Foods, and Books for Preschool Children. Each section may contain some or all of these materials: list of objectives, informative sections, questions on the information and answers,…

  9. Preparing Students for Globalization

    DEFF Research Database (Denmark)

    Friesel, Anna

    2010-01-01

    A. Friesel. Preparing Students for Globalization Working with International Teams with Projects // Electronics and Electrical Engineering. - Kaunas: Technologija, 2019. - No. 6(102). - P. 111-114. This paper summarizes the activities, contents and overall outcomes of our experiences with internat......A. Friesel. Preparing Students for Globalization Working with International Teams with Projects // Electronics and Electrical Engineering. - Kaunas: Technologija, 2019. - No. 6(102). - P. 111-114. This paper summarizes the activities, contents and overall outcomes of our experiences...... the positive influence on number of our partnership agreements with other European universities. Globalisation makes it necessary to cooperate on an international platform. At the IHK we have more than 50 active Erasmus agreements. We also have bilateral agreements with many non-European countries, for example......: USA, China, Korea, Mexico, Chile and others. We describe our experiences of working on industrial projects with international teams and analyse the development and trends in student mobility. The growing popularity of these programmes and the increasing number of the students joining our international...

  10. Coaching doctoral students

    DEFF Research Database (Denmark)

    Godskesen, Mirjam Irene; Kobayashi, Sofie

    2016-01-01

    In this paper we focus on individual coaching carried out by an external coach as a new pedagogical element that can impact doctoral students’ sense of progress in doctoral education. The study used a mixed methods approach in that we draw on quantitative and qualitative data from the evaluation...... impact the supervisor – student relationship in a positive way....

  11. Incentives for students

    DEFF Research Database (Denmark)

    Ostermaier, Andreas

    2018-01-01

    This study examines the effects of certificates and deadlines on student performance. It exploits time lags in reforms of two similar degree programs at a business school, which create quasi-experimental settings. Students’ performance is found to increase if certificates are awarded to them early...

  12. Students design composite bridges

    NARCIS (Netherlands)

    Stark, J.W.B.; Galjaard, J.C.; Brekelmans, J.W.P.M.

    1999-01-01

    The paper gives an overview of recent research on steel-concrete composite bridge design by students of Delft University of Technology doing their master's thesis. Primary objective of this research was to find possibilities for application of steel-concrete composite bridges in the Netherlands,

  13. Teaching Students Who Stutter

    Science.gov (United States)

    Education Digest: Essential Readings Condensed for Quick Review, 2011

    2011-01-01

    Stutterer's incident in class draws national attention; Stuttering Foundation responds with tips for educators. In response to the articles in the "New York Times," Jane Fraser, president of the nonprofit Stuttering Foundation, wrote in a press release eight tips for educators regarding working with students who stutter. This article presents…

  14. Students' Motivation in Class.

    Science.gov (United States)

    Cretu, Daniela

    2003-01-01

    Presents an approach that teachers can use to promote and investigate students' motivation to learn in the classroom. Notes that the strategies used are from Reading and Writing for Critical Thinking courses. Explains the following motivational devices: dual-entry diary; clusters; know/want to know/learned; think/pair/share; discussion web;…

  15. Young students experience theory

    CERN Multimedia

    2004-01-01

    Three sixteen-year-old students from the International School of Geneva, La Chataigneraie have spent a week finding out about the life of a theoretical physicist at CERN. Student Peter Bishop at the blackboard with Robert Fleischer of Theory Division. Peter Bishop, Sam Schoenholz and Alexander Hultin spent the time with the Theory Unit of the Physics department. The visit was at the suggestion of the students themselves, who are required to undertake work experience at an organization, gaining insights into professional life, as part of their studies. After an introduction to CERN at Microcosm, each student had the opportunity to learn about physics at a level well beyond their current academic training. They were mentored by theoretical physicists who introduced them to the basics of particle physics, discussing physics in general as well as topics such as predicting the mass of the Higgs boson and cosmology. A visit to CMS, guided by Ariane Frey, proved very impressive, but the working conditions of physi...

  16. Student Attitude Inventory - 1971.

    Science.gov (United States)

    Gillmore, Gerald M.; Aleamoni, Lawrence M.

    This 42-item Student Attitude Inventory (SAI) was administered to entering college freshmen at the University of Illinois (see TM 001 015). The SAI items are divided into nine categories on the basis of content as follows: voting behavior, drug usage, financial, Viet Nam war, education, religious behavior, pollution, housing, and alienation. A…

  17. Denying Medical Students' Emotions.

    Science.gov (United States)

    USA Today, 1984

    1984-01-01

    Medical educators nationwide are questioning the process that leads to the denial of the emotional side of medicine by its practitioners. Emotional dilemmas are often verbally suppressed by most students, but they surface in many ways, such as depression, insomnia, loss of appetite, and anxiety. (RM)

  18. Nudging the student

    NARCIS (Netherlands)

    dr. A.F. de Wild

    2013-01-01

    People do not always make the choice that improves their life. Higher education desires a lot of self discipline and independence. This is one of the reasons for lack of success. Our goal with Nudging the Student is to contribute improving passing yield by applying nudges. Presentation held at the

  19. Student Rights and Responsibilities

    Science.gov (United States)

    Today's Education, 1972

    1972-01-01

    Article summarizes National Education Association pamphlet. As citizens, students should have full protection of Bill of Rights, due process, protection from illegal search or seizure. As clients of institution, should have substantial influence on how institutions affect their lives. Proper disciplinary procedures for minor and major infractions…

  20. Student Discipline in Transition

    Science.gov (United States)

    Smith, George P.; Kirk, Henry P.

    1971-01-01

    This article has focused on the process of radical change in American Society. The regulation and dicipline of student conduct has been forced to give up its traditionally privileged position. Constitutional requirements have become a necessary part of disciplinary procedures in public institutions of higher education. (Author)

  1. Nudging the student

    OpenAIRE

    Wild, de, A.F.

    2013-01-01

    People do not always make the choice that improves their life. Higher education desires a lot of self discipline and independence. This is one of the reasons for lack of success. Our goal with Nudging the Student is to contribute improving passing yield by applying nudges. Presentation held at the International Honors Conference 2013.

  2. Student Attitude Inventory.

    Science.gov (United States)

    Aleamoni, Lawrence M.

    A ten item questionnaire dealing with parental family income, the legalization of marijuana, pollution, and a volunteer army was administered to the entering freshman class on September 6, 1970. The results indicate that the freshmen tend to underestimate the actual earning power of their fellow students' families by approximately $1,800. However,…

  3. Assessment Matters: Moving beyond Surveys

    Science.gov (United States)

    Wise, Vicki L.; Barham, Mary Ann

    2012-01-01

    The August 16, 2011, "Chronicle of Higher Education" article "Want Data? Ask Students. Again and Again" by Sara Lipka posits that in higher education there is a culture of oversurveying students and too often relying on surveys as the main, or only, way of assessing the impact of programs and services on student satisfaction and learning. Because…

  4. Science Careers and Disabled Students.

    Science.gov (United States)

    Jagoda, Sue; Cremer, Bob

    1981-01-01

    Summarizes proceedings and student experiences at the 1980 Science Career Workshop for Physically Disabled Students at the Lawrence Hall of Science (University of California). Includes a description of the key-note speaker's topics, and other workshop activities. (DS)

  5. Focusing of Students' Mathematical Thinking

    Science.gov (United States)

    Breyfogle, M. Lynn; Herbel-Eisenmann, Beth A.

    2004-01-01

    Suggestions and ideas that enable teachers to take a closer look at students' thinking are discussed. A teacher should periodically reflect on his or her own classroom practices in order to increase attention on students' mathematical thinking.

  6. The Student-Teacher Relationship

    Science.gov (United States)

    Schlechty, Phillip C.; Atwood, Helen E.

    1977-01-01

    Possible bases for student influence over teachers are examined. Since teachers cannot avoid being influenced by students, it is important for them to consciously select the kinds of influence efforts to which they will respond. (MJB)

  7. The Future of Student Engagement

    Science.gov (United States)

    Buskist, William; Groccia, James E.

    2018-01-01

    This chapter underscores the importance of conceptualizing student engagement as a responsibility shared by all members of the academy and describes how Groccia's multidimensional model can serve as blueprint for future thinking and research on student engagement.

  8. Ozone (Environmental Health Student Portal)

    Science.gov (United States)

    Skip Navigation National Library of Medicine Environmental Health Student Portal Connecting Middle School Students to Environmental Health Information Menu Home Air Pollution Air Pollution Home Indoor Air Pollution Outdoor ...

  9. Pesticides (Environmental Health Student Portal)

    Science.gov (United States)

    Skip Navigation National Library of Medicine Environmental Health Student Portal Connecting Middle School Students to Environmental Health Information Menu Home Air Pollution Air Pollution Home Indoor Air Pollution Outdoor ...

  10. Guided and Unguided Student Reflections

    OpenAIRE

    Matheson, Amanda; Wood, Laura; Franklin, Scott V.

    2017-01-01

    Self-reflection is important metacognitive skill, enabling students to build coherence into their learning and embed content in a broader context. While various pedagogical techniques exist to encourage student reflection, little research has examined the differences between formally guided, partially guided and unguided reflections. This study focuses on student responses to online Guided Reflection Forms (GRFs) from students in a first-semester non-physics class and, separately, a sophomore...

  11. Mathematics for the Student Scientist

    Science.gov (United States)

    Lauten, A. Darien; Lauten, Gary N.

    1998-03-01

    The Earth Day:Forest Watch Program, introduces elementary, middle, and secondary students to field laboratory, and satellite-data analysis methods for assessing the health of Eastern White Pine ( Pinus strobus). In this Student-Scientist Partnership program, mathematics, as envisioned in the NCTM Standards, arises naturally and provides opportunities for science-mathematics interdisciplinary student learning. School mathematics becomes the vehicle for students to quantify, represent, analyze, and interpret meaningful, real data.

  12. Classroom Texting in College Students

    Science.gov (United States)

    Pettijohn, Terry F.; Frazier, Erik; Rieser, Elizabeth; Vaughn, Nicholas; Hupp-Wilds, Bobbi

    2015-01-01

    A 21-item survey on texting in the classroom was given to 235 college students. Overall, 99.6% of students owned a cellphone and 98% texted daily. Of the 138 students who texted in the classroom, most texted friends or significant others, and indicate the reason for classroom texting is boredom or work. Students who texted sent a mean of 12.21…

  13. Engaging Students with Audio Feedback

    Science.gov (United States)

    Cann, Alan

    2014-01-01

    Students express widespread dissatisfaction with academic feedback. Teaching staff perceive a frequent lack of student engagement with written feedback, much of which goes uncollected or unread. Published evidence shows that audio feedback is highly acceptable to students but is underused. This paper explores methods to produce and deliver audio…

  14. Motivating Students to Do Homework

    Science.gov (United States)

    Kontur, Frederick J.; Terry, Nathan B.

    2014-01-01

    How do you motivate students to do their homework? Some instructors make students' homework scores a significant percentage of the final course grade. In that case, how much course credit is required? Some instructors do not grade homework at all, instead relying on students' intrinsic motivation to learn the course material. Will this actually…

  15. Career Expectations of Accounting Students

    Science.gov (United States)

    Elam, Dennis; Mendez, Francis

    2010-01-01

    The demographic make-up of accounting students is dramatically changing. This study sets out to measure how well the profession is ready to accommodate what may be very different needs and expectations of this new generation of students. Non-traditional students are becoming more and more of a tradition in the current college classroom.…

  16. Australian University International Student Finances

    Science.gov (United States)

    Forbes-Mewett, Helen; Marginson, Simon; Nyland, Chris; Ramia, Gaby; Sawir, Erlenawati

    2009-01-01

    The omission of international students from the Australian Vice-Chancellor's Committee (AVCC) 2007 national study on student finances is indicative of a pattern of exclusion. The exclusion is unacceptable from a humane perspective and feeds the belief that Australians perceive international students primarily as "cash cows". This study…

  17. Science Education and ESL Students

    Science.gov (United States)

    Allen, Heather; Park, Soonhye

    2011-01-01

    The number of students who learn English as a second language (ESL) in U.S. schools has grown significantly in the past decade. This segment of the student population increased by 56% between the 1994-95 and 2004-05 school years (NCLR 2007). As the ESL student population increases, many science teachers struggle to tailor instructional materials,…

  18. Dental Chairside Technique. Student's Manual.

    Science.gov (United States)

    Apfel, Maura; Weaver, Trudy Karlene

    This manual is part of a series dealing with skills and information needed by students in dental assisting. The individualized student materials are suitable for classroom, laboratory, or cooperative training programs. This student manual contains four units covering the following topics: local anesthesia; dental office emergencies; oral hygiene;…

  19. Cutting edge intermediate : student's book

    CERN Document Server

    Cunningham, Sarah

    2004-01-01

    A focus on high-frequency useful vocabulary helps students say what they want to say. Regular, well-structured speaking tasks encourage students to express themselves more extensively and fluently. ‘Do You Remember’ sections in every unit and extra. Consolidation modules provide regular review and consolidation Student Books include Mini-Dictionary to help learners study independently.

  20. Mirrors & Windows into Student Noticing

    Science.gov (United States)

    Dominguez, Higinio

    2016-01-01

    In many classrooms, students solve problems posed by others--teachers, textbooks, and test materials. These problems typically describe a contrived situation followed by a question about an unknown that students are expected to resolve. Unsurprisingly, many students avoid reading these problems for meaning and instead engage in a suspension of…

  1. Attendance Policies and Student Grades

    Science.gov (United States)

    Risen, D. Michael

    2007-01-01

    The details described in this case study examine the issues related to attendance policies and how such policies might be legally used to affect student grades. Concepts discussed should cause graduate students in educational administration to reflect on the issues presented from various points of view when the students complete an analysis of the…

  2. Students "Hacking" School Computer Systems

    Science.gov (United States)

    Stover, Del

    2005-01-01

    This article deals with students hacking school computer systems. School districts are getting tough with students "hacking" into school computers to change grades, poke through files, or just pit their high-tech skills against district security. Dozens of students have been prosecuted recently under state laws on identity theft and unauthorized…

  3. Start Where Your Students Are

    Science.gov (United States)

    Jackson, Robyn R.

    2010-01-01

    Starting where your students are means understanding how currencies are negotiated and traded in the classroom. Any behavior that students use to acquire the knowledge and skills needed in the classroom functions as currency. Teachers communicate the kinds of currencies they accept in their classrooms, such as getting good grades; students do…

  4. Engaging Students in Online Activities

    DEFF Research Database (Denmark)

    Egendal, Jeppe Michael

    This study investegates how the educational design of online study activities affects students’ social and academic engagement in connection to their study? The study uses a hermenutical approach, using recordings of online sessions of student collaborations and interviews with students as methods...... for understanding student engagement...

  5. Amplifying Student Learning through Volunteering

    Science.gov (United States)

    McFadden, Amanda; Smeaton, Kathleen

    2017-01-01

    Student volunteer experiences are ubiquitous within higher education contexts. Despite this, there is further scope for understanding the qualitatively different ways students experience volunteering. To achieve this an explicit focus on understanding volunteer experiences from the students' perspective and the relationship these experiences have…

  6. Inviting Student Engagement with Questioning

    Science.gov (United States)

    Caram, Chris A.; Davis, Patsy B.

    2005-01-01

    Teaching is about designing, creating, and inventing intellectually challenging work for students--work that engages students and is so compelling that students persist when they experience difficulty and feel satisfaction, indeed delight, when they successfully accomplish the challenge (Schlechty 1997). Whether thinking skills are taught…

  7. Helping Students Discuss Race Openly

    Science.gov (United States)

    Landsman, Julie

    2016-01-01

    One way teachers can disrupt inequities is by doing the work to foster discussions in which students talk about race--and racism--honestly together. Teachers also need to be ready to talk with students sensitively when the subject of race comes up spontaneously--in a student's work, connected to events outside school, or in response to a…

  8. Screening College Students for Hypercholesterolemia.

    Science.gov (United States)

    Faigel, Harris C.

    1992-01-01

    Describes one college's mandatory mass cholesterol screening for new students. Each year, over 30 beginning students with unknown hypercholesterolemia were detected. The program suggests that mass screening efficiently and economically identifies students who would benefit from cholesterol reduction, a modifiable risk in coronary artery disease.…

  9. The Music Student with Epilepsy

    Science.gov (United States)

    Murdock, Matthew C.; Morgan, Joseph A.; Laverghetta, Thomas S.

    2012-01-01

    The teacher-student relationship can afford the music educator an opportunity to be the first to identify behaviors associated with epilepsy. A case of a student with epilepsy, based on the authors' experience, is described in which the music educators were the first and only individuals to become aware of a change in the student's behavior, after…

  10. Supporting Families to Support Students

    Science.gov (United States)

    Kelly, John; Rossen, Eric; Cowan, Katherine C.

    2018-01-01

    Collaboration between students' families and the school is an essential component to promoting student mental and behavioral health. Many schools structure their mental health services using a Multi-Tiered System of Supports that offers three different tiers of support from universal supports to personalized help for students with serious…

  11. Adding Value: Online Student Engagement

    Science.gov (United States)

    Everett, Donna R.

    2015-01-01

    This paper seeks to add to the emerging literature related to online student engagement with additional suggestions for instructional strategies. Student engagement is one of the tenets of effective online instruction; as such, particular attention to how it adds value to student learning is crucial and worth the time and effort to enhance…

  12. Creativity among Geomatical Engineering Students

    Science.gov (United States)

    Keh, Lim Keng; Ismail, Zaleha; Yusof, Yudariah Mohammad

    2017-01-01

    This research aims to find out the creativity among the geomatical engineering students. 96 geomatical engineering students participated in the research. They were divided into 24 groups of 4 students. Each group were asked to solve a real world problem collaboratively with their creative thinking. Their works were collected and then analysed as…

  13. Encouraging Students to Read Mathematics

    Science.gov (United States)

    Shepherd, Mary D.

    2005-01-01

    It is generally agreed that the ability to read mathematics is an important skill--one that few of our students possess. A number of people have published some suggestions for helping students learn to read their mathematics textbooks. What these have in common is suggestions for getting students more active while reading. Using these resources as…

  14. Alternate Theory Formation by Students.

    Science.gov (United States)

    Hanson, R. Keith

    Video tapes of student teachers micro-teaching in a high school biology class were analyzed. Attention was focussed on students' interpretations of data and the teacher's responses to these interpretations. Examples are given of student explanations which teachers find unsatisfactory but which are valid alternatives based on the data available to…

  15. Journal of College Student Development

    OpenAIRE

    Janosik, S. M.; Gehring, D. D.

    2003-01-01

    In this national study on the impact of the Clery Campus Crime Disclosure and Reporting Act, 305 college administrators distributed questionnaires to 9,150 undergraduate students. Student knowledge of the Act and changes in student behavior were minimal and varied by gender, victim status, institution type, and institution size.

  16. Reconsidering Asian American Student Development

    Science.gov (United States)

    Kodama, Corinne M.; Maramba, Dina C.

    2017-01-01

    This chapter addresses the applicability of student development theories in light of empirical research on Asian American college students through a twofold approach: (a) revisiting the relevance of Kodama, McEwen, Liang, and Lee's (2001, 2002) theoretical work on Asian American student development; and (b) using Jones' and Stewart's (2016)…

  17. Engaging Students in Quality Games

    Science.gov (United States)

    Henninger, Mary L.; Richardson, Karen Pagnano

    2016-01-01

    Promoting student engagement for all students in physical education, and specifically in game play, is a challenge faced by many middle and high school physical education teachers. Often, the games we play in physical education are not "good games" because, as early as middle school, some students are already resistant to playing…

  18. Assessing Business Student Thinking Skills

    Science.gov (United States)

    Smith, Gerald F.

    2014-01-01

    The development of student thinking skills is a major goal of business education. As with other such goals, student outcomes assessment must be undertaken to measure goal achievement. Thinking is difficult to teach; it is also difficult to assess. The purpose of this article is to improve management educators' understanding of student thinking…

  19. Exploring Student Self-Plagiarism

    Science.gov (United States)

    Halupa, Colleen M.

    2014-01-01

    Student self-plagiarism is a confusing issue for both faculty and students alike. This problem is compounded because both groups perceive the concept very differently. Recent literature regarding these perceptions is reviewed and some brief preliminary results of an exploratory multi-university study of student perceptions of self-plagiarism are…

  20. Self Perceptions of Student Activists

    Science.gov (United States)

    Astin, Helen S.

    1971-01-01

    This study examines personality differences and similarities between student groups in protest activities by comparing activists to student leaders and random students. Results indicate many similarities in personality dimensions but protesters are more adventurous, autocratic and individualistic. They are also more spontaneous and irresponsible.…

  1. Student difficulties with Gauss' law

    Science.gov (United States)

    Kanim, Stephen

    2000-09-01

    Many students in introductory courses have difficulty solving Gauss' law problems. Through interviews with students and analysis of solutions to homework and examination questions we have identified some specific conceptual difficulties that often contribute to students' inability to solve quantitative Gauss' law problems. We give examples of common difficulties and discuss instructional implications.

  2. Improving Student Awareness and Performance.

    Science.gov (United States)

    Brown, Dale; Bateman, David N.

    1978-01-01

    Through the student activities of the Profession and Career Package (PAC), general principles taught in an introductory business course, "Principles of Management," are made relevant to students' future career plans. The development of the PAC approach, its objectives, and student reaction to this method are discussed. (JMD)

  3. STUDENTS: COMMUNICATION AND PEACE CULTURE

    Directory of Open Access Journals (Sweden)

    Elizabeth Arapé Copello

    2008-11-01

    Full Text Available This paper shows a research about Communication and Peace Culture developed with Venezuelan students. We did a theoretical review and field-work with students. We are looking for visions and perceptions about communication to peace from students. The research is focused on three student groups who live near of Venezuela frontier. We work with three test: (COMPAZ-1, Peace Builder and Learning to Dialoguing. The students show changes in their initials perceptions after the workshop. The experience developed that short training could be useful to be better the communication behavior as support of peace project.

  4. Emotions in veterinary surgical students

    DEFF Research Database (Denmark)

    Langebæk, Rikke; Eika, Berit; Pedersen, Lene Tanggaard

    2012-01-01

    A surgical educational environment is potentially stressful and can negatively affect students' learning. The aim of the present study was to investigate the emotions experienced by veterinary students in relation to their first encounter with live-animal surgery and to identify possible sources...... of positive and negative emotions, respectively. During a Basic Surgical Skills course, 155 veterinary fourth-year students completed a survey. Of these, 26 students additionally participated in individual semi-structured interviews. The results of the study show that students often experienced a combination...

  5. Students individual engagement in GIS

    DEFF Research Database (Denmark)

    Madsen, Lene Møller; Christiansen, Frederik V; Rump, Camilla Østerberg

    2014-01-01

    This paper develops two sets of concepts to theorize why students engage differently in Geographical Information Systems (GIS). These theoretical concepts are used as an analytical lens to explore empirical data on the experiences and engagement of students enrolled in an undergraduate GIS course...... in planning and management. The analysis shows that both the theoretical perspectives and the custom and didactical contract are important to understand students' engagement in GIS. However, it is the personal desiderata that are the key to understanding the students' different engagement. Further, a temporal...... dimension and contextual awareness are important in understanding students' engagement in a broader perspective....

  6. Student Scientific Conference 2000. Abstracts of papers of students and post-graduate students

    International Nuclear Information System (INIS)

    Ilias, M.

    2000-04-01

    The aim of the Student Scientific Conference was review of works of students and post-graduate students from universities of the Slovak Republic and Czech Republic. The proceedings of the conference contain 43 abstracts of Biological Section, 69 abstracts of Chemical Section, 18 abstracts of Environmental Section, 15 abstracts of Geography and Cartography Section, and 31 abstracts of Geology Section

  7. Student active teaching

    DEFF Research Database (Denmark)

    Rasmussen, Jens

    to the surface (Best, 2006). In order to avoid fads, fancy and personal bias in education the science of teaching has gained ground over the last decades. Today we have from research and especially from syntheses of research results quite much evidence on what works and to what degree it works. This presentation...... will give a brief introduction to meta-analyses and syntheses of educational research related to student achievement (Hattie, 2009, 2011). And then point to teaching methods that are manageable in classes of any size, are engaging to students, and qualified for increasing and developing students’ abilities......It seems unsatisfactory that much teaching practice is based on ideas with only weak or sometimes even no documentation for their effect. Many resources in terms of money and time have been lost on implementing ideas that after a short while must be dropped because they did not function well...

  8. Fellows, Associates & Students Programmes

    CERN Document Server

    2005-01-01

    The present document reviews the CERN Fellows, Associates and Students Programmes emphasizing the developments since 2000, when the previous review was presented to the Scientific Policy Committee, Finance Committee and Council (CERN/2325), and makes proposals for the coming five years. In summary, it is proposed to â?¢ Simplify the payment scheme for the Paid Scientific Associates Programme, which will no longer depend on candidateâ??s home support and age; â?¢ Broaden the scope of the Fellowship Programme, in order to facilitate the recruitment of young graduates in computing and engineering. Age-related eligibility conditions and payment levels will be replaced with experience-based criteria; â?¢ Modify subsistence rates for the Doctoral and Technical Student Programme in order to harmonize CERNâ??s payment levels with those offered by other research establishments. This document is presented for discussion and recommendation by the Scientific Policy Committee and approval by the Council. Additiona...

  9. Developing student awareness:

    DEFF Research Database (Denmark)

    Bagger, Bettan; Taylor Kelly, Hélène; Hørdam, Britta

    Danish academic regulations emphasize a dynamic theory- practice relation in the nursing education. The nursing program is based upon the close collaboration and development of the scholastic and clinical spheres. Attempts to improve patient safety emphasize the critical role that the systematic...... reporting of clinical errors can play. This is not only a national but also an international priority as millions of patients worldwide suffer injury or death due to unsafe care. A project in co-operation with clinical practice and University College Sealand’s research and development department attempts...... to optimize the theory-practice connection while developing students’ competencies with respect to the reporting of clinical errors. Quantitative data from the involved students and clinical advisors is collected in order to measure the effect of the intervention. Student knowledge, awareness and experiences...

  10. Matching Students to Schools

    Directory of Open Access Journals (Sweden)

    Dejan Trifunovic

    2017-08-01

    Full Text Available In this paper, we present the problem of matching students to schools by using different matching mechanisms. This market is specific since public schools are free and the price mechanism cannot be used to determine the optimal allocation of children in schools. Therefore, it is necessary to use different matching algorithms that mimic the market mechanism and enable us to determine the core of the cooperative game. In this paper, we will determine that it is possible to apply cooperative game theory in matching problems. This review paper is based on illustrative examples aiming to compare matching algorithms in terms of the incentive compatibility, stability and efficiency of the matching. In this paper we will present some specific problems that may occur in matching, such as improving the quality of schools, favoring minority students, the limited length of the list of preferences and generating strict priorities from weak priorities.

  11. Today's students, tomorrow's practitioners

    DEFF Research Database (Denmark)

    Heape, Chris

    2015-01-01

    an alternative understanding of collaborative design practice as participatory inquiry. The paper suggests that participatory inquiry, as it more fully takes into account the learning driven and relational nature of design practice, could help inform alternative design educational strategies.......There is an inherent dilemma that some research indicates ways and means of doing design practice, in particular how practitioners bring what this paper identifies as informal resources into play, that are seldom reflected in how and what design students are taught or learn. The question is posed...... as to whether today’s design students are in fact equipped to be tomorrow’s practitioners. This paper introduces a range of literature and empirical observations that describe a number of different appreciations of process and practice, from both design and non-design perspectives. This in order to draw up...

  12. Students' conceptions about force

    International Nuclear Information System (INIS)

    Soeguet, Oe.

    2005-01-01

    Students from a young age have developed in their own minds differing concepts of things such as all creatures having a soul. Also children see the environment and interpret what they see according to their own understanding and explanation. In particular, with regards to physics, things like light, heat, motion, structure of matter and energy are understood at the level of a child s comprehension. Most often the child s understanding varies quite differently from the actual true meaning. As a result the child is reluctant to accept any other explanation. In such situations the necessary difficulties must be tackled with care and caution pertinent to the individual. Studies at K.S.U University related to force and motion of various departments in the Faculty of Science and Letters have been investigated. After evaluations of all the findings a number of suggestions have been made to change student views and ideas

  13. Chinese Journalism Students

    DEFF Research Database (Denmark)

    Dombernowsky, Laura Møller

    2014-01-01

    As important providers of information, analysis of current events and debates, journalists are subject to high expectations regarding their professional values. Journalism is considered to be more than merely a career; it is construed as a profession that builds on personal commitment to serve...... 2012 with 41 students studying journalism at People's University, Tsinghua University, China Youth University for Political Sciences, Central University for Nationalities, Beijing Foreign Languages University and Chinese Academy of Social Sciences in Beijing and at Fudan University in Shanghai....

  14. Alcohol Consumption in Students

    OpenAIRE

    Tran, Cathy

    2010-01-01

    Drinking behaviour among university students is a serious public health concern. Reasons for drinking are complex and many factors contribute to this behaviour. Previous research has established links between personality factors and alcohol consumption and also between metacognitions and alcohol consumption. Few studies have looked into how personality traits and metacognitions interact. This study investigated the relationships between personality, metacognitions and alcohol consumption in a...

  15. Helping Students Help Themselves

    Directory of Open Access Journals (Sweden)

    Pamela A. Marshall

    2012-08-01

    Full Text Available Review of: Three tools that aim to teach students more effective study habits: How to Get the Most Out of Studying: A Video Series by S.L. Chew, Study Smarter, Not Harder: Use the Genius in You, 3rd Edition by Kevin Paul, and How to Study Science 4th Edition by Frederick W. Drewes and Kristin L.D. Milligan.

  16. Student voice - Getting motivated.

    Science.gov (United States)

    Cowen, Emma

    2016-05-09

    ON THE whole, I consider myself a calm, logical person who rarely gets stressed. This stands me in good stead on placement, but it causes problems when it comes to the academic side of being a student. I rarely start work when I should. I have not yet started an essay the night before it is due, but it is unheard of for me to start an essay sooner than two weeks before it is due.

  17. Student Research Projects

    Science.gov (United States)

    Yeske, Lanny A.

    1998-01-01

    Numerous FY1998 student research projects were sponsored by the Mississippi State University Center for Air Sea Technology. This technical note describes these projects which include research on: (1) Graphical User Interfaces, (2) Master Environmental Library, (3) Database Management Systems, (4) Naval Interactive Data Analysis System, (5) Relocatable Modeling Environment, (6) Tidal Models, (7) Book Inventories, (8) System Analysis, (9) World Wide Web Development, (10) Virtual Data Warehouse, (11) Enterprise Information Explorer, (12) Equipment Inventories, (13) COADS, and (14) JavaScript Technology.

  18. Tom Brown appointed Dean of Students

    OpenAIRE

    Williams, Meghan

    2007-01-01

    James Thomas "Tom" Brown, former senior associate dean of the Dean of Students office, has been appointed as the Dean of Students. The Dean of Students office is responsible for the coordination of student advocacy, new student orientation and parent programs, and responding to student emergencies in collaboration with Judicial Affairs, Residence Life, Cook Counseling Center, Schiffert Health Center, and other departments and agencies.

  19. Students' perspectives on cyber bullying.

    Science.gov (United States)

    Agatston, Patricia W; Kowalski, Robin; Limber, Susan

    2007-12-01

    The aim of this study was to gain a better understanding of the impact of cyber bullying on students and the possible need for prevention messages targeting students, educators, and parents. A total of 148 middle and high school students were interviewed during focus groups held at two middle and two high schools in a public school district. The focus groups were approximately 45 minutes in length. Students were divided by gender and asked a series of scripted questions by a same-gender student assistance counselor. We found that students' comments during the focus groups suggest that students-particularly females-view cyber bullying as a problem, but one rarely discussed at school, and that students do not see the school district personnel as helpful resources when dealing with cyber bullying. Students are currently experiencing the majority of cyber bullying instances outside of the school day; however there is some impact at school. Students were able to suggest some basic strategies for dealing with cyber bullying, but were less likely to be aware of strategies to request the removal of objectionable websites, as well as how to respond as a helpful bystander when witnessing cruel online behavior. We conclude that school districts should address cyber bullying through a combination of policies and information that are shared with students and parents. Schools should include cyber bullying as part of their bullying prevention strategies and include classroom lessons that address reporting and bystander behavior.

  20. Nursing students assess nursing education.

    Science.gov (United States)

    Norman, Linda; Buerhaus, Peter I; Donelan, Karen; McCloskey, Barbara; Dittus, Robert

    2005-01-01

    This study assessed the characteristics of nursing students currently enrolled in nursing education programs, how students finance their nursing education, their plans for clinical practice and graduate education, and the rewards and difficulties of being a nursing student. Data are from a survey administered to a national sample of 496 nursing students. The students relied on financial aid and personal savings and earnings to finance their education. Parents, institutional scholarships, and government loans are also important sources, but less than 15% of the students took out bank loans. Nearly one quarter of the students, particularly younger and minority students, plan to enroll in graduate school immediately after graduation and most want to become advanced nursing practitioners. Most of the nursing students (88%) are satisfied with their nursing education and nearly all (95%) provided written answers to two open-ended questions. Comments collapsed into three major categories reflecting the rewards (helping others, status, and job security) and three categories reflecting the difficulties (problems with balancing demands, quality of nursing education, and the admissions process) of being a nursing student. Implications for public policymaking center on expanding the capacity of nursing education programs, whereas schools themselves should focus on addressing the financial needs of students, helping them strike a balance among their school, work, and personal/family responsibilities and modifying certain aspects of the curriculum.

  1. Students catch cosmic rays

    CERN Multimedia

    2007-01-01

    Students from the USA’s QuarkNet programme install their muon detector in the CMS visitors centre. The detector built by high school students and teachers with CMS collaborators from Notre Dame University. From left to right: Danielle McDermott, Tony Coiro, Dan Karmgard, Jeff Chorny, Barry Baumbaugh, Mike McKenna and Caleb Phillips.For high-school students, summer usually means heading to the beach and hanging out with friends. But this year, Tony Coiro and Caleb Phillips had different plans. They enrolled in the QuarkNet programme and spent the summer creating a tabletop muon detector that is now on display in the CMS visitors gallery, and last week they were here to install it. "I loved the programme, absolutely loved it," said Tony. "We started in mid-June and worked up to 2 August - it was five days a week, five and a half hours a day, but I enjoyed every minute of it." QuarkNet is a national programme in the United States ...

  2. Mobbing of Working Students

    Directory of Open Access Journals (Sweden)

    Alessandra Rodrigues Jacoby

    2014-04-01

    Full Text Available Workplace mobbing has become a common topic. Taking into account the increasing reports of this act, this study was aimed at investigating the prevalence of mobbing in relation to university students who work and also ascertaining the most frequent biosociodemographic and work characteristics of the group of workers who were mobbed. The sample was composed of 457 working students living in the metropolitan area of Porto Alegre, in the state of Rio Grande do Sul, and usedas instruments a Biosociodemographic and Employment questionnaire and the Negative Acts Questionnaire (NAQ. It could be observed that 89.3% of the students had a mobbing score according to the NAQ – objective measure. As per the subjective measure, 11.2% of the participants stated to having beenmobbed. High rates of the practice of hostile acts in the workplace can be noted, but these are often viewed as mundane and normal acts in the workplace. In conclusion, it is necessary to seek alternatives in order to overcome this problem, which already affects a significant number of workers.

  3. Online Access Patterns and Students

    Directory of Open Access Journals (Sweden)

    Nasir Butrous

    2011-04-01

    Full Text Available The paper follows accessing patterns of five cohorts of postgraduate students enrolled in a core unit within a master of business administration (MBA program. The unit is designed to provide numerous opportunities for student participation in Discussion Boards using Blackboard technology. Discussion Boards create numerous opportunities for interaction amongst online learners to share and exchange their experiences, creating a sense of a virtual community. Relationships between accessing patterns for each week of the semester for each student are explored in relation to their performance using course statistics generated by the Blackboard technology. Close examination of the significant differences in access patterns to the course window and its components of communication, content, and student areas reveal middle of the semester (week 7 as the common critical point that differentiates high achieving students from low achieving students. Identifying critical points provides the faculty staff member an opportunity to introduce intervention strategies in order to improve the learning experience of all the students.

  4. Dental students--dental advocates.

    Science.gov (United States)

    Bensch, Brittany

    2010-01-01

    Student advocacy and involvement in the political process is built into the structure of the American Student Dental Association (ASDA), especially in its Legislative Grassroots Network and an internal communication network among students to ensure political awareness. Students are concerned with such issues as a universally accepted, non-patient-based licensure process, mid-level providers, loan availability and tax deductibility, financial support for schools, and service early in one's professional career (giving forward rather than giving back). Through collaboration with the American Dental Education Association and with many state associations, students participate in lobbying, awareness campaigns, and behind the scenes as legislative aids. Although students share the same love for the profession that animates established practitioners, they are perceived by legislators as being different. Students are involved in the legislative process because it represents their future.

  5. In search of student time

    DEFF Research Database (Denmark)

    Bengtsen, Søren Smedegaard; Sarauw, Laura Louise; Filippakou, Ourania

    education policy debates, together with recent studies that highlight the interplay between different forms of political and institutional engagement with student temporality and students’ understandings of time in their higher education learning trajectories. As Gibbs et al argue (2015) universities......, activity templates, attendance charts, and assessment programmes for effective learning and teaching. The management of student time also becomes a management of student place (telling students not only when to be, but also where to be), of student thinking (fusing epistemology with study progress reforms...... of ‘duration’ to argue that student temporality always takes the form of lived time. Here, time is experiental and existential, and therefore bound by and embedded within individual perceptions and specific learning contexts. From a Bergsonian perspective, students do not apply time as an organising tool...

  6. Geriatric and Student Perceptions following Student-led Educational Sessions

    Directory of Open Access Journals (Sweden)

    Kristin Janzen

    2018-01-01

    Full Text Available Objective: The objective of this study was to measure the effect of student-led educational events on geriatric patient and student participant perceptions in a community setting. Methods: Students led three events at a senior community center, focusing on learning and memory, sleep hygiene, and arthritis pain. The participants were geriatric patients who themselves were providers of support to homebound peers (“clients” through an independently organized program. Geriatric participants completed pre- and post-event surveys to measure changes in familiarity with the topics. Student participants also completed pre- and post-event surveys that tracked changes in their comfort in working with the geriatric population. Results: Each event demonstrated at least one positive finding for geriatric patients and/or their clients. Students reported increased comfort in working with and teaching the geriatric population following the first and third events, but not the second. Conclusion: Student-led educational sessions can improve perceived health-related knowledge of geriatric participants while simultaneously exposing students to the geriatric patient population. Overall, both students and geriatric participants benefited from these events. Practice Implications: Incorporation of single, student-led educational events could be mutually beneficial to students and the elderly population in the community and easily incorporated into any healthcare curriculum. Funding:This work was supported by a Butler University Innovation Fund Grant. Treatment of Human Subjects: IRB review/approval required and obtained   Type: Original Research

  7. A student-initiated and student-facilitated international health elective for preclinical medical students

    Directory of Open Access Journals (Sweden)

    Nirali Vora

    2010-02-01

    Full Text Available Introduction: Global health education is becoming more important for developing well-rounded physicians and may encourage students toward a career in primary care. Many medical schools, however, lack adequate and structured opportunities for students beginning the curriculum. Methods: Second-year medical students initiated, designed, and facilitated a pass–fail international health elective, providing a curricular framework for preclinical medical students wishing to gain exposure to the clinical and cultural practices of a developing country. Results: All course participants (N=30 completed a post-travel questionnaire within one week of sharing their experiences. Screening reflection essays for common themes that fulfill university core competencies yielded specific global health learning outcomes, including analysis of health care determinants. Conclusion: Medical students successfully implemented a sustainable global health curriculum for preclinical student peers. Financial constraints, language, and organizational burdens limit student participation. In future, long-term studies should analyze career impact and benefits to the host country.

  8. A student-initiated and student-facilitated international health elective for preclinical medical students.

    Science.gov (United States)

    Vora, Nirali; Chang, Mina; Pandya, Hemang; Hasham, Aliya; Lazarus, Cathy

    2010-02-15

    Global health education is becoming more important for developing well-rounded physicians and may encourage students toward a career in primary care. Many medical schools, however, lack adequate and structured opportunities for students beginning the curriculum. Second-year medical students initiated, designed, and facilitated a pass-fail international health elective, providing a curricular framework for preclinical medical students wishing to gain exposure to the clinical and cultural practices of a developing country. All course participants (N=30) completed a post-travel questionnaire within one week of sharing their experiences. Screening reflection essays for common themes that fulfill university core competencies yielded specific global health learning outcomes, including analysis of health care determinants. Medical students successfully implemented a sustainable global health curriculum for preclinical student peers. Financial constraints, language, and organizational burdens limit student participation. In future, long-term studies should analyze career impact and benefits to the host country.

  9. Ways optimization physical activity students

    Directory of Open Access Journals (Sweden)

    Vasilij Sutula

    2014-12-01

    Full Text Available Purpose: on the basis of the analysis of results of poll of students, first, to define structure and the importance of the factors influencing formation of motivation at them to sports and sports activity, secondly, to allocate possible subjects for extension of the maintenance of theoretical and methodical-practical components of sports formation of student's youth. Material and Methods: the study involved students of first and second courses of the Institute for training bodies and the Faculty of Law of the National University №9 Yaroslav the Wise and the students of the Kyiv National University of Culture and Arts and Zhytomyr State University named after Ivan Franko. Results: it is established that during training at national law university interests of students concerning factors which motivate them to sports and sports activity significantly change. The analyses data testify that a key factor which prevents students to be engaged in sports and sports activity, lack of free time is. It is proved that students consider necessary to receive information on the physical state. Conclusions: results of research allowed allocating the most significant factors which motivate students to be engaged in sports and sports activity. It is established subjects of theoretical and methodical and practical components of sports education which interest students of NLU and KNUCA and ZSU. It is shown that for students of Law University of importance topic of theoretical and methodological and practical components of physical education strongly depends on the year of their training.

  10. Health, sustainability and student travel.

    Science.gov (United States)

    Green, Gill; Morris, Jenny; Wade, Margaret

    2012-01-01

    A survey of 246 pre-registration nursing students in a University in the South West of England was carried out to explore the impact of course related travel on the student experience. Results from the survey indicated that students' main mode of transport to practice placements was by car which reflects the rural nature of the South West and the relative paucity of public transport. Long distances that many students travel to their study centre and to placements, and the concurrent financial strain that this creates, impacted negatively on the student experience. Students recognised the need to travel to a place of study and clinical placements and suggestions of minimising the negative impact of travel were offered. These included the increased use of electronic delivery of lectures, attendance at local university premises, the provision of shared transport to placements and placements closer to the student's home. Few students, however, considered the environmental impact of travel. Higher Education Institutions need to address issues of sustainability through promoting student wellbeing and taking steps to reduce greenhouse gas emissions. It is therefore important that student awareness of sustainability related issues is increased as well as focusing on reducing the environmental impact through organisational change. Copyright © 2011 Elsevier Ltd. All rights reserved.

  11. The Perceptions of Elementary School Teachers Regarding Their Efforts to Help Students Utilize Student-to-Student Discourse in Science

    Science.gov (United States)

    Craddock, Jennifer Lovejoy

    The purpose of this phenomenological study was to examine the perceptions of elementary teachers who teach science as opposed to science teacher specialists regarding their efforts to help students use student-to-student discourse for improving science learning. A growing body of research confirms the importance of a) student-to-student discourse for making meaning of science ideas and b) moving students' conceptual development towards a more scientific understanding of the natural world. Based on those foundations, the three research questions that guided this study examined the value elementary teachers place on student-to-student discourse, the various approaches teachers employ to promote the use of student-to-student discourse for learning science, and the factors and conditions that promote and inhibit the use of student-to-student discourse as an effective pedagogical strategy in elementary science. Data were gathered from 23 elementary teachers in a single district using an on-line survey and follow-up interviews with 8 teachers. All data were analyzed and evolving themes led to the following findings: (1) elementary teachers value student-to-student discourse in science, (2) teachers desire to increase time using student-to-student discourse, (3) teachers use a limited number of student-to-student discourse strategies to increase student learning in science, (4) teachers use student-to-student discourse as formative assessment to determine student learning in science, (5) professional development focusing on approaches to student-to-student discourse develops teachers' capacity for effective implementation, (6) teachers perceive school administrators' knowledge of and support for student-to-student discourse as beneficial, (7) time and scheduling constraints limit the use of student-to-student discourse in science. Implications of this study included the necessity of school districts to focus on student-to-student discourse in science, provide teacher and

  12. Student assistantships: bridging the gap between student and doctor

    Directory of Open Access Journals (Sweden)

    Crossley JGM

    2015-06-01

    Full Text Available James GM Crossley,1,2 Pirashanthie Vivekananda-Schmidt1 1University of Sheffield School of Medicine, Sheffield, 2Chesterfield Royal Hospital NHS Foundation Trust, Chesterfield, UK Abstract: In 2009, the General Medical Council UK (GMC published its updated guidance on medical education for the UK medical schools – Tomorrow's Doctors 2009. The Council recommended that the UK medical schools introduce, for the first time, a clinical placement in which a senior medical student, “assisting a junior doctor and under supervision, undertakes most of the duties of an F1 doctor”. In the UK, an F1 doctor is a postgraduation year 1 (PGY1 doctor. This new kind of placement was called a student assistantship. The recommendation was considered necessary because conventional UK clinical placements rarely provided medical students with opportunities to take responsibility for patients – even under supervision. This is in spite of good evidence that higher levels of learning, and the acquisition of essential clinical and nontechnical skills, depend on students participating in health care delivery and gradually assuming responsibility under supervision. This review discusses the gap between student and doctor, and the impact of the student assistantship policy. Early evaluation indicates substantial variation in the clarity of purpose, setting, length, and scope of existing assistantships. In particular, few models are explicit on the most critical issue: exactly how the student participates in care and how supervision is deployed to optimize learning and patient safety. Surveys indicate that these issues are central to students' perceptions of the assistantship. They know when they have experienced real responsibility and when they have not. This lack of clarity and variation has limited the impact of student assistantships. We also consider other important approaches to bridging the gap between student and doctor. These include supporting the

  13. The contribution of student affairs: A student leader perspective

    African Journals Online (AJOL)

    being a student activist. It was the time post the mergers in higher education; it was a very charged atmosphere I think on both sides, on the management side and on the other side as a student leader. So I decided to run for Students' Representative Council (SRC). I got in as vice-president and in the second year I ran again ...

  14. Green Capital: Student Capital student-led evaluation

    OpenAIRE

    Runkle, Q.; Haines, T.; Piper, K.; Leach, S.

    2016-01-01

    To assess and evaluate the impact of the Green Capital: Student Capital project, the partnership (the University of the West of England, the University of Bristol, the Students’ Union at UWE, and Bristol Students’ Union) worked with NUS to train a team of students from both universities to lead an evaluation process. There were two key aims for the evaluation: \\ud \\ud • To verify the quantitative outputs of the Green Capital: Student Capital project; \\ud • And to make a qualitative assessment...

  15. [Medical students and psychiatry. A survey of students' opinion].

    Science.gov (United States)

    Giberti, F; Corsini, G; Rovida, S

    1994-06-01

    In the last years research on the didactics of Psychiatry and opinions of medical students on Psychiatry has gained great interest. The authors think that this research could be useful for the improvement of didactics, for better understanding the meanings of professional choice, the identity of psychiatrist and their relationship with colleagues in other medical field. The goal of this research work was a preliminary survey of Genoese University Medical Student's opinions about psychiatry didactics, and choice of specialization. A questionnaire was submitted to all the students who passed Clinical Psychiatry examination in the period from November 1987 to December 1988. The students were divided in two randomized groups: the first group of students (224) was submitted to the questionnaire immediately after Clinical Psychiatry examination; while to the second group of students (66) the questionnaire was mailed. The aim of the questions was to assess the student's opinions on psychiatry, psychoanalysis, psychotherapy, the career they wanted to take up, and the difficulties of studying psychiatry: 69% of the students of the first group and 42% of the students of the second group answered the questionnaire. Female students answered that they preferred psychiatric specialization more than their male colleagues did, but the difference has no statistical importance. In most cases, the students who answered that they have taken into account psychiatry as a choice of specialisation, are more interested in medical specialties (primary care, etc.) than in surgical specialties. Most of the medical students declare some emotional troubles (anxiety, sleeplessness, problem in social relations).(ABSTRACT TRUNCATED AT 250 WORDS)

  16. The contexts for student learning: international students in Denmark

    DEFF Research Database (Denmark)

    Hammershøy, Anna; Simonsen, Berit Elsebeth; Miller, Tanja

    The paper focuses on Service, Hospitality and Tourism management education programme at the University College of Northern Denmark. The English-taught international stream is developed in a local context, following a Danish curriculum and employing Danish instructors. The students originate...... primarily from Eastern and Central Europe and are not socialised in the North European educational culture. It takes these students more attempts to pass examinations compared to the Danish students, and their GPA is lower compared to the Danish students. The paper addresses the immediate learning context...

  17. Abstracts for student symposium

    Energy Technology Data Exchange (ETDEWEB)

    Goldman, B.

    1994-04-01

    Lawrence Livermore National Laboratory Science and Engineering Research Semester (SERS) students are participants in a national program sponsored by the DOE Office of Energy Research. Presented topics from Fall 1993 include: Laser glass, wiring codes, lead in food and food containers, chromium removal from ground water, fiber optic sensors for ph measurement, CFC replacement, predator/prey simulation, detection of micronuclei in germ cells, DNA conformation, stimulated brillouin scattering, DNA sequencing, evaluation of education programs, neural network analysis of nuclear glass, lithium ion batteries, Indonesian snails, optical switching systems, and photoreceiver design. Individual papers are indexed separately on the Energy Data Base.

  18. Outstanding Student Paper Awards

    Science.gov (United States)

    2004-04-01

    The following members in the Space Physics & Aeronomy Section received Outstanding Student Paper Awards at the 2003 AGU Fall Meeting in San Francisco, California. Arve Aksnes; Aroh Barjatya; Jacob Bortnik; Amir Caspi; Ruben Delgado; Galen Fowler; Paul G. Hanlon; Sid Henderson; Tara B. Hiebert; Chia-Lin Huang; Steven P. Joy; Eun-Hwa Kim; Colby Lemon; Yingjuan Ma; Elizabeth A. MacDonald; Jaco Minnie; Mitsuo Oka; Yoshitaka Okazaki; Erin J. Rigler; Ina P. Robertson; Patrick A. Roddy; Sang-Il Roh; Albert Y. Shih; Christopher Smithtro; Emma Spanswick; Maria Spasojevic; Hiroki Tanaka; Linghua Wang; Deirdre E. Wendel; Jichun Zhang>

  19. INTRODUCTION: GRADUATE STUDENT SCHOLARSHIP

    Directory of Open Access Journals (Sweden)

    Laverne Jacobs

    2015-02-01

    Full Text Available The Windsor Yearbook of Access to Justice is proud to publish issue 32 (1. This issue features a special section highlighting the scholarship of graduate students. While it is always a pleasure to read promising work by newer scholars in the fields of law and social justice, we are certain that this collection of articles represents some of the finest and thought-provoking scholarship stemming from current graduate students in law. The articles stem from a graduate student essay contest that WYAJ held in 2013 and for which we received many submissions. The collection of selected papers offers a view of legal and interdisciplinary research examining issues that are topically diverse but which are all of deep, long-term importance to the world of access to justice. A reader of the special section on Graduate Student Scholarship will find explorations of access to justice from the perspectives of equality rights, discretion, adjudication and methods of legal service delivery, to name a few. A prize was offered to two papers judged to be of exceptional quality. I am very pleased to announce that the winners of those two prizes are Andrew Pilliar, for his article “Exploring a Law Firm Business Model to Improve Access to Justice” and Blair A. Major, for his contribution, “Religion and Law in R v NS: Finding Space to Re-think the Balancing Analysis”. The Editorial Board thanks all those who submitted papers to the contest and to this final special issue of the Windsor Yearbook of Access to Justice. Another notable feature of this issue is the introduction of a section called Research Notes. The Yearbook will periodically publish peer-reviewed research notes that present the findings of empirical (quantitative, qualitative or mixed method research studies. This section aims to contribute to the growing and important body of empirical scholarship within the realm of access to justice socio-legal research. We hope that you enjoy

  20. Transforming students into digital academics

    DEFF Research Database (Denmark)

    Thorell, Maria; Fridorff-Jens, Peter Kindt; Lassen, Pia

    2015-01-01

    BACKGROUND: Little is known of students' Information and Communication Technology (ICT) readiness in a learning context. Information about students' capabilities and resources is an important prerequisite for designing meaningful teaching and learning activities that engage and motivate students....... To learn about health science students' usage of digital equipment, familiarity with software, online behavior and communication with the university, we have conducted a survey focusing on these areas. METHODS: A digital questionnaire was sent to 9134 health science students, of whom 1165 responded (12...... of chat users was 23.8 (Standard deviation 3.7) years, SMS users, 25 (Standard deviation 4.2) years and email users, 27.9 (Standard deviation 6.5) years. Over half of the students (53.4%) found that the degree of ICT incorporated in the teaching and learning activities was insufficient to provide them...

  1. Intercultural training of medical students.

    Science.gov (United States)

    van Wieringen, J.C.M.; Schulpen, T.W.J.; Kuyvenhoven, M.M.

    2001-01-01

    Until recently the Utrecht Medical School had a traditional curriculum with a predominantly biomedical orientation and strong emphasis on curative medicine. In 1997 an experimental 'Multi-cultural Family Attachment Course' started at the Utrecht Medical School with 20 second-year medical students. Each student was attached to a native Dutch and an ethnic minority family with a newborn or chronically ill child. In a period of 1.5 years students had to visit each family at home four times. The students monitored growth and development of the child and discussed several aspects of health and disease with the parents according to a structured schedule. In regular group sessions students reported back their experiences. In this way, the influence of socioeconomic circumstances, culture and environment on health becomes a real-life experience. This paper aims to describe some aspects of this pilot-course and the reactions of the students.

  2. Pharmacy Students' Attitudes Toward Debt.

    Science.gov (United States)

    Park, Taehwan; Yusuf, Akeem A; Hadsall, Ronald S

    2015-05-25

    To examine pharmacy students' attitudes toward debt. Two hundred thirteen pharmacy students at the University of Minnesota were surveyed using items designed to assess attitudes toward debt. Factor analysis was performed to identify common themes. Subgroup analysis was performed to examine whether students' debt-tolerant attitudes varied according to their demographic characteristics, past loan experience, monthly income, and workload. Principal component extraction with varimax rotation identified 3 factor themes accounting for 49.0% of the total variance: tolerant attitudes toward debt (23.5%); contemplation and knowledge about loans (14.3%); and fear of debt (11.2%). Tolerant attitudes toward debt were higher if students were white or if they had had past loan experience. These 3 themes in students' attitudes toward debt were consistent with those identified in previous research. Pharmacy schools should consider providing a structured financial education to improve student management of debt.

  3. FEATURES OF STUDENT PSYCHOLOGICAL COUNSELLING

    Directory of Open Access Journals (Sweden)

    Maria Dorina PASCA

    2013-10-01

    Full Text Available Student psychological counseling is one of the means to acknowledge student identity by employing counseling tools that allow the psychologist to make use of a set of skills essential in achieving envisaged outcomes. To act as counseling psychologist for students is to guide actions by the five wh- questions: who (the client is, why (the counselor is approached, who (the counselor talks to, what (problem the student has to tackle, how (the problem can be solved. Some of the most important features that contribute to solving student problems are the counselor’s deontology, trustworthiness and attitude that are to be relied on without impeding the client’s personality traits. Thus, developing awareness of the features underlying student psychological counseling and acting accordingly is the real test for any professional in the field. Therefore, the real challenge is not being in the lion’s den, but living with it.

  4. Dedicated education unit: student perspectives.

    Science.gov (United States)

    Nishioka, Vicki M; Coe, Michael T; Hanita, Makoto; Moscato, Susan R

    2014-01-01

    The study compared students' perceptions of their clinical learning experiences in a dedicated education unit (DEU) with their experiences in traditional clinical education. Unlike traditional academic-instructor models, expert nurses in the DEU provide clinical education to students with faculty support. This repeated measures design used student surveys, supplemented by focus group data. Students were more likely to agree that their clinical learning experience was high quality and they had a consistent mentoring relationship during DEU rotations. Students also reported the quality of the unit's learning environment, the leadership style of the nurse manager, and the nursing care on the unit was more favorable in DEUs than traditional units. Consistent with their changed role in DEUs, faculty members were less active in helping students integrate theory and practice. These findings provide additional evidence of the value that the DEU model contributes to high-quality clinical education.

  5. [Compassionate care for student nurses].

    Science.gov (United States)

    Cann, Lisa

    2016-05-01

    Nurses are practising in a work environment which is sometimes difficult and which can affect their capacity to supervise students. They may sometimes find themselves taking out their frustration on these students. By being better trained in the specificities of adult learning, frontline professionals and tutors could find it easier to adopt a compassionate care attitude towards nursing students, an essential condition for the development of their skills. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  6. Working with artistically gifted students

    OpenAIRE

    Dedukić, Sanja

    2014-01-01

    The thesis deals with the problem of detection, identification and the educational work of art gifted students. It is very important that these students are detected early and regarded as a separate group that has exceptional potential in the field of art and are thusly entitled to individualized adaptation within the primary education program. Namely, when working with gifted students, teachers are expected to utilize different forms of work in the classroom, which will encourage such studen...

  7. Academic Procrastination on Worker Students

    OpenAIRE

    Muzaqi, Sugito; Arumsari, Andini Dwi

    2017-01-01

    Academic procrastination is to delay the work in the academic field. Academic procrastination occurs because students who work less able to divide his time well, between work and college. Students who work doing academic procrastination because it is less able to regulate themselves. Self-regulation is the ability to control their own behavior and one of the prime movers of the human personality. In the process of self-regulation, academic procrastination students who need to understand the i...

  8. Another successful Doctoral Student Assembly

    CERN Multimedia

    Katarina Anthony

    2014-01-01

    On Wednesday 2 April, CERN hosted its third Doctoral Student Assembly in the Council Chamber.   CERN PhD students show off their posters in CERN's Main Building. Speaking to a packed house, Director-General Rolf Heuer gave the assembly's opening speech and introduced the poster session that followed. Seventeen CERN PhD students presented posters on their work, and were greeted by their CERN and University supervisors. It was a very successful event!

  9. International Student Migration to Germany

    OpenAIRE

    Donata Bessey

    2007-01-01

    This paper presents first empirical evidence on international student migration to Germany. I use a novel approach that analyzes student mobility using an augmented gravity equation and find evidence of strong network effects and of the importance of distance - results familiar from the empirical migration literature. However, the importance of disposable income in the home country does not seem to be too big for students, while the fact of being a politically unfree country decreases migrati...

  10. Developing scientist-practitioner students

    OpenAIRE

    Merdian, Hannah Lena; Miller, Kirsty

    2017-01-01

    At the University of Lincoln, we offer three undergraduate degrees in psychology: Psychology; Psychology with Clinical Psychology; and Psychology with Forensic Psychology. All three programmes are very positively perceived, by the students, teaching team, and external examiners. While the ‘with’ students show high satisfaction for the applied elements of their courses, they consistently rate the core psychology modules (common across the three programmes) lower than the Psychology students an...

  11. Information Access for Disabled Students

    OpenAIRE

    Cypaite, Asta; Šerkšnien, Justina; Rudžioniene, Jurgita

    2008-01-01

    Disabled students who makes relatively small part of the academic society are in risk to disappear among all other students, due to their communication and mobility difficulties have less possibilities to satisfy their needs, ensuring their rights to qualitative studies, equal opportunities in the labor market and social integration. A topic about information accessibility for disabled students is extremely important because of their information exclusion in their study process at the un...

  12. Does student debt affect dental students' and dentists' stress levels?

    Science.gov (United States)

    Boyles, J D; Ahmed, B

    2017-10-27

    Introduction Many studies have shown financial worries and debt to induce stress in individuals, this combined with the existing stress of being a dentist raises the question of how student debt affects students' and dentists' stress levels.Objectives Determine whether student debt has had any noticeable effect on student stress levels; investigate whether student debt has any effect on dentists' career choice; investigate whether the increase in tuition fees has influenced the number of applicants to study dentistry at the University of Birmingham.Method Anonymous questionnaires were completed by 70 4th year and 38 5th year BDS and 22 Dental Core Trainees (DCTs). Participants circled the response which best fitted their situation regarding statements on their level of stress and future career path. Ethical approval granted. Application figures to study dentistry obtained from head of admissions.Results Forty-two percent of males and 63% of females strongly agreed with the statement that having no debt would reduce their stress levels. Of those with debt >£40,000, 11% strongly agreed and 42% agreed that their total amount of student debt causes them stress. Whereas, those whose debt is stress. Seventy-seven percent of participants who had parental or family financial support reported this reduced their stress levels. Student debt was found to deter females from undertaking further study more than it deters males (P stressed about their total student loan(s) (P stress (P stress; students reporting a higher level of debt also report more stress and concern about paying off their student debt. Having no student debt would reduce stress levels, although to what extent is undetermined. Applications to study dentistry have fallen since the increase in tuition fees.

  13. Assessing student clinical learning experiences.

    Science.gov (United States)

    Nehyba, Katrine; Miller, Susan; Connaughton, Joanne; Singer, Barbara

    2017-08-01

    This article describes the use of an activity worksheet and questionnaire to investigate the learning experience of students on clinical placement. The worksheet measures the amount of time students spend in different learning activities, and the questionnaire explores student satisfaction and preferred learning activities. An activity worksheet and questionnaire … investigate[d] the learning experiences of students on clinical placement METHODS: The activity worksheet and questionnaire were used in a cohort pilot study of physiotherapy students on clinical placement. The activity worksheet provides details of the amount of time students engage in a range of clinical and non-clinical tasks while on placement, such as time spent treating patients, working individually, working with their peers and engaging in reflective practice. In combination with the questionnaire results, it allows clinicians to gain an understanding of the clinical learning environment experienced by their students. The data collected using these tools provide a description of the students' activities while undertaking the clinical placement. This information may guide the refinement of the clinical experience, and offers an opportunity to individualise learning activities to match students' needs and preferences. © 2016 John Wiley & Sons Ltd and The Association for the Study of Medical Education.

  14. Asian student migration to Australia.

    Science.gov (United States)

    Shu, J; Hawthorne, L

    1996-01-01

    "This paper presents an overview of Asian student migration to Australia, together with an analysis of political and educational aspects of the overseas student programme. It focuses on some significant consequences of this flow for Australia. The characteristics of key student groups are contrasted to provide some perspective of the diversity of historical and cultural backgrounds, with the source countries of Malaysia, Indonesia and PRC [China] selected as case studies. Since the issue of PRC students in Australia has attracted considerable public attention and policy consideration, particular focus is placed on their experience." (SUMMARY IN FRE AND SPA) excerpt

  15. Burnout syndrome among dental students.

    Science.gov (United States)

    Campos, Juliana Alvares Duarte Bonini; Jordani, Paula Cristina; Zucoloto, Miriane Lucindo; Bonafé, Fernanda Salloume Sampaio; Maroco, João

    2012-03-01

    The burnout syndrome is characterized by professional exhaustion and has been reported in college students. The aim of this study was to estimate the prevalence of Burnout Syndrome among dentistry students from a public university, and its relationship to socio-demographic characteristics. All students (n = 300) were invited to participate. We used the Maslach Burnout Inventory-Student Version (MBI-SS). We carried out an analysis of the MBI-SS' psychometric properties. Multivariate Analysis of Variance (MANOVA) was performed, followed by Analysis of Variance (ANOVA) and Tukey's post-hoc tests to compare the mean scores of burnout dimensions. Of the 235 participants, 72.8% were women and the mean age was 21.0 ± 1.8 years. The MBI-SS was reliable and valid. Of the students, 17.0% had Burnout Syndrome. There was a significant relation between Burnout Syndrome and a student's performance during the course (F = 4.433, p students most affected were those with poor performance, those who took medication because of studies, and those with thoughts of dropping the course. We concluded that the prevalence of the syndrome among dentistry students was high, with a significant relation between the syndrome and a student's academic performance, use of medication because of studies, and thoughts of dropping the course.

  16. Care of the college student.

    Science.gov (United States)

    Unwin, Brian K; Goodie, Jeffrey; Reamy, Brian V; Quinlan, Jeffrey

    2013-11-01

    There are approximately 20 million students in U.S. colleges and universities. Although this population is characterized as having good health, 600,000 students report some form of disability or some type of medical problem, including attention-deficit/hyperactivity disorder, learning disabilities, psychiatric disorders, and chronic illnesses, among others. Physicians can enhance youth transition to an adult model of health care; the use of self-care skills checklists is one recommended method to assist with the transition. Stimulant medications are effective for treating adults with attention-deficit/hyperactivity disorder, but physicians should use caution when prescribing stimulants to college students because of the high rates of medication diversion in this population. Depression, anxiety, posttraumatic stress disorder, sleep problems, and eating disorders are common in college students and can significantly impact performance. Emphasis on immunization of students for influenza, meningococcus, and pertussis is necessary because of the low rates of compliance. Screening and interventions for obesity, tobacco use, and substance abuse are important because of the high prevalence of these problems in college students. Screening for alcohol abuse facilitates identification of students with problem drinking behaviors. Students who are war veterans should be monitored for suicidal ideation and posttraumatic stress disorder. Lesbian, gay, bisexual, transgender, and questioning students are at risk of harassment and discrimination. Caution should be exercised when prescribing medications to college athletes to avoid violation of National Collegiate Athletic Association eligibility rules.

  17. Stress in medical students.

    Science.gov (United States)

    Nechita, Florina; Nechita, Dan; Pîrlog, Mihail Cristian; Rogoveanu, Ion

    2014-01-01

    Stress has been defined as the state of a body threatened by imbalance under the influence of agents or conditions endangering its homeostatic mechanisms but the concept have multiple meanings in correlation with the origin and biological support of its effects. Also, stressors are multiple, recording one of the highest levels during the academic studies. For the medical students, stress represents an important challenge, especially during the first year of medical school, caused by the absence of a learning strategy, the sleepless night before the exam and also an unhealthy food intake during the exams. The coping strategies are important, their background being represented by the social support, especially within the family, and emotional, the passions of the medicine students being the most important stress-combating factor. Gender represents also an important factor for the stress vulnerability, manifested through medical and psychiatric symptoms. In order to train good doctors, fair and above all healthy, it is important to consider not only the information we want to transmit, but also the context in which we educate.

  18. Students multicultural awareness

    Directory of Open Access Journals (Sweden)

    F.I Soekarman

    2016-12-01

    Full Text Available Multicultural awareness is the foundation of communication and it involves the ability of standing back from ourselves and becoming aware of our cultural values, beliefs and perceptions. Multicultural awareness becomes central when we have to interact with people from other cultures. People see, interpret and evaluate things in a different ways. What is considered an appropriate behaviour in one culture is frequently inappropriate in another one. this research use descriptive- quantitative methodology to indentify level of students multicultural awareness specifically will be identified by gender and academic years. This research will identify multicultural awareness based on differences of gender, academic years. This research use random and purposive random sampling of 650 students from university. These studies identify of multicultural awareness 34, 11, 4% in high condition, 84, 1% medium and 4, 5% in low. Further, there is a significant difference in the level of multicultural awareness based on gender and academic year. These findings could not be generalized because of the limited sample and ethnicity; it should need a wider research so that can be generalized and recommended the efforts to development and improvement of multicultural awareness conditions for optimization the services.

  19. Measuring student engagement among elementary students: pilot of the Student Engagement Instrument--Elementary Version.

    Science.gov (United States)

    Carter, Chandra P; Reschly, Amy L; Lovelace, Matthew D; Appleton, James J; Thompson, Dianne

    2012-06-01

    Early school withdrawal, commonly referred to as dropout, is associated with a plethora of negative outcomes for students, schools, and society. Student engagement, however, presents as a promising theoretical model and cornerstone of school completion interventions. The purpose of the present study was to validate the Student Engagement Instrument-Elementary Version (SEI-E). The psychometric properties of this measure were assessed based on the responses of an ethnically diverse sample of 1,943 students from an urban locale. Exploratory and confirmatory factor analyses indicated that the 4-factor model of student engagement provided the best fit for the current data, which is divergent from previous SEI studies suggesting 5- and 6-factor models. Discussion and implications of these findings are presented in the context of student engagement and dropout prevention. (PsycINFO Database Record (c) 2012 APA, all rights reserved).

  20. Making Meaning of Student Activism: Student Activist and Administrator Perspectives

    Science.gov (United States)

    Harrison, Laura M.; Mather, Peter C.

    2017-01-01

    College campuses have experienced a recent resurgence of student activism, particularly in response to some of President Donald Trump's executive orders as well as controversial speakers like Ann Coulter and Milo Yiannopoulous. Student activism presents both challenges and opportunities for higher education leaders seeking to engage productively…

  1. Student integration, persistence and success, and the role of student

    African Journals Online (AJOL)

    Student Engagement (SASSE) have highlighted the significance of learning communities as noted in Tinto's work. He conceived learning communities as interdisciplinary peer groups that span the social and academic life contexts of students – from the curricular into the co-curriculum and thus, for example, into residences ...

  2. Engaging Marketing Students: Student Operated Businesses in a Simulated World

    Science.gov (United States)

    Russell-Bennett, Rebekah; Rundle-Thiele, Sharyn R.; Kuhn, Kerri-Ann

    2010-01-01

    Engaged students are committed and more likely to continue their university studies. Subsequently, they are less resource intensive from a university's perspective. This article details an experiential second-year marketing course that requires students to develop real products and services to sell on two organized market days. In the course,…

  3. Student Leadership Development within Student Government at Snow College

    Science.gov (United States)

    Wilson, Gordon Ned

    2010-01-01

    The purpose of this study was to describe the leadership development process of former student leaders at Snow College. More specifically, the study focused on understanding how, when, and where leadership development took place in their "lived experience" within the student government at Snow College (Van Manen, 1998). Examining the lived…

  4. Student-led leadership training for undergraduate healthcare students.

    Science.gov (United States)

    Sheriff, Ibrahim Hasanyn Naim; Ahmed, Faheem; Jivraj, Naheed; Wan, Jonathan C M; Sampford, Jade; Ahmed, Na'eem

    2017-10-02

    Purpose Effective clinical leadership is crucial to avoid failings in the delivery of safe health care, particularly during a period of increasing scrutiny and cost-constraints for the National Health Service (NHS). However, there is a paucity of leadership training for health-care students, the future leaders of the NHS, which is due in part to overfilled curricula. The purpose of this study was to assess the impact of student-led leadership training for the benefit of fellow students. Design/methodology/approach To address this training gap, a group of multiprofessional students organised a series of large-group seminars and small-group workshops given by notable health-care leaders at a London university over the course of two consecutive years. Findings The majority of students had not previously received any formal exposure to leadership training. Feedback post-events were almost universally positive, though students expressed a preference for experiential teaching of leadership. Working with university faculty, an inaugural essay prize was founded and student members were given the opportunity to complete internships in real-life quality improvement projects. Originality/value Student-led teaching interventions in leadership can help to fill an unmet teaching need and help to better equip the next generation of health-care workers for future roles as leaders within the NHS.

  5. Student Research Projects Inhibiting Factors from the Students Perspective

    Directory of Open Access Journals (Sweden)

    Laila Nikrooz

    2012-09-01

    Full Text Available Background & Objective: Identifying the research barriers and assess the ability of students to use the university services and facilities is crucial to promote research activities. Present study was carried out to determine the inhibiting factors influencing the student's research projects from the view point of Yasuj University of Medical Sciences students in 2008. Materials & Methods: In this cross sectional study 96 students of Yasuj Medical University were selected by stratified random sampling. The data were collected by validate & reliable questionnaire, containing demographic information, inhibiting factors related to students (personal and organization. The data were analyzed by SPSS software. Results: The mean scores against the personal barriers and the organizational barriers questions were 43.23±12.96 and 62.58±12.08 respectively. There was a significant difference between personal and organizational barriers (P<0.001 and personal barriers were more important. According to the results, the student's inadequate skills & knowledge of research methodology and lack of awareness of research topics were the most prevalent personal barriers. The most prevalent organizational barriers were unavailability of research consulters, inadequate research skills of consulter, insufficient facilities & equipment and lack of motivating staff & faculties. Other variables such as gender, subject of study and research experience are mentioned in the full text. Conclusion: This study showed that the personal barriers were more important than organizational barriers which interfere with the student's research projects. This can be corrected and controlled by teachers, faculty members, university officials and students, themselves.

  6. Student Assistance Program Outcomes for Students at Risk for Suicide

    Science.gov (United States)

    Biddle, Virginia Sue; Kern, John, III; Brent, David A.; Thurkettle, Mary Ann; Puskar, Kathryn R.; Sekula, L. Kathleen

    2014-01-01

    Pennsylvania's response to adolescent suicide is its Student Assistance Program (SAP). SAP has been funded for 27 years although no statewide outcome studies using case-level data have been conducted. This study used logistic regression to examine drug-/alcohol-related behaviors and suspensions of suicidal students who participated in SAP. Of the…

  7. Universal Interventions for Students with ADHD--and All Students

    Science.gov (United States)

    Zelenka, Valerie

    2017-01-01

    This article describes effective classroom intervention strategies for students experiencing symptoms of attention-deficit/hyperactivity disorder (ADHD), regardless of the severity and whether the student has a diagnosis of ADHD. These suggestions incorporate the universal design for learning (UDL) framework. This framework does not limit…

  8. Student Teachers' Perceptions about Their Experiences in a Student ...

    African Journals Online (AJOL)

    independent learners with self-regulatory skills in order to be able to foster student ..... helped them socialize and build effective communication. Most of them reported ... of grouping students is believed to lead to higher self-esteem and better ...

  9. Student attendance and student achievement: a tumultuous and ...

    African Journals Online (AJOL)

    Administrator

    2001-12-21

    Dec 21, 2001 ... students must be present in school in order to benefit from academic program in .... attend class but passed with sometimes very high scores (e.g. 83% in CBS ..... done outside class or interaction forms, through online learning plat-form. ... also has obliged all journalism students to possess either an iPhone.

  10. Academic Students' Attitudes toward Students with Learning Disabilities

    Science.gov (United States)

    Gonen, Ayala; Grinberg, Keren

    2016-01-01

    Background: Learning disabilities (LD) are lifelong disabilities that affect all facets of a person's life. Aim: Identifying the relationship between academic students' attitudes toward learning disability, self-image, and selected factors. Methods: A questionnaire was distributed to 213 students from an academic center in Israel. Two different…

  11. Dual Enrollment for Low-Income Students: Exploring Student Perceptions

    Science.gov (United States)

    Felder, Theresa B.

    2017-01-01

    Most educators are keenly aware that a high socioeconomic status (SES) equates to better academic preparation than a low SES and high SES students are more likely to attain a college degree. One strategy for closing the higher education equity gap is to provide college-level courses to students while in high school through dual enrollment…

  12. Motivating Students in the 21st Century.

    Science.gov (United States)

    Sedden, Mandy L; Clark, Kevin R

    2016-07-01

    To examine instructors' and students' perspectives on motivation in the classroom and clinical environments and to explore instructional strategies educators can use to motivate college students in the 21st century. Articles selected for this review were from peer-reviewed journals and scholarly sources that emphasized student and educator perspectives on motivation and instructional strategies to increase student motivation. Understanding how college students are motivated can help educators engage students in lessons and activities, ultimately improving the students' academic performance. Students exhibit increased motivation in classes when educators have high expectations, conduct an open-atmosphere classroom, and use multidimensional teaching strategies. Instructional styles such as connecting with students, creating an interactive classroom, and guiding and reminding students improved student motivation. Radiologic science educators must be mindful of how college students are motivated and use various instructional strategies to increase students' motivation in the classroom and clinical setting. ©2016 American Society of Radiologic Technologists.

  13. Student Scientific Conference 2001. Abstracts of papers of students and post-graduate students

    International Nuclear Information System (INIS)

    Stankovicova, H.

    2001-04-01

    The aim of the Student Scientific Conference was to review the works of students and post-graduate students from universities of the Slovak Republic and Czech Republic as well as from Slovak Academy of Sciences and Czech Academy of Sciences. The proceedings of the conference contain 63 abstracts of Biological Section, 16 abstracts of Didactic Section, 39 abstracts of Environmental Section, 15 abstracts of Geography Section, 12 abstracts of Geology Section, and 42 abstracts of Chemical Section

  14. Student employment and study effort for engineering students

    DEFF Research Database (Denmark)

    Clemmensen, Line Katrine Harder; Harder, D. E.

    2015-01-01

    more than those in studies from e.g. UK and US [3, 4, 5]. A similar trend was seen in a study from Norway [6]. Government financial support seems to limit the amount of hours spent on paid work but not the percentage of students who take on paid work. Thus, full-time studies with benefits of increased...... capabilities and experience gained through employment could be aided by proper policies. Additionally, one of the highest impacts on study activity was the perceived study environment. As the engineering students have four hours per week of interaction with an instructor for each five ECTS...... to answer if the full-time student is under demise in these settings as opposed to settings without financial support [1, 2]. The research consisted of a web-based survey amongst all students at the Technical University of Denmark (DTU). The students in this survey had fewer employment hours and studied...

  15. Nursing students' approaches toward euthanasia.

    Science.gov (United States)

    Ozcelik, Hanife; Tekir, Ozlem; Samancioglu, Sevgin; Fadiloglu, Cicek; Ozkara, Erdem

    2014-01-01

    In Turkey, which is a secular, democratic nation with a majority Muslim population, euthanasia is illegal and regarded as murder. Nurses and students can be faced with ethical dilemmas and a lack of a legal basis, with a conflict of religious beliefs and social and cultural values concerning euthanasia. The aim of this study was to investigate undergraduate nursing students' attitudes towards euthanasia. The study, which had a descriptive design, was conducted with 600 students. The 1st, 2nd, 3rd, and 4th year nursing students at a school of nursing were contacted in May 2009, and 383 students (63.8% of the study population of a total of 600 students) gave informed consent. Two tools were used in accordance with questionnaire preparation rules. The majority of students were female and single (96.9%), and their mean age was 21.3 ± 1.5 years. A majority (78.9%) stated they had received no training course/education on the concept of euthanasia. Nearly one-third (32.4%) of the students were against euthanasia; 14.3% of the students in the study agreed that if their relatives had an irreversible, lethal condition, passive euthanasia could be performed. In addition, 24.8% of the students agreed that if they themselves had an irreversible, lethal condition, passive euthanasia could be performed. Less than half (42.5%) of the students thought that discussions about euthanasia could be useful. There was a significant relation between the study year and being against euthanasia (p euthanasia could be abused (p euthanasia was unethical (p euthanasia.

  16. Student Data Privacy: Building a Trusted Environment

    Science.gov (United States)

    Foundation for Excellence in Education, 2017

    2017-01-01

    The effective use of student data is essential for improving student outcomes and equipping educators with the information they need to help every student remain on a path to educational success. Student data can help teachers personalize and customize instruction, equip parents and students with information to make informed educational choices,…

  17. At-Risk Students Fact Sheet

    Science.gov (United States)

    Montana Office of Public Instruction, 2016

    2016-01-01

    Montana's definition of a basic system of quality public elementary and secondary schools includes educational programs for at-risk students (20-9-309, MCA). State statute defines an at-risk student as a "student who is affected by environmental conditions that negatively impact the student's educational performance or threaten a student's…

  18. Student Life Balance: Myth or Reality?

    Science.gov (United States)

    Doble, Niharika; Supriya, M. V.

    2011-01-01

    Purpose: Student life stress, student family conflict and student life balance are issues that are scarcely researched. This paper aims to develop a scale for assessing the concept of student life balance. Design/methodology/approach: The study evaluated a 54-item scale for assessing the construct. The data are obtained from 612 Indian students.…

  19. Mathematic Achievement of Canadian Private School Students

    Science.gov (United States)

    Cadigan, Francoise Jane; Wei, Yichun; Clifton, Rodney A.

    2013-01-01

    Very little Canadian research has examined the academic achievement of private school students. Data from The Programme for International Student Assessment (PISA) 2003 were used to examine the achievement of private school students. The study found that private school students outperformed their public school peers. In addition, the students'…

  20. Authentic Classroom Leaders: The Student Perspective

    Science.gov (United States)

    Downing, Megan S.

    2016-01-01

    In a qualitative study assessing students' perceptions of faculty-student interaction in the online learning environment, findings demonstrated that students make meaning of faculty-student interaction in ways that align with authentic leadership behaviors. Faculty interaction, or lack thereof, shaped students' perceptions of faculty authenticity…

  1. Discussing Poverty as a Student Issue: Making a Case for Student Human Services

    Science.gov (United States)

    Cady, Clare

    2012-01-01

    Student poverty is an issue with which far too many students are confronted. Student affairs professionals must increase their awareness of this human dynamic and develop programs, services, and personal knowledge to support students faced with this challenge.

  2. From students to researchers: The education of physics graduate students

    Science.gov (United States)

    Lin, Yuhfen

    This dissertation aims to make two research contributions: (1) In physics education research, this work aims to advance our understanding of physics student learning at the graduate level. This work attempts to better understand how physics researchers and teachers are produced, and what factors support or encourage the process of becoming a researcher and a teacher. (2) In cognitive science research in the domain of expert/novice differences, researchers are interested in defining and understanding what expertise is. This work aims to provide some insight into some of the components of expertise that go into becoming a competent expert researcher in the domain of physics. This in turn may contribute to our general understanding of expertise across multiple domains. Physics graduate students learn in their classes as students, teach as teaching assistants, and do research with research group as apprentices. They are expected to transition from students to independent researchers and teachers. The three activities of learning, teaching, and research appear to be very different and demand very different skill-sets. In reality, these activities are interrelated and have subtle effects on each other. Understanding how students transition from students to researchers and teachers is important both to PER and physics in general. In physics, an understanding of how physics students become researchers may help us to keep on training physicists who will further advance our understanding of physics. In PER, an understanding of how graduate students learn to teach will help us to train better physics teachers for the future. In this dissertation, I examine physics graduate students' approaches to teaching, learning, and research through semi-structured interviews. The collected data is interpreted and analyzed through a framework that focuses on students' epistemological beliefs and locus of authority. The data show how students' beliefs about knowledge interact with their

  3. The Student and His Parents

    Science.gov (United States)

    Bloom, Ellen; Kennedy, C. E.

    1970-01-01

    Responses to questionnaire to parents indicate that they want to know what is happening in the lives of their students, and students want them to know and understand. It is conceivable that the arena of personnel work may well extend to include more work with parents. (Author)

  4. Students Individual Engagement in GIS

    Science.gov (United States)

    Madsen, Lene Møller; Christiansen, Frederik; Rump, Camilla

    2014-01-01

    This paper develops two sets of concepts to theorize why students engage differently in Geographical Information Systems (GIS). These theoretical concepts are used as an analytical lens to explore empirical data on the experiences and engagement of students enrolled in an undergraduate GIS course in planning and management. The analysis shows that…

  5. Law and the Student Press.

    Science.gov (United States)

    Stevens, George E.; Webster, John B.

    Court cases and legal decisions involving the student press in the late 1960s and early 1970s are brought together in this book in order to show how the law has been applied to school officials and student journalists in high school, college, and the underground. The ten chapters cover the following topics: censorship, libel, obscenity, contempt,…

  6. Developing Students' Professional Digital Identity

    Science.gov (United States)

    Cochrane, Thomas; Antonczak, Laurent

    2015-01-01

    In contrast to the myth of the "Digital Native" and the ubiquity of Facebook use, we have found that students' digital identities are predominantly social with their online activity beyond Facebook limited to being social media consumers rather than producers. Within a global economy students need to learn new digital literacy skills to…

  7. Digital Photography for Elementary Students

    Science.gov (United States)

    Neckers, Matt

    2009-01-01

    Most elementary students approach photography in an open-minded, experimental way. As a result, their images are often more playful than those taken by adults. Students discover more through their own explorations than they would learn through overly structured lessons. In this article, the author describes how he introduces his elementary…

  8. Teaching STEM to Millennial Students

    Science.gov (United States)

    Nikirk, Martin

    2012-01-01

    The "Millennial Generation" includes students enrolled in primary grades through high school. These students are also known as Digital Natives, Generation Why, the Net Generation, Generation Me, and i-Kids. The generation includes ages ranging from approximately 7 to 30. This is the generation who have always had technology integrated into their…

  9. Student Affairs in Complex Contexts

    African Journals Online (AJOL)

    Dissatisfaction and frustration with political leaders have sent students ... In the Democratic Republic of Congo, the Minister of Higher Education has ordered a ... Student Affairs will need to anticipate and find innovative ways to adjust ... Razia Mayet's article focuses on the effectiveness of learning development interventions.

  10. Making Politics Matter to Students

    Science.gov (United States)

    Jacoby, Barbara

    2006-01-01

    Many people saw the 2004 presidential election as an opportunity for students to engage in democracy in a fundamental and concrete way--by registering to vote and participating fully in the electoral process. The first national post-election study of college student turnout in the 2004 presidential election, conducted by the Center for Information…

  11. Working with Handicapped Art Students.

    Science.gov (United States)

    Silver, Rawley A.

    Presented at the 1979 National Art Education Association Convention on the arts in special education, the paper focuses on studies of the aesthetic and therapeutic use of special art procedures with handicapped students. The art education needs of handicapped students are briefly discussed, along with the impact and implications of new…

  12. Student Perceptions of Teaching Transparency

    Science.gov (United States)

    Anderson, Alecia D.; Hunt, Andrea N.; Powell, Rachel E.; Dollar, Cindy Brooks

    2013-01-01

    The authors discuss the relationship between teaching transparency and active learning through the perspectives of their students. Active learning directly engages students in the learning process while transparency involves the instructor's divulgence of logic regarding course organization and activity choices. After utilizing these teaching…

  13. A Tale of Two Students

    Science.gov (United States)

    Gordon, Sheldon P.

    2008-01-01

    The article describes the performance of several individual students in a college algebra/precalculus course that focuses on the development of conceptual understanding and the use of mathematical modeling and discusses the likely differences in outcome if the students took a traditional algebra-skills focused course.

  14. The Myth about Student Competency

    Science.gov (United States)

    Oblinger, Diana G.; Hawkins, Brian L.

    2006-01-01

    Students appear to be highly technologically competent yet their information literacy skills are in question. College and university executives should consider how to equip their students with information literacy -- not just IT skills -- for a lifelong ability to evaluate and address information needs since part of a college or university's…

  15. Undergraduate Students' Information Search Practices

    Science.gov (United States)

    Nikolopoulou, Kleopatra; Gialamas, Vasilis

    2011-01-01

    This paper investigates undergraduate students' information search practices. The subjects were 250 undergraduate students from two university departments in Greece, and a questionnaire was used to document their search practices. The results showed that the Web was the primary information system searched in order to find information for…

  16. Do Examinations Influence Student Evaluations?

    Science.gov (United States)

    Arnold, Ivo J. M.

    2009-01-01

    This paper measures the impact of timing on student evaluations of teaching effectiveness, using a dataset of close to 3000 observations from Erasmus School of Economics. A special feature of the data is that students were able to complete on-line questionnaires during a time window ranging from one week "before" to one week "after" the final…

  17. Undergraduate Students' Attitudes toward Biodiversity

    Science.gov (United States)

    Huang, Hui-Ju; Lin, Yu-Teh Kirk

    2014-01-01

    The study investigated American and Taiwan undergraduate students' attitudes toward biodiversity. The survey questionnaire consisted of statements prompted by the question "To what extent do you agree with the following statements about problems with the biodiversity issues." Students indicated strongly disagree, disagree, agree,…

  18. Intercultural Competence in Host Students?

    DEFF Research Database (Denmark)

    Egekvist, Ulla Egidiussen; Lyngdorf, Niels Erik; Du, Xiangyun

    2016-01-01

    Although substantial work in intercultural education has been done on the intercultural competences of mobile students engaging in international study visits, there is a need to explore intercultural competences in host students. This chapter seeks to answer questions about the challenges...

  19. Student Engagement: Rhetoric and Reality

    Science.gov (United States)

    Baron, Paula; Corbin, Lillian

    2012-01-01

    Recently, there has been much interest in higher education literature and policy on the concepts of student engagement and disengagement. While most academic writings recognise the significance of student engagement, they have tended to concentrate on it in relation to academic activities. Increasingly, universities are "cascading" down…

  20. Student Evaluations as Social Ritual.

    Science.gov (United States)

    Whittington, Harold

    The practice of student evaluation of college faculty is discussed in terms of the literature on social ritual. The following arguments that critics have raised are considered: student ratings of professors are neither scientific nor objective; feedback needed by professors to improve the quality of their work and data needed by administrators to…

  1. Summer Student Report - Project Kryolize

    CERN Document Server

    Drozdowski, Pawel

    2016-01-01

    The purpose of this document is to describe the work and results obtained by the author during his summer student internship at CERN. The author of this document was attached to the project Kryolize as a software developer, overtaking the job from a recently departed technical student.

  2. Understanding Disabilities & Online Student Success

    Science.gov (United States)

    Betts, Kristen; Welsh, Bill; Pruitt, Cheryl; Hermann, Kelly; Dietrich, Gaeir; Trevino, Jorge G.; Watson, Terry L.; Brooks, Michael L.; Cohen, Alex H.; Coombs, Norman

    2013-01-01

    Online learning has been growing at an exponential rate over the past decade, providing new opportunities for students seeking quality courses and programs offered through flexible formats. However, as higher education continues to expand online offerings, services must be expanded simultaneously to support all students. This article focuses on…

  3. Student Interpretations of Diagnostic Feedback

    Science.gov (United States)

    Doe, Christine

    2015-01-01

    Diagnostic assessment is increasingly being recognized as a potentially beneficial tool for teaching and learning (Jang, 2012). There have been calls in the research literature for students to receive diagnostic feedback and for researchers to investigate how such feedback is used by students. Therefore, this study examined how students…

  4. Authorizing the Foreign Language Students.

    Science.gov (United States)

    Maxim, Hiram H.

    1998-01-01

    Reviews current practices in foreign-language teaching in light of Bourdieu's theories of language and power to show how failing to assess discursive intent prevents students from understanding strategic use of language. Bordieu's model is then proposed as the basis for pedagogy that authorizes students to use their existing cognitive skills in…

  5. Calculus Student Descending a Staircase.

    Science.gov (United States)

    Mueller, William

    1999-01-01

    Common student attitudes toward reform methods are conveyed through the thoughts of a student leaving a multivariable calculus exam and musings range over textbooks, homework, workload, group work, writing, noncomputational problems, instructional problems, instructional styles, and classroom activities. (Author/ASK)

  6. Astrology Beliefs among Undergraduate Students

    Science.gov (United States)

    Sugarman, Hannah; Impey, Chris; Buxner, Sanlyn; Antonellis, Jessie

    2011-01-01

    A survey of the science knowledge and attitudes toward science of nearly 10000 undergraduates at a large public university over a 20-year period included several questions addressing student beliefs in astrology and other forms of pseudoscience. The results from our data reveal that a large majority of students (78%) considered astrology "very" or…

  7. International Students and Mental Health

    Science.gov (United States)

    Forbes-Mewett, Helen; Sawyer, Anne-Maree

    2016-01-01

    Since the early 2000s, reports of increased rates of mental ill health among young people worldwide have received much attention. Several studies indicate a greater incidence of mental health problems among tertiary students, compared with the general population, and higher levels of anxiety, in particular, among international students compared…

  8. Creativity Styles of Freshman Students.

    Science.gov (United States)

    Kumar, V. K.; And Others

    1991-01-01

    First-year college students (n=182) were tested to determine their beliefs about and approaches to creative endeavors. Students self-identified as creative employed a greater number of techniques such as brainstorming and were less motivated by the goal of developing a final product, compared to those identified as least creative. (JDD)

  9. Entrepreneurial intention of Danish students

    DEFF Research Database (Denmark)

    Fietze, Simon; Boyd, Britta

    2017-01-01

    Purpose – The purpose of this paper is to describe the entrepreneurial intention (EI) among Danish university students applying the theory of planned behaviour. Design/methodology/approach – Using cross-sectional data from the Danish Global University Student Spirit Survey 2013 (n=1...

  10. Hispanic College Students Library Experience

    Science.gov (United States)

    Lumley, Risa; Newman, Eric; Brown, Haakon T.

    2015-01-01

    This study looks at undergraduate Hispanic students' interpretations and current perceptions of the academic library's purpose, usefulness and value. What are the reasons to use the library? What are the barriers to use? This study will examine academic libraries' move toward electronic library materials and what it means for Hispanic students.…

  11. How Medical Students Use Objectives.

    Science.gov (United States)

    Mast, Terrill A.; And Others

    Two related studies were undertaken at Southern Illinois University on how students in the School of Medicine use the instructional objectives faculty prepare for them. Students in the classes of 1978 and 1979 were surveyed in their final month of training. The second survey was modified, based on responses from the first. The five research…

  12. Student Misconceptions in Introductory Biology.

    Science.gov (United States)

    Fisher, Kathleen M.; Lipson, Joseph I.

    Defining a "misconception" as an error of translation (transformation, correspondence, interpolation, interpretation) between two different kinds of information which causes students to have incorrect expectations, a Taxonomy of Errors has been developed to examine student misconceptions in an introductory biology course for science…

  13. Students' Problem Solving and Justification

    Science.gov (United States)

    Glass, Barbara; Maher, Carolyn A.

    2004-01-01

    This paper reports on methods of students' justifications of their solution to a problem in the area of combinatorics. From the analysis of the problem solving of 150 students in a variety of settings from high-school to graduate study, four major forms of reasoning evolved: (1) Justification by Cases, (2) Inductive Argument, (3) Elimination…

  14. International student mobility literature review

    NARCIS (Netherlands)

    King, R.; Findlay, A.; Ahrens, J.

    2010-01-01

    To bring their understanding of patterns in students' study and work abroad up to date, HEFCE and the British Council, the UK National Agency for Erasmus, commissioned a review of international student mobility. Professor Russell King and Jill Ahrens of the University of Sussex, and Professor Allan

  15. Blended Learning: The Student Viewpoint

    African Journals Online (AJOL)

    Student perceptions were assessed using Mann–Whitney. U‑test and ... Keywords: Blended learning, Online learning, Students' perceptions. Access this article online ..... performance, EC: Educational counseling, MIB: Medical insurance billing, MT: .... distance in education at the harvard business school. Educ. Technol ...

  16. Students' Evaluations about Climate Change

    Science.gov (United States)

    Lombardi, Doug; Brandt, Carol B.; Bickel, Elliot S.; Burg, Colin

    2016-01-01

    Scientists regularly evaluate alternative explanations of phenomena and solutions to problems. Students should similarly engage in critical evaluation when learning about scientific and engineering topics. However, students do not often demonstrate sophisticated evaluation skills in the classroom. The purpose of the present study was to…

  17. Student Monitoring in Distance Education.

    Science.gov (United States)

    Holt, Peter; And Others

    1987-01-01

    Reviews a computerized monitoring system for distance education students at Athabasca University designed to solve the problems of tracking student performance. A pilot project for tutors is described which includes an electronic conferencing system and electronic mail, and an evaluation currently in progress is briefly discussed. (LRW)

  18. Story Lab: Student Data Privacy

    Science.gov (United States)

    Herold, Benjamin

    2015-01-01

    Student data privacy is an increasingly high-profile--and controversial--issue that touches schools and families across the country. There are stories to tell in virtually every community. About three dozen states have passed legislation addressing student data privacy in the past two years, and eight different proposals were floating around…

  19. Statistics Anxiety among Postgraduate Students

    Science.gov (United States)

    Koh, Denise; Zawi, Mohd Khairi

    2014-01-01

    Most postgraduate programmes, that have research components, require students to take at least one course of research statistics. Not all postgraduate programmes are science based, there are a significant number of postgraduate students who are from the social sciences that will be taking statistics courses, as they try to complete their…

  20. Diffusion of student business incubators

    DEFF Research Database (Denmark)

    Hjortsø, Carsten Nico Portefée; Honig, Benson; Riis, Nina Louise Fynbo

    education. Applying neo-institutional theory, we examine the development of student incubation activities in the field of general state-funded Danish universities. We review institutional pressures from the political sphere that led to the diffusion of student incubation, introducing a three-phase process...