WorldWideScience

Sample records for sara duff abstract

  1. News developments at Sara

    International Nuclear Information System (INIS)

    Belmont, J.L.; Fruneau, M.; Martin, P.

    1989-05-01

    SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration

  2. Predicting duff and woody fuel consumed by prescribed fire in the Northern Rocky Mountains

    Science.gov (United States)

    James K. Brown; Michael A. Marsden; Kevin C. Ryan; Elizabeth D. Reinhardt

    1985-01-01

    Relationships for predicting duff reduction, mineral soil exposure, and consumption of downed woody fuel were determined to assist in planning prescribed fires. Independent variables included lower and entire duff moisture contents, loadings of downed woody fuels, duff depth, National Fire-Danger Rating System 1,000-hour moisture content, and Canadian Duff Moisture...

  3. Spatial interpolation and simulation of post-burn duff thickness after prescribed fire

    Science.gov (United States)

    Peter R. Robichaud; S. M. Miller

    1999-01-01

    Prescribed fire is used as a site treatment after timber harvesting. These fires result in spatial patterns with some portions consuming all of the forest floor material (duff) and others consuming little. Prior to the burn, spatial sampling of duff thickness and duff water content can be used to generate geostatistical spatial simulations of these characteristics....

  4. Does raking basal duff affect tree growth rates or mortality?

    Science.gov (United States)

    Erin Noonan-Wright; Sharon M. Hood; Danny R. Cluck

    2010-01-01

    Mortality and reduced growth rates due to raking accumulated basal duff were evaluated for old, large-diameter ponderosa and Jeffrey pine trees on the Lassen National Forest, California. No fire treatments were included to isolate the effect of raking from fire. Trees were monitored annually for 5 years after the raking treatment for mortality and then cored to measure...

  5. Duff reaction on phenols: Characterization of non steam volatile products

    Digital Repository Service at National Institute of Oceanography (India)

    Wahidullah, S.; DeSouza, L.; Bhattacharya, J.

    New products having structures 1 and 2 have been characterized in the Duff reaction thymol arid carvacrol. These products have been identified as 2.6'-dithymylmethane 1 and 5.5' -dicarvacryl methane 2 respectively on the basis of spectral data...

  6. 2012 SARA Students Technical Report

    International Nuclear Information System (INIS)

    Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet

    2012-01-01

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of

  7. 2012 SARA Students Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

    2012-07-30

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the

  8. The SARA REU Site Program

    Science.gov (United States)

    Wood, M. A.; Oswalt, T. D.; SARA Collaboration

    2000-12-01

    We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.

  9. Abstracts

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    The Western Theories of War Ethics and Contemporary Controversies Li Xiaodong U Ruijing (4) [ Abstract] In the field of international relations, war ethics is a concept with distinct westem ideological color. Due to factors of history and reality, the in

  10. Abstracts

    Institute of Scientific and Technical Information of China (English)

    2017-01-01

    Supplementary Short Board: Orderly Cultivate Housing Leasing Market WANG Guangtao (Former Minister of Ministry of Construction) Abstract: In December 2016, Central Economic Work Conference proposed that to promote the steady and healthy development of the real estate market, it should adhere to the “house is used to live, not used to speculate” position. At present, the development of housing leasing market in China is lagging behind. It is urgent to improve the housing conditions of large cities and promote the urbanization of small and medium-sized cities. Therefore, it is imperative to innovate and supplement the short board to accelerate the development of housing leasing market.

  11. Sara

    International Nuclear Information System (INIS)

    Aparo, M.; Dionisi, M.; Vicini, C.; Zeppa, P.; Frazzoli, F.V.; Remetti, R.; Portale, C.

    1989-01-01

    Nuclear Material Accountability, supported by Containment and Surveillance measures, is a foundamental means for an effective International Safeguard implemention in nuclear plants. Accountability is based on the verification that difference between a material quantity entering a given material balance and the quantity leaving that area in a given period of time, correspond and the amount of material actually present at the moment of the inspection. In the recent years International Safeguards appealing to the needs of timeliness in detecting diversion and concealing activities, devoted ReD efforts on a new Dynamic Accountability procedures (NRTMA) with particular concern with reprocessing plants. The present paper, which is the result of a research activity carried out in the frame of the Italian Support Programme to IAEA for Safeguards implementation, deals with a feasibility study of a NRTMA system to be applied to the EUREX pilot reprocessing plant. Such a feasibility study was performed by developing a computer program based on simulated plant generated data

  12. Abstracts

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Strategic Realism: An Option for China' s Grand Strategy Song Dexing (4) [ Abstract] As a non-Western emerging power, China should positively adapt its grand strategy to the strategic psychological traits in the 21st century, maintain a realist tone consistent with the national conditions of China, and avoid adventurist policies while awaring both strategic strength and weakness. In the 21st century, China' s grand strategy should be based on such core values as security, development, peace and justice, especially focusing on development in particular, which we named "strategic realism". Given the profound changes in China and the world, strategic realism encourages active foreign policy to safe- guard the long-term national interests of China. Following the self-help logic and the fun- damental values of security and prosperity, strategic realism concerns national interests as its top-priority. It advocates smart use of power, and aims to achieve its objectives by optimizing both domestic and international conditions. From the perspective of diplomatic phi- losophy, strategic realism is not a summarization of concrete policies but a description of China' s grand strategy orientations in the new century. [ Key Words] China, grand strategy, strategic realism [ Author]Song Dexing, Professor, Ph.D. Supervisor, and Director of the Center for International Strategic Studies, University of International Studies of PLA.

  13. Particle crossing versus field crossing; a corrective response to Duff's recent account of string theory

    International Nuclear Information System (INIS)

    Schroer, Bert; FU-Berlin

    2012-02-01

    Using recent results of advanced quantum field theory, we confute some of M. Duff's claims about string theory which he wrote as an invited paper to the project 'Forty Years Of String Theory: Reflecting on the Foundations' (author)

  14. Severe Accident Recriticality Analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  15. Severe accident recriticality analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H

    2001-11-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated

  16. Severe accident recriticality analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.

    2001-01-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady

  17. Severe Accident Recriticality Analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  18. Interpreting the SARA and RCRA training requirements

    International Nuclear Information System (INIS)

    Moreland, W.M.; Wells, S.M.

    1987-01-01

    The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements

  19. Concurrent software system design supported by SARA at the age of one

    Energy Technology Data Exchange (ETDEWEB)

    Campos, I.M.; Estrin, G.

    A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.

  20. System Analysis and Risk Assessment (SARA) system

    International Nuclear Information System (INIS)

    Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

    1986-01-01

    Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable

  1. Mixed Conifer Forest Duff Consumption during Prescribed Fires: Tree Crown Impacts

    NARCIS (Netherlands)

    Hille, M.G.; Stephens, S.L.

    2005-01-01

    Fire suppression has produced large forest floor fuel loads in many coniferous forests in western North America. This study describes spatial patterns of duff consumption in a mixed-conifer forest in the north-central Sierra Nevada, California. Overstory crown coverage was correlated to spatial

  2. Heat Pipe Powered Stirling Conversion for the Demonstration Using Flattop Fission (DUFF) Test

    Science.gov (United States)

    Gibson, Marc A.; Briggs, Maxwell H.; Sanzi, James L.; Brace, Michael H.

    2013-01-01

    Design concepts for small Fission Power Systems (FPS) have shown that heat pipe cooled reactors provide a passive, redundant, and lower mass option to transfer heat from the fuel to the power conversion system, as opposed to pumped loop designs typically associated with larger FPS. Although many systems have been conceptually designed and a few making it to electrically heated testing, none have been coupled to a real nuclear reactor. A demonstration test named DUFF Demonstration Using Flattop Fission, was planned by the Los Alamos National Lab (LANL) to use an existing criticality experiment named Flattop to provide the nuclear heat source. A team from the NASA Glenn Research Center designed, built, and tested a heat pipe and power conversion system to couple to Flattop with the end goal of making electrical power. This paper will focus on the design and testing performed in preparation for the DUFF test.

  3. Forest Fire Smoldering Emissions from Ponderosa Pine Duff in Central Washington

    Science.gov (United States)

    Baker, S. P.; Lincoln, E.; Page, W.; Richardson, M.

    2017-12-01

    Forest fire smoldering combustion is a significant contribution to pollution and carbon emissions. Smoldering combustion produces the majority of carbon monoxide (CO), methane (CH4), volatile organic compounds (VOC), and fine particulate matter (PM2.5) emitted by forest fires when it occurs. The emission factor for PM2.5 and many VOCs are correlated with the modified combustion efficiency (MCE), which is the ratio of CO2 emitted, to the sum of emitted CO2 and CO. MCE is a measure of the relative ratio of flaming and smoldering combustion, but its relationship to the physical fire process is poorly studied. We measured carbon emission rates and individual emission factors for CO, CO2, CH4, and VOC's from smoldering combustion on Ponderosa pine /Douglas-Fir forest sites in central Washington. The emission factor results are linked with concurrent thermal measurements made at various depths in the duff and surface IR camera imagery. The MCE value ranged from .80 to .91 and are correlated with emission factors for 24 carbon compounds. Other data collected were fuel moistures and duff temperatures at depth increments. This goal of this research is the creation of a database to better predict the impacts of air pollution resulting from burns leading to smoldering combustion.

  4. Duff mound consumption and cambium injury for centuries-old western larch from prescribed burning in western Montana

    Science.gov (United States)

    Michael G. Harrington

    2012-01-01

    Western larch is one of the most fire-adapted conifers in western North America. Its historical perpetuation depended upon regular fire disturbances, which creates open stand conditions and mineral seedbeds. A stand of 200- to 500-year-old larch in western Montana with deep duff mounds resulting from an unusually long 150-year fire-free period was mechanically thinned...

  5. The relationship between SARA fractions and crude oil stability

    Directory of Open Access Journals (Sweden)

    Siavash Ashoori

    2017-03-01

    Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.

  6. Layering of life (Sara novel of Peter Sarić

    Directory of Open Access Journals (Sweden)

    Kostić Dragomir J.

    2015-01-01

    Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safe­guard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.

  7. Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.

    Science.gov (United States)

    O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J

    2008-04-01

    Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.

  8. Gene : CBRC-SARA-01-1996 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

  9. SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS

    International Nuclear Information System (INIS)

    Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.

    2015-01-01

    SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index

  10. Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

    Directory of Open Access Journals (Sweden)

    M. Sidi Ritau'din

    2017-06-01

    Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.

  11. Layering of life (Sara novel of Peter Sarić)

    OpenAIRE

    Kostić, Dragomir J.

    2015-01-01

    Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...

  12. A simple blowdown code for SUPER-SARA loop conditions

    International Nuclear Information System (INIS)

    Fritz, G.

    1981-01-01

    The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section

  13. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...

  14. Sara, a patient with borderline personality structure: A "crisis" management

    Directory of Open Access Journals (Sweden)

    Paola Marinelli

    2015-05-01

    Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma. 

  15. Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

    Directory of Open Access Journals (Sweden)

    Jessica N Snowden

    Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.

  16. System Analysis and Risk Assessment system (SARA) Version 4.0

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1992-01-01

    This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis

  17. The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...

  18. Calculations for the design and modification of the 2 cyclotrons of S.A.R.A

    International Nuclear Information System (INIS)

    Albrand, P.S.; Belmont, J.L.; Ripouteau, F.

    1983-09-01

    S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron

  19. Social humanoid robot SARA: development of the wrist mechanism

    Science.gov (United States)

    Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.

    2018-01-01

    This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.

  20. Mengukur Politisasi Agama dalam Ruang Publik: Komunikasi SARA dalam Perdebatan Rational Choice Theory

    Directory of Open Access Journals (Sweden)

    Mohammad Supriyadi

    2015-12-01

    Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.

  1. ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

    Directory of Open Access Journals (Sweden)

    Sulistyastuti Sutomo

    2015-01-01

    Full Text Available Not only does art   have   self-fullfillment, but  it also has axiological  benefits both socially, culturally, religiously, and economiclally.  So does Sara Douda dance.  Sara Douda aesthetics  is first contained  in its whole dance movements. In addition, it  can also be found in the whole dance equipments.  Moreover,  this dance aesthetics  may  also be contained in the verbal symbols in the speech forms  prior to the dance performance. However,  both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and  religious values in the Loli community about  their honoring their ancestors,  having social harmony, and  highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance.   Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda

  2. The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

    International Nuclear Information System (INIS)

    Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan

    2013-01-01

    Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...

  9. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    Science.gov (United States)

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...

  17. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  6. Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural

    Directory of Open Access Journals (Sweden)

    Tiara Kharisma

    2017-12-01

    Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

  10. Transferring generic SARA/OSHA training to US Department of Energy facilities

    International Nuclear Information System (INIS)

    White, A.; McKinley, T.

    1989-01-01

    The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs

  11. SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

    DEFF Research Database (Denmark)

    Martin, Christer; Heinze, C.; Busch, M.

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...

  12. Abstract algebra

    CERN Document Server

    Garrett, Paul B

    2007-01-01

    Designed for an advanced undergraduate- or graduate-level course, Abstract Algebra provides an example-oriented, less heavily symbolic approach to abstract algebra. The text emphasizes specifics such as basic number theory, polynomials, finite fields, as well as linear and multilinear algebra. This classroom-tested, how-to manual takes a more narrative approach than the stiff formalism of many other textbooks, presenting coherent storylines to convey crucial ideas in a student-friendly, accessible manner. An unusual feature of the text is the systematic characterization of objects by universal

  13. NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...

  16. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    OpenAIRE

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...

  18. Identification of Differentially Expressed Proteins in Liver in Response to Subacute Ruminal Acidosis (SARA Induced by High-concentrate Diet

    Directory of Open Access Journals (Sweden)

    X. Y. Jiang

    2014-08-01

    Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.

  19. SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-05-01

    Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.

  20. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    Science.gov (United States)

    Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

    2017-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.

  1. System Analysis and Risk Assessment System (SARA), Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.

    1992-02-01

    This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs

  2. Article Abstract

    African Journals Online (AJOL)

    Abstract. Simple learning tools to improve clinical laboratory practical skills training. B Taye, BSc, MPH. Addis Ababa University, College of Health Sciences, Addis Ababa, ... concerns about the competence of medical laboratory science graduates. ... standardised practical learning guides and assessment checklists would.

  3. Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

    2009-07-01

    Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench

  4. Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

    Science.gov (United States)

    Thomas, S. M.; Su, Y. C.; Hummel, P. R.

    2016-12-01

    Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance

  5. On the Witten-Duff five Branes model together with knots theory and E8E8 super strings in a single fractal spacetime theory

    International Nuclear Information System (INIS)

    El Naschie, M.S.

    2009-01-01

    The Witten-Duff five Branes in 11 dimensions model which leads to N = 528 states is reviewed. A complimentary model leading to N = 496 of E 8 E 8 exceptional Lie symmetry group is established along identical ideas. Subsequently both models are combined into a general one which includes the zero-form missing in the original five Branes model. Finally a highly instructive connection to vertical bar E 12 vertical bar = 685 Lie symmetry group which encompasses E 11 as well as the number of distinct knots for given crossing numbers is established. It is concluded that it is easier to transfinitely extend the five Branes model than to add additional roots of exceptional Lie groups in order to find the exact answer.

  6. Inventory Abstraction

    International Nuclear Information System (INIS)

    Leigh, C.

    2000-01-01

    The purpose of the inventory abstraction as directed by the development plan (CRWMS M and O 1999b) is to: (1) Interpret the results of a series of relative dose calculations (CRWMS M and O 1999c, 1999d). (2) Recommend, including a basis thereof, a set of radionuclides that should be modeled in the Total System Performance Assessment in Support of the Site Recommendation (TSPA-SR) and the Total System Performance Assessment in Support of the Final Environmental Impact Statement (TSPA-FEIS). (3) Provide initial radionuclide inventories for the TSPA-SR and TSPA-FEIS models. (4) Answer the U.S. Nuclear Regulatory Commission (NRC)'s Issue Resolution Status Report ''Key Technical Issue: Container Life and Source Term'' (CLST IRSR) (NRC 1999) key technical issue (KTI): ''The rate at which radionuclides in SNF [Spent Nuclear Fuel] are released from the EBS [Engineered Barrier System] through the oxidation and dissolution of spent fuel'' (Subissue 3). The scope of the radionuclide screening analysis encompasses the period from 100 years to 10,000 years after the potential repository at Yucca Mountain is sealed for scenarios involving the breach of a waste package and subsequent degradation of the waste form as required for the TSPA-SR calculations. By extending the time period considered to one million years after repository closure, recommendations are made for the TSPA-FEIS. The waste forms included in the inventory abstraction are Commercial Spent Nuclear Fuel (CSNF), DOE Spent Nuclear Fuel (DSNF), High-Level Waste (HLW), naval Spent Nuclear Fuel (SNF), and U.S. Department of Energy (DOE) plutonium waste. The intended use of this analysis is in TSPA-SR and TSPA-FEIS. Based on the recommendations made here, models for release, transport, and possibly exposure will be developed for the isotopes that would be the highest contributors to the dose given a release to the accessible environment. The inventory abstraction is important in assessing system performance because

  7. INVENTORY ABSTRACTION

    International Nuclear Information System (INIS)

    Ragan, G.

    2001-01-01

    The purpose of the inventory abstraction, which has been prepared in accordance with a technical work plan (CRWMS M andO 2000e for/ICN--02 of the present analysis, and BSC 2001e for ICN 03 of the present analysis), is to: (1) Interpret the results of a series of relative dose calculations (CRWMS M andO 2000c, 2000f). (2) Recommend, including a basis thereof, a set of radionuclides that should be modeled in the Total System Performance Assessment in Support of the Site Recommendation (TSPA-SR) and the Total System Performance Assessment in Support of the Final Environmental Impact Statement (TSPA-FEIS). (3) Provide initial radionuclide inventories for the TSPA-SR and TSPA-FEIS models. (4) Answer the U.S. Nuclear Regulatory Commission (NRC)'s Issue Resolution Status Report ''Key Technical Issue: Container Life and Source Term'' (CLST IRSR) key technical issue (KTI): ''The rate at which radionuclides in SNF [spent nuclear fuel] are released from the EBS [engineered barrier system] through the oxidation and dissolution of spent fuel'' (NRC 1999, Subissue 3). The scope of the radionuclide screening analysis encompasses the period from 100 years to 10,000 years after the potential repository at Yucca Mountain is sealed for scenarios involving the breach of a waste package and subsequent degradation of the waste form as required for the TSPA-SR calculations. By extending the time period considered to one million years after repository closure, recommendations are made for the TSPA-FEIS. The waste forms included in the inventory abstraction are Commercial Spent Nuclear Fuel (CSNF), DOE Spent Nuclear Fuel (DSNF), High-Level Waste (HLW), naval Spent Nuclear Fuel (SNF), and U.S. Department of Energy (DOE) plutonium waste. The intended use of this analysis is in TSPA-SR and TSPA-FEIS. Based on the recommendations made here, models for release, transport, and possibly exposure will be developed for the isotopes that would be the highest contributors to the dose given a release

  8. Development of an ion guide coupled to an on-line isotope separation system on Sara. Identification and study of isospin exotic nuclei at Isolde and Sara

    International Nuclear Information System (INIS)

    Bouldjedri, A.

    1992-06-01

    This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements

  9. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  10. Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.

    1995-01-01

    Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...

  12. Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010

    OpenAIRE

    Beaulé, Sophie

    2014-01-01

    With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w

  14. Lepidoptera, Nymphalidae, Heliconiinae, Heliconius sara apseudes (Hübner, 1813: Distribution extension

    Directory of Open Access Journals (Sweden)

    Iserhard, C. A.

    2010-01-01

    Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.

  15. PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

    Directory of Open Access Journals (Sweden)

    Jorge A. Orrego-Ruiz

    2014-06-01

    Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.

  16. The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

    Science.gov (United States)

    Wood, M. A.

    2003-12-01

    The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.

  17. BALWOIS: Abstracts

    International Nuclear Information System (INIS)

    Morell, Morell; Todorovik, Olivija; Dimitrov, Dobri

    2004-01-01

    anthropogenic pressures and international shared water. Here are the 320 abstracts proposed by authors and accepted by the Scientific Committee. More than 200 papers are presented during the Conference on 8 topics related to Hydrology, Climatology and Hydro biology: - Climate and Environment; - Hydrological regimes and water balances; - Droughts and Floods; -Integrated Water Resources Management; -Water bodies Protection and Eco hydrology; -Lakes; -Information Systems for decision support; -Hydrological modelling. Papers relevant to INIS are indexed separately

  18. Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.

    Science.gov (United States)

    Zhao, Bryan M; Hoffmann, F Michael

    2006-09-01

    Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.

  19. Sara John: Ethnisierte Arbeit. Eine feministische Perspektive. Marburg: Tectum Wissenschaftsverlag 2009.

    Directory of Open Access Journals (Sweden)

    Grit Grigoleit

    2011-03-01

    Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.

  20. A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

    Science.gov (United States)

    Worthen, Helena Harlow

    2012-01-01

    The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…

  1. Hemolytic disease of the fetus and newborn caused by an antibody to a low-prevalence antigen, anti-SARA.

    Science.gov (United States)

    Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy

    2011-09-01

    The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.

  2. Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

    Science.gov (United States)

    Goldrick-Rab, Sara; Kelly, Andrew P.

    2016-01-01

    In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

  4. NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r

  9. Escribiendo el silencio: la contemplación poética de Sara Pujol

    Directory of Open Access Journals (Sweden)

    Gala, Candelas

    2005-06-01

    Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.

  10. Intravenous immunoglobulin in the management of a rare cause of hemolytic disease of the newborn: Anti-SARA antibodies.

    Science.gov (United States)

    Venkataraman, Rohini; Yusuf, Kamran

    2017-01-01

    Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.

  11. Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

    Directory of Open Access Journals (Sweden)

    Tirshem Kumar Kaushik

    2015-05-01

    Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.

  12. Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge

    DEFF Research Database (Denmark)

    Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette

    2017-01-01

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...

  13. TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

    Energy Technology Data Exchange (ETDEWEB)

    1989-03-01

    This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.

  14. Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.

    1994-11-01

    The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)

  15. Instructional materials for SARA/OSHA training. Volume 1, General site working training

    Energy Technology Data Exchange (ETDEWEB)

    Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)

    1988-04-01

    This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.

  16. La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli

    Directory of Open Access Journals (Sweden)

    Umberto Fortis

    2014-04-01

    Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.

  17. Reading Sara Pujol Russell’s Poetry of Contemplation and Connection

    Directory of Open Access Journals (Sweden)

    Anita M. Hart

    2012-06-01

    Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.

  18. SAPHIRE technical reference manual: IRRAS/SARA Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.

    1993-01-01

    This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix

  19. From Abstract Art to Abstracted Artists

    Directory of Open Access Journals (Sweden)

    Romi Mikulinsky

    2016-11-01

    Full Text Available What lineage connects early abstract films and machine-generated YouTube videos? Hans Richter’s famous piece Rhythmus 21 is considered to be the first abstract film in the experimental tradition. The Webdriver Torso YouTube channel is composed of hundreds of thousands of machine-generated test patterns designed to check frequency signals on YouTube. This article discusses geometric abstraction vis-à-vis new vision, conceptual art and algorithmic art. It argues that the Webdriver Torso is an artistic marvel indicative of a form we call mathematical abstraction, which is art performed by computers and, quite possibly, for computers.

  20. Pioneering studies of IQ by G.H. Thomson and J.F. Duff--an example of established knowledge subsequently 'hidden in plain sight'.

    Science.gov (United States)

    Charlton, Bruce G

    2008-11-01

    Perhaps the earliest authoritative measurement of a social class gradient in IQ, with a stratification of occupations among the parents of children with different IQs, is seen in two fascinating papers published in 1923 and 1929 in the British Journal of Psychology. The authors were GH Thomson and JF Duff (both of whom were later knighted) and the papers' main findings were confirmed by later researchers. Results of an intelligence test administered to 13419 children aged 11-12 were analyzed according to parent's occupation. The average children's IQ at extremes of social class among their parents included clergymen-121, teachers-116 and bankers and managers-112 at the upper end; while at the lower end there were 'cripples and invalids'-94, cattlemen-93, hawkers and chimneysweeps-91, and the 'insane, criminal'-88. More than 100 specific categories of parental occupations were then combined into 13 social classes, with their children's average IQ as follows: Professional-112; Managers-110; Higher Commercial-109; Army, Navy, Police, Postmen-106; Shopkeeping-105; Engineers [ie. apprenticed craftsmen, such as mining engineers]-103; Foremen-103; Building trades-102; Metal workers, shipbuilders-101; Miscellaneous industrial workers-101; Miners and quarrymen-98; Agriculture-98; Labourers-96. A follow-up study compared an 'intelligent' group (IQ 136 plus) with a matched IQ 95-105 'control' group. IQ testing at age 11-12 was predictive of teacher's reports of higher levels of intelligence and health at age 16; and better performance in official examinations. The occupations of fathers, grandfathers and uncles were consistent with occupation being indicative of 'an inherited quality' (i.e. IQ) and there was regression from parents to grandparents and uncles among the 'intelligent' but not among controls. Other findings included a wider variance in intelligence among boys than girls, and descriptions of the predictive value of IQ in estimating future education, examinations

  1. Programme and abstracts

    International Nuclear Information System (INIS)

    1975-01-01

    Abstracts of 25 papers presented at the congress are given. The abstracts cover various topics including radiotherapy, radiopharmaceuticals, radioimmunoassay, health physics, radiation protection and nuclear medicine

  2. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    Directory of Open Access Journals (Sweden)

    Abdullah K. Shehabat

    2016-09-01

    Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.

  3. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0. Volume 5, Systems Analysis and Risk Assessment (SARA) tutorial manual

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities

  4. SARA South Observations and Analysis of the Solar Type, Totally Eclipsing, Over Contact Binary, PY Aquarii

    Science.gov (United States)

    Chamberlain, Heather; Samec, Ronald G.; Caton, Daniel Bruce; Van Hamme, Walter

    2018-01-01

    PY Aqr (GSC 05191-00853) is a solar Type (T ~ 5750K) eclipsing binary. It was observed in July to October, 2017 at Cerro Tololo in remote mode with the 0.6-m SARA South reflector. Two times of minimum light were calculated from our present observations, a primary and a secondary eclipse:HJD Min I = 2457951.7762±0.0006 HJD Min II = 2458019.5295±00.0003. Both weighted as 1.0.In addition, four timings were determined from online data given in IBVS 5600 and five observations at minima were determined from archived All Sky Automated Survey Data:HJD Min I = 2452908.3165, 2452912.33612 HJD Min II = 2452877.5621, 2452913.34465. All weighted as 0.5.ASAS Observations at minima: 2452094.688, 2453478.882, 2453266.576, 2452093.685 and 54729.600. Each weighted as 0.10The following linear and quadratic ephemerides were determined from all available times of minimum light:JD Hel Min I=2452951.7443±0.0008d + 0.402093441±0.000000099 X E {1} JD Hel Min I=2452951.7439±0.0007d + 0.4020912±0.0000007 X E +0.00000000018 ± 0.00000000006 X E2 {2}A BVRI Bessell filtered simultaneous Wilson-Devinney Program (W-D) solution reveals that the system has a mass ratio of ~0.34 and a component temperature difference of only ~40 K. One low luminosity (Tfact ~ 0.94, ~66 degree radius) large cool region of spots was iterated on the primary component in the WD Synthetic Light Curve computations. It appears in the Southern Hemisphere (colatitude 155 degrees). The Roche Lobe fill-out of the binary is ~17%. The inclination is ~86 degrees. An eclipse duration of ~10 minutes was determined for the primary eclipse and the light curve solution. Additional and more detailed information is given in this report.

  5. DETERMINACIÓN DE LAS FRACCIONES SARA DE ASFALTOS COLOMBIANOS ENVEJECIDOS AL MEDIO AMBIENTE EMPLEANDO CROMATOGRAFÍA LÍQUIDA EN COLUMNA DETERMINAÇÃO DAS FRAÇÕES SARA DE ASFALTOS COLOMBIANOS ENVELHECIDOS AO MÉDIO AMBIENTE EMPREGANDO CROMATOGRAFIA LÍQUIDA EM COLUNA DETERMINATION OF SARA FRACTIONS OF ENVIRONMENTALLY AGED COLOMBIAN ASPHALTS USING LIQUID CHROMATOGRAPHY COLUMN

    Directory of Open Access Journals (Sweden)

    Fredy Alberto Reyes

    2012-06-01

    Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p

  6. Program and abstracts

    International Nuclear Information System (INIS)

    1975-01-01

    Abstracts of the papers given at the conference are presented. The abstracts are arranged under sessions entitled:Theoretical Physics; Nuclear Physics; Solid State Physics; Spectroscopy; Physics Education; SANCGASS; Astronomy; Plasma Physics; Physics in Industry; Applied and General Physics

  7. Program and abstracts

    Energy Technology Data Exchange (ETDEWEB)

    1975-01-01

    Abstracts of the papers given at the conference are presented. The abstracts are arranged under sessions entitled:Theoretical Physics; Nuclear Physics; Solid State Physics; Spectroscopy; Physics Education; SANCGASS; Astronomy; Plasma Physics; Physics in Industry; Applied and General Physics.

  8. Introduction to abstract algebra

    CERN Document Server

    Nicholson, W Keith

    2012-01-01

    Praise for the Third Edition ". . . an expository masterpiece of the highest didactic value that has gained additional attractivity through the various improvements . . ."-Zentralblatt MATH The Fourth Edition of Introduction to Abstract Algebra continues to provide an accessible approach to the basic structures of abstract algebra: groups, rings, and fields. The book's unique presentation helps readers advance to abstract theory by presenting concrete examples of induction, number theory, integers modulo n, and permutations before the abstract structures are defined. Readers can immediately be

  9. Abstracting Concepts and Methods.

    Science.gov (United States)

    Borko, Harold; Bernier, Charles L.

    This text provides a complete discussion of abstracts--their history, production, organization, publication--and of indexing. Instructions for abstracting are outlined, and standards and criteria for abstracting are stated. Management, automation, and personnel are discussed in terms of possible economies that can be derived from the introduction…

  10. 2018 Congress Poster Abstracts

    Science.gov (United States)

    2018-02-21

    Each abstract has been indexed according to the first author. Abstracts appear as they were submitted and have not undergone editing or the Oncology Nursing Forum’s review process. Only abstracts that will be presented appear here. Poster numbers are subject to change. For updated poster numbers, visit congress.ons.org or check the Congress guide. Data published in abstracts presented at the ONS 43rd Annual Congress are embargoed until the conclusion of the presentation. Coverage and/or distribution of an abstract, poster, or any of its supplemental material to or by the news media, any commercial entity, or individuals, including the authors of said abstract, is strictly prohibited until the embargo is lifted. Promotion of general topics and speakers is encouraged within these guidelines.

  11. 2018 Congress Podium Abstracts

    Science.gov (United States)

    2018-02-21

    Each abstract has been indexed according to first author. Abstracts appear as they were submitted and have not undergone editing or the Oncology Nursing Forum’s review process. Only abstracts that will be presented appear here. For Congress scheduling information, visit congress.ons.org or check the Congress guide. Data published in abstracts presented at the ONS 43rd Annual Congress are embargoed until the conclusion of the presentation. Coverage and/or distribution of an abstract, poster, or any of its supplemental material to or by the news media, any commercial entity, or individuals, including the authors of said abstract, is strictly prohibited until the embargo is lifted. Promotion of general topics and speakers is encouraged within these guidelines.

  12. Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia

    Directory of Open Access Journals (Sweden)

    Tjitske F. Lawerman

    2017-12-01

    Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced

  13. sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

    DEFF Research Database (Denmark)

    Christner, Martin; Heinze, Constanze; Busch, Michael

    2012-01-01

    to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...

  14. Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

    Science.gov (United States)

    Godwin, Allison; Potvin, Geoff

    2017-01-01

    This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…

  15. Staphylococcus aureus Quorum Regulator SarA Targeted Compound, 2-[(Methylaminomethyl]phenol Inhibits Biofilm and Down-Regulates Virulence Genes

    Directory of Open Access Journals (Sweden)

    P. Balamurugan

    2017-07-01

    Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.

  16. Compilation of Theses Abstracts

    National Research Council Canada - National Science Library

    2005-01-01

    This publication contains unclassified/unrestricted abstracts of classified or restricted theses submitted for the degrees of Doctor of Philosophy, Master of Business Administration, Master of Science...

  17. Nuclear medicine. Abstracts; Nuklearmedizin 2000. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2000-07-01

    This issue of the journal contains the abstracts of the 183 conference papers as well as 266 posters presented at the conference. Subject fields covered are: Neurology, psychology, oncology, pediatrics, radiopharmacy, endocrinology, EDP, measuring equipment and methods, radiological protection, cardiology, and therapy. (orig./CB) [German] Die vorliegende Zeitschrift enthaelt die Kurzfassungen der 183 auf der Tagung gehaltenen Vortraege sowie der 226 praesentierten Poster, die sich mit den folgenden Themen befassten: Neurologie, Psychiatrie, Onkologie, Paediatrie, Radiopharmazie, Endokrinologie, EDV, Messtechnik, Strahlenschutz, Kardiologie sowie Therapie. (MG)

  18. Data Abstraction in GLISP.

    Science.gov (United States)

    Novak, Gordon S., Jr.

    GLISP is a high-level computer language (based on Lisp and including Lisp as a sublanguage) which is compiled into Lisp. GLISP programs are compiled relative to a knowledge base of object descriptions, a form of abstract datatypes. A primary goal of the use of abstract datatypes in GLISP is to allow program code to be written in terms of objects,…

  19. Truthful Monadic Abstractions

    DEFF Research Database (Denmark)

    Brock-Nannestad, Taus; Schürmann, Carsten

    2012-01-01

    indefinitely, finding neither a proof nor a disproof of a given subgoal. In this paper we characterize a family of truth-preserving abstractions from intuitionistic first-order logic to the monadic fragment of classical first-order logic. Because they are truthful, these abstractions can be used to disprove...

  20. Program and abstracts

    International Nuclear Information System (INIS)

    1976-01-01

    Abstracts of the papers given at the conference are presented. The abstracts are arranged under sessions entitled: Theoretical Physics; Nuclear Physics; Solid State Physics; Spectroscopy; Plasma Physics; Solar-Terrestrial Physics; Astrophysics and Astronomy; Radioastronomy; General Physics; Applied Physics; Industrial Physics

  1. Completeness of Lyapunov Abstraction

    Directory of Open Access Journals (Sweden)

    Rafael Wisniewski

    2013-08-01

    Full Text Available In this work, we continue our study on discrete abstractions of dynamical systems. To this end, we use a family of partitioning functions to generate an abstraction. The intersection of sub-level sets of the partitioning functions defines cells, which are regarded as discrete objects. The union of cells makes up the state space of the dynamical systems. Our construction gives rise to a combinatorial object - a timed automaton. We examine sound and complete abstractions. An abstraction is said to be sound when the flow of the time automata covers the flow lines of the dynamical systems. If the dynamics of the dynamical system and the time automaton are equivalent, the abstraction is complete. The commonly accepted paradigm for partitioning functions is that they ought to be transversal to the studied vector field. We show that there is no complete partitioning with transversal functions, even for particular dynamical systems whose critical sets are isolated critical points. Therefore, we allow the directional derivative along the vector field to be non-positive in this work. This considerably complicates the abstraction technique. For understanding dynamical systems, it is vital to study stable and unstable manifolds and their intersections. These objects appear naturally in this work. Indeed, we show that for an abstraction to be complete, the set of critical points of an abstraction function shall contain either the stable or unstable manifold of the dynamical system.

  2. The deleuzian abstract machines

    DEFF Research Database (Denmark)

    Werner Petersen, Erik

    2005-01-01

    To most people the concept of abstract machines is connected to the name of Alan Turing and the development of the modern computer. The Turing machine is universal, axiomatic and symbolic (E.g. operating on symbols). Inspired by Foucault, Deleuze and Guattari extended the concept of abstract...

  3. Check Sample Abstracts.

    Science.gov (United States)

    Alter, David; Grenache, David G; Bosler, David S; Karcher, Raymond E; Nichols, James; Rajadhyaksha, Aparna; Camelo-Piragua, Sandra; Rauch, Carol; Huddleston, Brent J; Frank, Elizabeth L; Sluss, Patrick M; Lewandrowski, Kent; Eichhorn, John H; Hall, Janet E; Rahman, Saud S; McPherson, Richard A; Kiechle, Frederick L; Hammett-Stabler, Catherine; Pierce, Kristin A; Kloehn, Erica A; Thomas, Patricia A; Walts, Ann E; Madan, Rashna; Schlesinger, Kathie; Nawgiri, Ranjana; Bhutani, Manoop; Kanber, Yonca; Abati, Andrea; Atkins, Kristen A; Farrar, Robert; Gopez, Evelyn Valencerina; Jhala, Darshana; Griffin, Sonya; Jhala, Khushboo; Jhala, Nirag; Bentz, Joel S; Emerson, Lyska; Chadwick, Barbara E; Barroeta, Julieta E; Baloch, Zubair W; Collins, Brian T; Middleton, Owen L; Davis, Gregory G; Haden-Pinneri, Kathryn; Chu, Albert Y; Keylock, Joren B; Ramoso, Robert; Thoene, Cynthia A; Stewart, Donna; Pierce, Arand; Barry, Michelle; Aljinovic, Nika; Gardner, David L; Barry, Michelle; Shields, Lisa B E; Arnold, Jack; Stewart, Donna; Martin, Erica L; Rakow, Rex J; Paddock, Christopher; Zaki, Sherif R; Prahlow, Joseph A; Stewart, Donna; Shields, Lisa B E; Rolf, Cristin M; Falzon, Andrew L; Hudacki, Rachel; Mazzella, Fermina M; Bethel, Melissa; Zarrin-Khameh, Neda; Gresik, M Vicky; Gill, Ryan; Karlon, William; Etzell, Joan; Deftos, Michael; Karlon, William J; Etzell, Joan E; Wang, Endi; Lu, Chuanyi M; Manion, Elizabeth; Rosenthal, Nancy; Wang, Endi; Lu, Chuanyi M; Tang, Patrick; Petric, Martin; Schade, Andrew E; Hall, Geraldine S; Oethinger, Margret; Hall, Geraldine; Picton, Avis R; Hoang, Linda; Imperial, Miguel Ranoa; Kibsey, Pamela; Waites, Ken; Duffy, Lynn; Hall, Geraldine S; Salangsang, Jo-Anne M; Bravo, Lulette Tricia C; Oethinger, Margaret D; Veras, Emanuela; Silva, Elvia; Vicens, Jimena; Silva, Elvio; Keylock, Joren; Hempel, James; Rushing, Elizabeth; Posligua, Lorena E; Deavers, Michael T; Nash, Jason W; Basturk, Olca; Perle, Mary Ann; Greco, Alba; Lee, Peng; Maru, Dipen; Weydert, Jamie Allen; Stevens, Todd M; Brownlee, Noel A; Kemper, April E; Williams, H James; Oliverio, Brock J; Al-Agha, Osama M; Eskue, Kyle L; Newlands, Shawn D; Eltorky, Mahmoud A; Puri, Puja K; Royer, Michael C; Rush, Walter L; Tavora, Fabio; Galvin, Jeffrey R; Franks, Teri J; Carter, James Elliot; Kahn, Andrea Graciela; Lozada Muñoz, Luis R; Houghton, Dan; Land, Kevin J; Nester, Theresa; Gildea, Jacob; Lefkowitz, Jerry; Lacount, Rachel A; Thompson, Hannis W; Refaai, Majed A; Quillen, Karen; Lopez, Ana Ortega; Goldfinger, Dennis; Muram, Talia; Thompson, Hannis

    2009-02-01

    The following abstracts are compiled from Check Sample exercises published in 2008. These peer-reviewed case studies assist laboratory professionals with continuing medical education and are developed in the areas of clinical chemistry, cytopathology, forensic pathology, hematology, microbiology, surgical pathology, and transfusion medicine. Abstracts for all exercises published in the program will appear annually in AJCP.

  4. The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters

    International Nuclear Information System (INIS)

    Iazzourene, F.

    1982-01-01

    The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr

  5. Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

    Directory of Open Access Journals (Sweden)

    Helena López

    2013-07-01

    Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.

  6. Os suínos da raça Bísara – oportunidades e desafios

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...

  7. Abstract Datatypes in PVS

    Science.gov (United States)

    Owre, Sam; Shankar, Natarajan

    1997-01-01

    PVS (Prototype Verification System) is a general-purpose environment for developing specifications and proofs. This document deals primarily with the abstract datatype mechanism in PVS which generates theories containing axioms and definitions for a class of recursive datatypes. The concepts underlying the abstract datatype mechanism are illustrated using ordered binary trees as an example. Binary trees are described by a PVS abstract datatype that is parametric in its value type. The type of ordered binary trees is then presented as a subtype of binary trees where the ordering relation is also taken as a parameter. We define the operations of inserting an element into, and searching for an element in an ordered binary tree; the bulk of the report is devoted to PVS proofs of some useful properties of these operations. These proofs illustrate various approaches to proving properties of abstract datatype operations. They also describe the built-in capabilities of the PVS proof checker for simplifying abstract datatype expressions.

  8. Completeness of Lyapunov Abstraction

    DEFF Research Database (Denmark)

    Wisniewski, Rafal; Sloth, Christoffer

    2013-01-01

    the vector field, which allows the generation of a complete abstraction. To compute the functions that define the subdivision of the state space in an algorithm, we formulate a sum of squares optimization problem. This optimization problem finds the best subdivisioning functions, with respect to the ability......This paper addresses the generation of complete abstractions of polynomial dynamical systems by timed automata. For the proposed abstraction, the state space is divided into cells by sublevel sets of functions. We identify a relation between these functions and their directional derivatives along...

  9. Scientific meeting abstracts

    International Nuclear Information System (INIS)

    1999-01-01

    The document is a collection of the scientific meeting abstracts in the fields of nuclear physics, medical sciences, chemistry, agriculture, environment, engineering, different aspects of energy and presents research done in 1999 in these fields

  10. Science meeting. Abstracts

    International Nuclear Information System (INIS)

    2000-01-01

    the document is a collection of the science meeting abstracts in the fields of nuclear physics, medical sciences, chemistry, agriculture, environment, engineering, material sciences different aspects of energy and presents research done in 2000 in these fields

  11. Mathematical games, abstract games

    CERN Document Server

    Neto, Joao Pedro

    2013-01-01

    User-friendly, visually appealing collection offers both new and classic strategic board games. Includes abstract games for two and three players and mathematical games such as Nim and games on graphs.

  12. Abstracts of contributed papers

    Energy Technology Data Exchange (ETDEWEB)

    1994-08-01

    This volume contains 571 abstracts of contributed papers to be presented during the Twelfth US National Congress of Applied Mechanics. Abstracts are arranged in the order in which they fall in the program -- the main sessions are listed chronologically in the Table of Contents. The Author Index is in alphabetical order and lists each paper number (matching the schedule in the Final Program) with its corresponding page number in the book.

  13. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  14. Abstract Objects of Verbs

    DEFF Research Database (Denmark)

    Robering, Klaus

    2014-01-01

    Verbs do often take arguments of quite different types. In an orthodox type-theoretic framework this results in an extreme polysemy of many verbs. In this article, it is shown that this unwanted consequence can be avoided when a theory of "abstract objects" is adopted according to which these obj......Verbs do often take arguments of quite different types. In an orthodox type-theoretic framework this results in an extreme polysemy of many verbs. In this article, it is shown that this unwanted consequence can be avoided when a theory of "abstract objects" is adopted according to which...... these objects represent non-objectual entities in contexts from which they are excluded by type restrictions. Thus these objects are "abstract'' in a functional rather than in an ontological sense: they function as representatives of other entities but they are otherwise quite normal objects. Three examples...

  15. Building Safe Concurrency Abstractions

    DEFF Research Database (Denmark)

    Madsen, Ole Lehrmann

    2014-01-01

    Concurrent object-oriented programming in Beta is based on semaphores and coroutines and the ability to define high-level concurrency abstractions like monitors, and rendezvous-based communication, and their associated schedulers. The coroutine mechanism of SIMULA has been generalized into the no......Concurrent object-oriented programming in Beta is based on semaphores and coroutines and the ability to define high-level concurrency abstractions like monitors, and rendezvous-based communication, and their associated schedulers. The coroutine mechanism of SIMULA has been generalized...

  16. Abstract Objects of Verbs

    DEFF Research Database (Denmark)

    2014-01-01

    Verbs do often take arguments of quite different types. In an orthodox type-theoretic framework this results in an extreme polysemy of many verbs. In this article, it is shown that this unwanted consequence can be avoided when a theory of "abstract objects" is adopted according to which...... these objects represent non-objectual entities in contexts from which they are excluded by type restrictions. Thus these objects are "abstract'' in a functional rather than in an ontological sense: they function as representatives of other entities but they are otherwise quite normal objects. Three examples...

  17. Nuclear medicine. Abstracts

    International Nuclear Information System (INIS)

    Anon.

    2000-01-01

    This issue of the journal contains the abstracts of the 183 conference papers as well as 266 posters presented at the conference. Subject fields covered are: Neurology, psychology, oncology, pediatrics, radiopharmacy, endocrinology, EDP, measuring equipment and methods, radiological protection, cardiology, and therapy. (orig./CB) [de

  18. Seismic Consequence Abstraction

    International Nuclear Information System (INIS)

    Gross, M.

    2004-01-01

    The primary purpose of this model report is to develop abstractions for the response of engineered barrier system (EBS) components to seismic hazards at a geologic repository at Yucca Mountain, Nevada, and to define the methodology for using these abstractions in a seismic scenario class for the Total System Performance Assessment - License Application (TSPA-LA). A secondary purpose of this model report is to provide information for criticality studies related to seismic hazards. The seismic hazards addressed herein are vibratory ground motion, fault displacement, and rockfall due to ground motion. The EBS components are the drip shield, the waste package, and the fuel cladding. The requirements for development of the abstractions and the associated algorithms for the seismic scenario class are defined in ''Technical Work Plan For: Regulatory Integration Modeling of Drift Degradation, Waste Package and Drip Shield Vibratory Motion and Seismic Consequences'' (BSC 2004 [DIRS 171520]). The development of these abstractions will provide a more complete representation of flow into and transport from the EBS under disruptive events. The results from this development will also address portions of integrated subissue ENG2, Mechanical Disruption of Engineered Barriers, including the acceptance criteria for this subissue defined in Section 2.2.1.3.2.3 of the ''Yucca Mountain Review Plan, Final Report'' (NRC 2003 [DIRS 163274])

  19. Annual Conference Abstracts

    Science.gov (United States)

    Journal of Engineering Education, 1972

    1972-01-01

    Includes abstracts of papers presented at the 80th Annual Conference of the American Society for Engineering Education. The broad areas include aerospace, affiliate and associate member council, agricultural engineering, biomedical engineering, continuing engineering studies, chemical engineering, civil engineering, computers, cooperative…

  20. WWNPQFT-2013 - Abstracts

    International Nuclear Information System (INIS)

    Cessac, B.; Bianchi, E.; Bellon, M.; Fried, H.; Krajewski, T.; Schubert, C.; Barre, J.; Hofmann, R.; Muller, B.; Raffaelli, B.

    2014-01-01

    The object of this Workshop is to consolidate and publicize new efforts in non perturbative-like Field Theories, relying in Functional Methods, Renormalization Group, and Dyson-Schwinger Equations. A presentation deals with effective vertices and photon-photon scattering in SU(2) Yang-Mills thermodynamics. This document gathers the abstracts of the presentations

  1. Seismic Consequence Abstraction

    Energy Technology Data Exchange (ETDEWEB)

    M. Gross

    2004-10-25

    The primary purpose of this model report is to develop abstractions for the response of engineered barrier system (EBS) components to seismic hazards at a geologic repository at Yucca Mountain, Nevada, and to define the methodology for using these abstractions in a seismic scenario class for the Total System Performance Assessment - License Application (TSPA-LA). A secondary purpose of this model report is to provide information for criticality studies related to seismic hazards. The seismic hazards addressed herein are vibratory ground motion, fault displacement, and rockfall due to ground motion. The EBS components are the drip shield, the waste package, and the fuel cladding. The requirements for development of the abstractions and the associated algorithms for the seismic scenario class are defined in ''Technical Work Plan For: Regulatory Integration Modeling of Drift Degradation, Waste Package and Drip Shield Vibratory Motion and Seismic Consequences'' (BSC 2004 [DIRS 171520]). The development of these abstractions will provide a more complete representation of flow into and transport from the EBS under disruptive events. The results from this development will also address portions of integrated subissue ENG2, Mechanical Disruption of Engineered Barriers, including the acceptance criteria for this subissue defined in Section 2.2.1.3.2.3 of the ''Yucca Mountain Review Plan, Final Report'' (NRC 2003 [DIRS 163274]).

  2. Full Abstraction for HOPLA

    DEFF Research Database (Denmark)

    Nygaard, Mikkel; Winskel, Glynn

    2003-01-01

    A fully abstract denotational semantics for the higher-order process language HOPLA is presented. It characterises contextual and logical equivalence, the latter linking up with simulation. The semantics is a clean, domain-theoretic description of processes as downwards-closed sets of computation...

  3. Abstraction and art.

    Science.gov (United States)

    Gortais, Bernard

    2003-07-29

    In a given social context, artistic creation comprises a set of processes, which relate to the activity of the artist and the activity of the spectator. Through these processes we see and understand that the world is vaster than it is said to be. Artistic processes are mediated experiences that open up the world. A successful work of art expresses a reality beyond actual reality: it suggests an unknown world using the means and the signs of the known world. Artistic practices incorporate the means of creation developed by science and technology and change forms as they change. Artists and the public follow different processes of abstraction at different levels, in the definition of the means of creation, of representation and of perception of a work of art. This paper examines how the processes of abstraction are used within the framework of the visual arts and abstract painting, which appeared during a period of growing importance for the processes of abstraction in science and technology, at the beginning of the twentieth century. The development of digital platforms and new man-machine interfaces allow multimedia creations. This is performed under the constraint of phases of multidisciplinary conceptualization using generic representation languages, which tend to abolish traditional frontiers between the arts: visual arts, drama, dance and music.

  4. Composing Interfering Abstract Protocols

    Science.gov (United States)

    2016-04-01

    Tecnologia , Universidade Nova de Lisboa, Caparica, Portugal. This document is a companion technical report of the paper, “Composing Interfering Abstract...a Ciência e Tecnologia (Portuguese Foundation for Science and Technology) through the Carnegie Mellon Portugal Program under grant SFRH / BD / 33765

  5. Abstract algebra for physicists

    International Nuclear Information System (INIS)

    Zeman, J.

    1975-06-01

    Certain recent models of composite hadrons involve concepts and theorems from abstract algebra which are unfamiliar to most theoretical physicists. The algebraic apparatus needed for an understanding of these models is summarized here. Particular emphasis is given to algebraic structures which are not assumed to be associative. (2 figures) (auth)

  6. Reasoning abstractly about resources

    Science.gov (United States)

    Clement, B.; Barrett, A.

    2001-01-01

    r describes a way to schedule high level activities before distributing them across multiple rovers in order to coordinate the resultant use of shared resources regardless of how each rover decides how to perform its activities. We present an algorithm for summarizing the metric resource requirements of an abstract activity based n the resource usages of its potential refinements.

  7. Abstracts of submitted papers

    International Nuclear Information System (INIS)

    1987-01-01

    The conference proceedings contain 152 abstracts of presented papers relating to various aspects of personnel dosimetry, the dosimetry of the working and living environment, various types of dosemeters and spectrometers, the use of radionuclides in various industrial fields, the migration of radionuclides on Czechoslovak territory after the Chernobyl accident, theoretical studies of some parameters of ionizing radiation detectors, and their calibration. (M.D.)

  8. The Abstraction Engine

    DEFF Research Database (Denmark)

    Fortescue, Michael David

    The main thesis of this book is that abstraction, far from being confined to higher formsof cognition, language and logical reasoning, has actually been a major driving forcethroughout the evolution of creatures with brains. It is manifest in emotive as well as rationalthought. Wending its way th...

  9. Impredicative concurrent abstract predicates

    DEFF Research Database (Denmark)

    Svendsen, Kasper; Birkedal, Lars

    2014-01-01

    We present impredicative concurrent abstract predicates { iCAP { a program logic for modular reasoning about concurrent, higher- order, reentrant, imperative code. Building on earlier work, iCAP uses protocols to reason about shared mutable state. A key novel feature of iCAP is the ability to dene...

  10. Abstract Film and Beyond.

    Science.gov (United States)

    Le Grice, Malcolm

    A theoretical and historical account of the main preoccupations of makers of abstract films is presented in this book. The book's scope includes discussion of nonrepresentational forms as well as examination of experiments in the manipulation of time in films. The ten chapters discuss the following topics: art and cinematography, the first…

  11. SPR 2015. Abstracts

    International Nuclear Information System (INIS)

    2015-01-01

    The volume contains the abstracts of the SPR (society for pediatric radiology) 2015 meeting covering the following issues: fetal imaging, muscoskeletal imaging, cardiac imaging, chest imaging, oncologic imaging, tools for process improvement, child abuse, contrast enhanced ultrasound, image gently - update of radiation dose recording/reporting/monitoring - meaningful or useless meaning?, pediatric thoracic imaging, ALARA.

  12. Beyond the abstractions?

    DEFF Research Database (Denmark)

    Olesen, Henning Salling

    2006-01-01

      The anniversary of the International Journal of Lifelong Education takes place in the middle of a conceptual landslide from lifelong education to lifelong learning. Contemporary discourses of lifelong learning etc are however abstractions behind which new functions and agendas for adult education...

  13. Abstracts of SIG Sessions.

    Science.gov (United States)

    Proceedings of the ASIS Annual Meeting, 1994

    1994-01-01

    Includes abstracts of 18 special interest group (SIG) sessions. Highlights include natural language processing, information science and terminology science, classification, knowledge-intensive information systems, information value and ownership issues, economics and theories of information science, information retrieval interfaces, fuzzy thinking…

  14. Circularity and Lambda Abstraction

    DEFF Research Database (Denmark)

    Danvy, Olivier; Thiemann, Peter; Zerny, Ian

    2013-01-01

    unknowns from what is done to them, which we lambda-abstract with functions. The circular unknowns then become dead variables, which we eliminate. The result is a strict circu- lar program a la Pettorossi. This transformation is reversible: given a strict circular program a la Pettorossi, we introduce...

  15. SPR 2015. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-04-01

    The volume contains the abstracts of the SPR (society for pediatric radiology) 2015 meeting covering the following issues: fetal imaging, muscoskeletal imaging, cardiac imaging, chest imaging, oncologic imaging, tools for process improvement, child abuse, contrast enhanced ultrasound, image gently - update of radiation dose recording/reporting/monitoring - meaningful or useless meaning?, pediatric thoracic imaging, ALARA.

  16. Controlling groundwater over abstraction

    NARCIS (Netherlands)

    Naber, Al Majd; Molle, Francois

    2017-01-01

    The control of groundwater over abstraction is a vexing problem worldwide. Jordan is one of the countries facing severe water scarcity which has implemented a wide range of measures and policies over the past 20 years. While the gap between formal legal and policy frameworks and local practices on

  17. Monadic abstract interpreters

    DEFF Research Database (Denmark)

    Sergey, Ilya; Devriese, Dominique; Might, Matthew

    2013-01-01

    to instrument an analysis with high-level strategies for improving precision and performance, such as abstract garbage collection and widening. While the paper itself runs the development for continuationpassing style, our generic implementation replays it for direct-style lambda-calculus and Featherweight Java...

  18. EBS Radionuclide Transport Abstraction

    International Nuclear Information System (INIS)

    Schreiner, R.

    2001-01-01

    The purpose of this work is to develop the Engineered Barrier System (EBS) radionuclide transport abstraction model, as directed by a written development plan (CRWMS M and O 1999a). This abstraction is the conceptual model that will be used to determine the rate of release of radionuclides from the EBS to the unsaturated zone (UZ) in the total system performance assessment-license application (TSPA-LA). In particular, this model will be used to quantify the time-dependent radionuclide releases from a failed waste package (WP) and their subsequent transport through the EBS to the emplacement drift wall/UZ interface. The development of this conceptual model will allow Performance Assessment Operations (PAO) and its Engineered Barrier Performance Department to provide a more detailed and complete EBS flow and transport abstraction. The results from this conceptual model will allow PA0 to address portions of the key technical issues (KTIs) presented in three NRC Issue Resolution Status Reports (IRSRs): (1) the Evolution of the Near-Field Environment (ENFE), Revision 2 (NRC 1999a), (2) the Container Life and Source Term (CLST), Revision 2 (NRC 1999b), and (3) the Thermal Effects on Flow (TEF), Revision 1 (NRC 1998). The conceptual model for flow and transport in the EBS will be referred to as the ''EBS RT Abstraction'' in this analysis/modeling report (AMR). The scope of this abstraction and report is limited to flow and transport processes. More specifically, this AMR does not discuss elements of the TSPA-SR and TSPA-LA that relate to the EBS but are discussed in other AMRs. These elements include corrosion processes, radionuclide solubility limits, waste form dissolution rates and concentrations of colloidal particles that are generally represented as boundary conditions or input parameters for the EBS RT Abstraction. In effect, this AMR provides the algorithms for transporting radionuclides using the flow geometry and radionuclide concentrations determined by other

  19. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Diego O Andrey

    Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  20. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    OpenAIRE

    Abdullah K. Shehabat

    2016-01-01

    This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...

  1. Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests

    International Nuclear Information System (INIS)

    Eifler, W.; Shepherd, I.M.

    1983-01-01

    Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix

  2. Land-use evaluation for sustainable construction in a protected area: A case of Sara mountain national park.

    Science.gov (United States)

    Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena

    2018-01-15

    The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Ghana Science Abstracts

    International Nuclear Information System (INIS)

    Entsua-Mensah, C.

    2004-01-01

    This issue of the Ghana Science Abstracts combines in one publication all the country's bibliographic output in science and technology. The objective is to provide a quick reference source to facilitate the work of information professionals, research scientists, lecturers and policy makers. It is meant to give users an idea of the depth and scope and results of the studies and projects carried out. The scope and coverage comprise research outputs, conference proceedings and periodical articles published in Ghana. It does not capture those that were published outside Ghana. Abstracts reported have been grouped under the following subject areas: Agriculture, Biochemistry, Biodiversity conservation, biological sciences, biotechnology, chemistry, dentistry, engineering, environmental management, forestry, information management, mathematics, medicine, physics, nuclear science, pharmacy, renewable energy and science education

  4. Research Abstracts of 1979.

    Science.gov (United States)

    1979-12-01

    abscess formation and tissue necrosis, its relationship to periodontal pockets was investigated. Specimens were obtained from maxillary and mandibular...of Organisms and Periodontal Pockets." (Abstract 4853). 10. SIMONSON, Lo Go, LAMDERTS, B. L. and JACROLA, Do R. - "Effects of Dextranases and other...the tip of the periodontal probe rests within epithelium, at or slightly apical to the coronal extent of the junctional epithelium. The purpose of

  5. NPP life management (abstracts)

    International Nuclear Information System (INIS)

    Litvinskij, L.L.; Barbashev, S.V.

    2002-01-01

    Abstracts of the papers presented at the International conference of the Ukrainian Nuclear Society 'NPP Life Management'. The following problems are considered: modernization of the NPP; NPP life management; waste and spent nuclear fuel management; decommissioning issues; control systems (including radiation and ecological control systems); information and control systems; legal and regulatory framework. State nuclear regulatory control; PR in nuclear power; training of personnel; economics of nuclear power engineering

  6. Research Abstracts of 1982.

    Science.gov (United States)

    1982-12-01

    Third Molars in Naval Personnel,- (Abstract #1430) 7. A. SEROWSKI* and F. AKER --"The Effect of Marine and Fresh-Water Atmospheric Environments on...record to determine changes in surface coverage or other outcomes -- extraction, endodontic therapy , crown placement -- which occurred over time. The...MR0412002-0443. 0 e5 History of Retention and Extraction of Third Molars in Naval Personnel. D. C. SCHROEDER*, J. C. CECIL and M. E. COHEN. Naval

  7. DEGRO 2017. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2017-06-15

    The volume includes abstracts of the Annual DEGRO Meeting 2017 covering lectures and poster sessions with the following issues: lymphoma, biology, physics, radioimmunotherapy, sarcomas and rare tumors, prostate carcinoma, lung tumors, benign lesions and new media, mamma carcinoma, gastrointestinal tumors, quality of life, care science and quality assurance, high-technology methods and palliative situation, head-and-neck tumors, brain tumors, central nervous system metastases, guidelines, radiation sensitivity, radiotherapy, radioimmunotherapy.

  8. Medical physics 2013. Abstracts

    International Nuclear Information System (INIS)

    Treuer, Harald

    2013-01-01

    The proceedings of the medical physics conference 2013 include abstract of lectures and poster sessions concerning the following issues: Tele-therapy - application systems, nuclear medicine and molecular imaging, neuromodulation, hearing and technical support, basic dosimetry, NMR imaging -CEST (chemical exchange saturation transfer), medical robotics, magnetic particle imaging, audiology, radiation protection, phase contrast - innovative concepts, particle therapy, brachytherapy, computerized tomography, quantity assurance, hybrid imaging techniques, diffusion and lung NMR imaging, image processing - visualization, cardiac and abdominal NMR imaging.

  9. SPR 2014. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2014-05-15

    The proceedings of the SPR 2014 meeting include abstracts on the following topics: Body imaging techniques: practical advice for clinic work; thoracic imaging: focus on the lungs; gastrointestinal imaging: focus on the pancreas and bowel; genitourinary imaging: focus on gonadal radiology; muscoskeletal imaging; focus on oncology; child abuse and nor child abuse: focus on radiography; impact of NMR and CT imaging on management of CHD; education and communication: art and practice in pediatric radiology.

  10. SPR 2014. Abstracts

    International Nuclear Information System (INIS)

    2014-01-01

    The proceedings of the SPR 2014 meeting include abstracts on the following topics: Body imaging techniques: practical advice for clinic work; thoracic imaging: focus on the lungs; gastrointestinal imaging: focus on the pancreas and bowel; genitourinary imaging: focus on gonadal radiology; muscoskeletal imaging; focus on oncology; child abuse and nor child abuse: focus on radiography; impact of NMR and CT imaging on management of CHD; education and communication: art and practice in pediatric radiology.

  11. WWNPQFT-2011 - Abstracts

    International Nuclear Information System (INIS)

    Bianchi, E.; Bender, C.; Culetu, H.; Fried, H.; Grossmann, A.; Hofmann, R.; Le Bellac, M.; Martinetti, P.; Muller, B.; Patras, F.; Raffaeli, B.; Vitting Andersen, J.

    2013-01-01

    The object of this workshop is to consolidate and publicize new efforts in non-perturbative field theories. This year the presentations deal with quantum gravity, non-commutative geometry, fat-tailed wave-functions, strongly coupled field theories, space-times two time-like dimensions, and multiplicative renormalization. A presentation is dedicated to the construction of a nucleon-nucleon potential from an analytical, non-perturbative gauge invariant QCD. This document gathers the abstracts of the presentations

  12. EBS Radionuclide Transport Abstraction

    International Nuclear Information System (INIS)

    J. Prouty

    2006-01-01

    The purpose of this report is to develop and analyze the engineered barrier system (EBS) radionuclide transport abstraction model, consistent with Level I and Level II model validation, as identified in Technical Work Plan for: Near-Field Environment and Transport: Engineered Barrier System: Radionuclide Transport Abstraction Model Report Integration (BSC 2005 [DIRS 173617]). The EBS radionuclide transport abstraction (or EBS RT Abstraction) is the conceptual model used in the total system performance assessment (TSPA) to determine the rate of radionuclide releases from the EBS to the unsaturated zone (UZ). The EBS RT Abstraction conceptual model consists of two main components: a flow model and a transport model. Both models are developed mathematically from first principles in order to show explicitly what assumptions, simplifications, and approximations are incorporated into the models used in the TSPA. The flow model defines the pathways for water flow in the EBS and specifies how the flow rate is computed in each pathway. Input to this model includes the seepage flux into a drift. The seepage flux is potentially split by the drip shield, with some (or all) of the flux being diverted by the drip shield and some passing through breaches in the drip shield that might result from corrosion or seismic damage. The flux through drip shield breaches is potentially split by the waste package, with some (or all) of the flux being diverted by the waste package and some passing through waste package breaches that might result from corrosion or seismic damage. Neither the drip shield nor the waste package survives an igneous intrusion, so the flux splitting submodel is not used in the igneous scenario class. The flow model is validated in an independent model validation technical review. The drip shield and waste package flux splitting algorithms are developed and validated using experimental data. The transport model considers advective transport and diffusive transport

  13. EBS Radionuclide Transport Abstraction

    Energy Technology Data Exchange (ETDEWEB)

    J. Prouty

    2006-07-14

    The purpose of this report is to develop and analyze the engineered barrier system (EBS) radionuclide transport abstraction model, consistent with Level I and Level II model validation, as identified in Technical Work Plan for: Near-Field Environment and Transport: Engineered Barrier System: Radionuclide Transport Abstraction Model Report Integration (BSC 2005 [DIRS 173617]). The EBS radionuclide transport abstraction (or EBS RT Abstraction) is the conceptual model used in the total system performance assessment (TSPA) to determine the rate of radionuclide releases from the EBS to the unsaturated zone (UZ). The EBS RT Abstraction conceptual model consists of two main components: a flow model and a transport model. Both models are developed mathematically from first principles in order to show explicitly what assumptions, simplifications, and approximations are incorporated into the models used in the TSPA. The flow model defines the pathways for water flow in the EBS and specifies how the flow rate is computed in each pathway. Input to this model includes the seepage flux into a drift. The seepage flux is potentially split by the drip shield, with some (or all) of the flux being diverted by the drip shield and some passing through breaches in the drip shield that might result from corrosion or seismic damage. The flux through drip shield breaches is potentially split by the waste package, with some (or all) of the flux being diverted by the waste package and some passing through waste package breaches that might result from corrosion or seismic damage. Neither the drip shield nor the waste package survives an igneous intrusion, so the flux splitting submodel is not used in the igneous scenario class. The flow model is validated in an independent model validation technical review. The drip shield and waste package flux splitting algorithms are developed and validated using experimental data. The transport model considers advective transport and diffusive transport

  14. Program and abstracts

    International Nuclear Information System (INIS)

    1978-01-01

    This volume contains the program and abstracts of the conference. The following topics are included: metal vapor molecular lasers, magnetohydrodynamics, rare gas halide and nuclear pumped lasers, transfer mechanisms in arcs, kinetic processes in rare gas halide lasers, arcs and flows, XeF kinetics and lasers, fundamental processes in excimer lasers, electrode effects and vacuum arcs, electron and ion transport, ion interactions and mobilities, glow discharges, diagnostics and afterglows, dissociative recombination, electron ionization and excitation, rare gas excimers and group VI lasers, breakdown, novel laser pumping techniques, electrode-related discharge phenomena, photon interactions, attachment, plasma chemistry and infrared lasers, electron scattering, and reactions of excited species

  15. Elements of abstract algebra

    CERN Document Server

    Clark, Allan

    1984-01-01

    This concise, readable, college-level text treats basic abstract algebra in remarkable depth and detail. An antidote to the usual surveys of structure, the book presents group theory, Galois theory, and classical ideal theory in a framework emphasizing proof of important theorems.Chapter I (Set Theory) covers the basics of sets. Chapter II (Group Theory) is a rigorous introduction to groups. It contains all the results needed for Galois theory as well as the Sylow theorems, the Jordan-Holder theorem, and a complete treatment of the simplicity of alternating groups. Chapter III (Field Theory)

  16. SPR 2017. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2017-05-15

    The conference proceedings SPR 2017 include abstracts on the following issues: gastrointestinal radiography - inflammatory bowel diseases, cardiovascular CTA, general muscoskeletal radiology, muscoskeletal congenital development diseases, general pediatric radiology - chest, muscoskeletal imaging - marrow and infectious disorders, state-of-the-art body MR imaging, practical pediatric sonography, quality and professionalism, CT imaging in congenital heart diseases, radiographic courses, body MT techniques, contrast enhanced ultrasound, machine learning, forensic imaging, the radiation dos conundrum - reconciling imaging, imagining and managing, the practice of radiology, interventional radiology, neuroradiology, PET/MR.

  17. Ghana energy abstracts

    International Nuclear Information System (INIS)

    Entsua-Mensah, Clement

    1994-01-01

    Ghana Energy Abstracts 1994 is the first issue of an annual publication of the Energy information Centre. The aim is to combine in one publication the country' s bibliographic output on energy so as to provide a valuable source of reference for policy makers, planners,and researchers. It covers the broad spectrum of energy including; energy conservation, energy resource management, petroleum and renewable energy resources.The documents listed comprise research reports, baseline studies,conference proceedings, periodical articles dissertations and theses. Keywords and author indexes have been provided to facilitate easy reference. (C.E.M)

  18. Parameterized Dataflow (Extended Abstract

    Directory of Open Access Journals (Sweden)

    Dominic Duggan

    2016-10-01

    Full Text Available Dataflow networks have application in various forms of stream processing, for example for parallel processing of multimedia data. The description of dataflow graphs, including their firing behavior, is typically non-compositional and not amenable to separate compilation. This article considers a dataflow language with a type and effect system that captures the firing behavior of actors. This system allows definitions to abstract over actor firing rates, supporting the definition and safe composition of actor definitions where firing rates are not instantiated until a dataflow graph is launched.

  19. ESPR 2015. Abstracts

    International Nuclear Information System (INIS)

    2015-01-01

    The volume includes the abstracts of the ESPR 2015 covering the following topics: PCG (post graduate courses): Radiography; fluoroscopy and general issue; nuclear medicine, interventional radiology and hybrid imaging, pediatric CT, pediatric ultrasound; MRI in childhood. Scientific sessions and task force sessions: International aspects; neuroradiology, neonatal imaging, engineering techniques to simulate injury in child abuse, CT - dose and quality, challenges in the chest, cardiovascular and chest, muscoskeletal, oncology, pediatric uroradiology and abdominal imaging, fetal and postmortem imaging, education and global challenges, neuroradiology - head and neck, gastrointestinal and genitourinary.

  20. ABSTRACTION OF DRIFT SEEPAGE

    International Nuclear Information System (INIS)

    Wilson, Michael L.

    2001-01-01

    Drift seepage refers to flow of liquid water into repository emplacement drifts, where it can potentially contribute to degradation of the engineered systems and release and transport of radionuclides within the drifts. Because of these important effects, seepage into emplacement drifts is listed as a ''principal factor for the postclosure safety case'' in the screening criteria for grading of data in Attachment 1 of AP-3.15Q, Rev. 2, ''Managing Technical Product Inputs''. Abstraction refers to distillation of the essential components of a process model into a form suitable for use in total-system performance assessment (TSPA). Thus, the purpose of this analysis/model is to put the information generated by the seepage process modeling in a form appropriate for use in the TSPA for the Site Recommendation. This report also supports the Unsaturated-Zone Flow and Transport Process Model Report. The scope of the work is discussed below. This analysis/model is governed by the ''Technical Work Plan for Unsaturated Zone Flow and Transport Process Model Report'' (CRWMS MandO 2000a). Details of this activity are in Addendum A of the technical work plan. The original Work Direction and Planning Document is included as Attachment 7 of Addendum A. Note that the Work Direction and Planning Document contains tasks identified for both Performance Assessment Operations (PAO) and Natural Environment Program Operations (NEPO). Only the PAO tasks are documented here. The planning for the NEPO activities is now in Addendum D of the same technical work plan and the work is documented in a separate report (CRWMS MandO 2000b). The Project has been reorganized since the document was written. The responsible organizations in the new structure are the Performance Assessment Department and the Unsaturated Zone Department, respectively. The work plan for the seepage abstraction calls for determining an appropriate abstraction methodology, determining uncertainties in seepage, and providing

  1. IPR 2016. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-05-15

    The volume on the meeting of pediatric radiology includes abstract on the following issues: chest, cardiovascular system, neuroradiology, CT radiation DRs (diagnostic reference levels) and dose reporting guidelines, genitourinary imaging, gastrointestinal radiology, oncology an nuclear medicine, whole body imaging, fetal/neonates imaging, child abuse, oncology and hybrid imaging, value added imaging, muscoskeletal imaging, dose and radiation safety, imaging children - immobilization and distraction techniques, information - education - QI and healthcare policy, ALARA, the knowledge skills and competences for a technologist/radiographer in pediatric radiology, full exploitation of new technological features in pediatric CT, image quality issues in pediatrics, abdominal imaging, interventional radiology, MR contrast agents, tumor - mass imaging, cardiothoracic imaging, ultrasonography.

  2. ESPR 2015. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-05-10

    The volume includes the abstracts of the ESPR 2015 covering the following topics: PCG (post graduate courses): Radiography; fluoroscopy and general issue; nuclear medicine, interventional radiology and hybrid imaging, pediatric CT, pediatric ultrasound; MRI in childhood. Scientific sessions and task force sessions: International aspects; neuroradiology, neonatal imaging, engineering techniques to simulate injury in child abuse, CT - dose and quality, challenges in the chest, cardiovascular and chest, muscoskeletal, oncology, pediatric uroradiology and abdominal imaging, fetal and postmortem imaging, education and global challenges, neuroradiology - head and neck, gastrointestinal and genitourinary.

  3. IPR 2016. Abstracts

    International Nuclear Information System (INIS)

    2016-01-01

    The volume on the meeting of pediatric radiology includes abstract on the following issues: chest, cardiovascular system, neuroradiology, CT radiation DRs (diagnostic reference levels) and dose reporting guidelines, genitourinary imaging, gastrointestinal radiology, oncology an nuclear medicine, whole body imaging, fetal/neonates imaging, child abuse, oncology and hybrid imaging, value added imaging, muscoskeletal imaging, dose and radiation safety, imaging children - immobilization and distraction techniques, information - education - QI and healthcare policy, ALARA, the knowledge skills and competences for a technologist/radiographer in pediatric radiology, full exploitation of new technological features in pediatric CT, image quality issues in pediatrics, abdominal imaging, interventional radiology, MR contrast agents, tumor - mass imaging, cardiothoracic imaging, ultrasonography.

  4. EBS Radionuclide Transport Abstraction

    Energy Technology Data Exchange (ETDEWEB)

    J.D. Schreiber

    2005-08-25

    The purpose of this report is to develop and analyze the engineered barrier system (EBS) radionuclide transport abstraction model, consistent with Level I and Level II model validation, as identified in ''Technical Work Plan for: Near-Field Environment and Transport: Engineered Barrier System: Radionuclide Transport Abstraction Model Report Integration'' (BSC 2005 [DIRS 173617]). The EBS radionuclide transport abstraction (or EBS RT Abstraction) is the conceptual model used in the total system performance assessment for the license application (TSPA-LA) to determine the rate of radionuclide releases from the EBS to the unsaturated zone (UZ). The EBS RT Abstraction conceptual model consists of two main components: a flow model and a transport model. Both models are developed mathematically from first principles in order to show explicitly what assumptions, simplifications, and approximations are incorporated into the models used in the TSPA-LA. The flow model defines the pathways for water flow in the EBS and specifies how the flow rate is computed in each pathway. Input to this model includes the seepage flux into a drift. The seepage flux is potentially split by the drip shield, with some (or all) of the flux being diverted by the drip shield and some passing through breaches in the drip shield that might result from corrosion or seismic damage. The flux through drip shield breaches is potentially split by the waste package, with some (or all) of the flux being diverted by the waste package and some passing through waste package breaches that might result from corrosion or seismic damage. Neither the drip shield nor the waste package survives an igneous intrusion, so the flux splitting submodel is not used in the igneous scenario class. The flow model is validated in an independent model validation technical review. The drip shield and waste package flux splitting algorithms are developed and validated using experimental data. The transport

  5. EBS Radionuclide Transport Abstraction

    International Nuclear Information System (INIS)

    J.D. Schreiber

    2005-01-01

    The purpose of this report is to develop and analyze the engineered barrier system (EBS) radionuclide transport abstraction model, consistent with Level I and Level II model validation, as identified in ''Technical Work Plan for: Near-Field Environment and Transport: Engineered Barrier System: Radionuclide Transport Abstraction Model Report Integration'' (BSC 2005 [DIRS 173617]). The EBS radionuclide transport abstraction (or EBS RT Abstraction) is the conceptual model used in the total system performance assessment for the license application (TSPA-LA) to determine the rate of radionuclide releases from the EBS to the unsaturated zone (UZ). The EBS RT Abstraction conceptual model consists of two main components: a flow model and a transport model. Both models are developed mathematically from first principles in order to show explicitly what assumptions, simplifications, and approximations are incorporated into the models used in the TSPA-LA. The flow model defines the pathways for water flow in the EBS and specifies how the flow rate is computed in each pathway. Input to this model includes the seepage flux into a drift. The seepage flux is potentially split by the drip shield, with some (or all) of the flux being diverted by the drip shield and some passing through breaches in the drip shield that might result from corrosion or seismic damage. The flux through drip shield breaches is potentially split by the waste package, with some (or all) of the flux being diverted by the waste package and some passing through waste package breaches that might result from corrosion or seismic damage. Neither the drip shield nor the waste package survives an igneous intrusion, so the flux splitting submodel is not used in the igneous scenario class. The flow model is validated in an independent model validation technical review. The drip shield and waste package flux splitting algorithms are developed and validated using experimental data. The transport model considers

  6. Problems in abstract algebra

    CERN Document Server

    Wadsworth, A R

    2017-01-01

    This is a book of problems in abstract algebra for strong undergraduates or beginning graduate students. It can be used as a supplement to a course or for self-study. The book provides more variety and more challenging problems than are found in most algebra textbooks. It is intended for students wanting to enrich their learning of mathematics by tackling problems that take some thought and effort to solve. The book contains problems on groups (including the Sylow Theorems, solvable groups, presentation of groups by generators and relations, and structure and duality for finite abelian groups); rings (including basic ideal theory and factorization in integral domains and Gauss's Theorem); linear algebra (emphasizing linear transformations, including canonical forms); and fields (including Galois theory). Hints to many problems are also included.

  7. ICENES 2007 Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Sahin, S [Gazi University, Technical Education Faculty, Ankara (Turkey)

    2007-07-01

    In this book Conference Program and Abstracts were included 13th International Conference on Emerging Nuclear Energy Systems which held between 03-08 June 2007 in Istanbul, Turkey. The main objective of International Conference series on Emerging Nuclear Energy Systems (ICENES) is to provide an international scientific and technical forum for scientists, engineers, industry leaders, policy makers, decision makers and young professionals who will shape future energy supply and technology , for a broad review and discussion of various advanced, innovative and non-conventional nuclear energy production systems. The main topics of 159 accepted papers from 35 countries are fusion science and technology, fission reactors, accelerator driven systems, transmutation, laser in nuclear technology, radiation shielding, nuclear reactions, hydrogen energy, solar energy, low energy physics and societal issues.

  8. ICENES 2007 Abstracts

    International Nuclear Information System (INIS)

    Sahin, S.

    2007-01-01

    In this book Conference Program and Abstracts were included 13th International Conference on Emerging Nuclear Energy Systems which held between 03-08 June 2007 in Istanbul, Turkey. The main objective of International Conference series on Emerging Nuclear Energy Systems (ICENES) is to provide an international scientific and technical forum for scientists, engineers, industry leaders, policy makers, decision makers and young professionals who will shape future energy supply and technology , for a broad review and discussion of various advanced, innovative and non-conventional nuclear energy production systems. The main topics of 159 accepted papers from 35 countries are fusion science and technology, fission reactors, accelerator driven systems, transmutation, laser in nuclear technology, radiation shielding, nuclear reactions, hydrogen energy, solar energy, low energy physics and societal issues

  9. Computational Abstraction Steps

    DEFF Research Database (Denmark)

    Thomsen, Lone Leth; Thomsen, Bent; Nørmark, Kurt

    2010-01-01

    and class instantiations. Our teaching experience shows that many novice programmers find it difficult to write programs with abstractions that materialise to concrete objects later in the development process. The contribution of this paper is the idea of initiating a programming process by creating...... or capturing concrete values, objects, or actions. As the next step, some of these are lifted to a higher level by computational means. In the object-oriented paradigm the target of such steps is classes. We hypothesise that the proposed approach primarily will be beneficial to novice programmers or during...... the exploratory phase of a program development process. In some specific niches it is also expected that our approach will benefit professional programmers....

  10. IEEE conference record -- Abstracts

    International Nuclear Information System (INIS)

    Anon.

    1994-01-01

    This conference covers the following areas: computational plasma physics; vacuum electronic; basic phenomena in fully ionized plasmas; plasma, electron, and ion sources; environmental/energy issues in plasma science; space plasmas; plasma processing; ball lightning/spherical plasma configurations; plasma processing; fast wave devices; magnetic fusion; basic phenomena in partially ionized plasma; dense plasma focus; plasma diagnostics; basic phenomena in weakly ionized gases; fast opening switches; MHD; fast z-pinches and x-ray lasers; intense ion and electron beams; laser-produced plasmas; microwave plasma interactions; EM and ETH launchers; solid state plasmas and switches; intense beam microwaves; and plasmas for lighting. Separate abstracts were prepared for 416 papers in this conference

  11. Probabilistic model fitting for spatio-temporal variability studies of precipitation: the Sara-Brut system - a case study

    International Nuclear Information System (INIS)

    Dorado Delgado, Jennifer; Burbano Criollo, Juan Carlos; Molina Tabares, Jose Manuel; Carvajal Escobar, Yesid; Aristizabal, Hector Fabio

    2006-01-01

    In this study, space and time variability of monthly and annual rainfall was analyzed for the downstream influence zone of a Colombian supply-regulation reservoir, Sara-Brut, located on the Cauca valley department. Monthly precipitation data from 18 gauge stations and for a 29-year record (1975-2003) were used. These data were processed by means of time series completion, consistency analyses and sample statistics computations. Theoretical probabilistic distribution models such as Gumbel, normal, lognormal and wake by, and other empirical distributions such as Weibull and Landwehr were applied in order to fit the historical precipitation data set. The fit standard error (FSE) was used to test the goodness of fit of the theoretical distribution models and to choose the best of this probabilistic function. The wake by approach showed the best goodness of fit in 89% of the total gauges taken into account. Time variability was analyzed by means of wake by estimated values of monthly and annual precipitation associated with return periods of 1,052, 1,25, 2, 10, 20 and 50 years. Precipitation space variability is presents by means of ArcGis v8.3 and using krigging as interpolation method. In general terms the results obtained from this study show significant distribution variability in precipitation over the whole area, and particularity, the formation of dry and humid nucleus over the northeastern strip and microclimates at the southwestern and central zone of the study area were observed, depending on the season of year. The mentioned distribution pattern is likely caused by the influence of pacific wind streams, which come from the Andean western mountain range. It is expected that the results from this work be helpful for future planning and hydrologic project design

  12. Exoplanets and Multiverses (Abstract)

    Science.gov (United States)

    Trimble, V.

    2016-12-01

    (Abstract only) To the ancients, the Earth was the Universe, of a size to be crossed by a god in a day, by boat or chariot, and by humans in a lifetime. Thus an exoplanet would have been a multiverse. The ideas gradually separated over centuries, with gradual acceptance of a sun-centered solar system, the stars as suns likely to have their own planets, other galaxies beyond the Milky Way, and so forth. And whenever the community divided between "just one' of anything versus "many," the "manies" have won. Discoveries beginning in 1991 and 1995 have gradually led to a battalion or two of planets orbiting other stars, very few like our own little family, and to moderately serious consideration of even larger numbers of other universes, again very few like our own. I'm betting, however, on habitable (though not necessarily inhabited) exoplanets to be found, and habitable (though again not necessarily inhabited) universes. Only the former will yield pretty pictures.

  13. SENSE 2010, Abstracts

    International Nuclear Information System (INIS)

    Lumsden, M.D.; Argyriou, D.N.; Inosov, D.

    2012-01-01

    The microscopic origin of unconventional superconductivity continues to attract the attention of the condensed matter community. Whereas rare-earth / actinide-based intermetallic and copper oxide-based high temperature superconductors are studied for more than twenty years, the iron-based superconductors have been in the focus of interest since their recent discovery. Inelastic neutron scattering experiments have been of particular importance for the understanding of the magnetic and superconducting properties of these compounds. With its 29 talks and 14 posters the workshop provided a forum for the 71 registered participants to review and discuss experimental achievements, recognize the observed synergy and differences as well as discuss theoretical efforts to identify the symmetry of the superconducting order parameter in addition to the coupling mechanisms of the Cooper pairs. The workshop covered different topics relevant for the study of unconventional superconductivity. Magnetization and lattice dynamics such as spin resonances, phonons, magnetic and other excitations as studied by spectroscopic methods were presented. Investigations of (doping, pressure and magnetic field dependent) phase diagrams, electronic states as well as vortex physics by the various diffraction techniques were also addressed. This document gathers only the abstracts of the papers. (authors)

  14. Book of Abstracts

    International Nuclear Information System (INIS)

    2013-06-01

    ANIMMA 2013 is the third of a series of conferences devoted to endorsing and promoting scientific and technical activities based on nuclear instrumentation and measurements. The main objective of ANIMMA conference is to unite the various scientific communities not only involved in nuclear instrumentation and measurements, but also in nuclear medicine and radiation. The conference is all about getting scientists, engineers and the industry to meet, exchange cultures and identify new scientific and technical prospects to help overcome both current and future unresolved issues. The conference provides scientists and engineers with a veritable opportunity to compare their latest research and development in different areas: physics, nuclear energy, nuclear fuel cycle, safety, security, future energies (GEN III+, GENIV, ITER, ...). The conference topics include instrumentation and measurement methods for: Fundamental physics; Fusion diagnostics and technology; Nuclear power reactors; Research reactors; Nuclear fuel cycle; Decommissioning, dismantling and remote handling; Safeguards, homeland security; Severe accident monitoring; Environmental and medical sciences; Education, training and outreach. This document brings together the abstracts of the presentations. Each presentation (full paper) is analysed separately and entered in INIS

  15. Stellar Presentations (Abstract)

    Science.gov (United States)

    Young, D.

    2015-12-01

    (Abstract only) The AAVSO is in the process of expanding its education, outreach and speakers bureau program. powerpoint presentations prepared for specific target audiences such as AAVSO members, educators, students, the general public, and Science Olympiad teams, coaches, event supervisors, and state directors will be available online for members to use. The presentations range from specific and general content relating to stellar evolution and variable stars to specific activities for a workshop environment. A presentation—even with a general topic—that works for high school students will not work for educators, Science Olympiad teams, or the general public. Each audience is unique and requires a different approach. The current environment necessitates presentations that are captivating for a younger generation that is embedded in a highly visual and sound-bite world of social media, twitter and U-Tube, and mobile devices. For educators, presentations and workshops for themselves and their students must support the Next Generation Science Standards (NGSS), the Common Core Content Standards, and the Science Technology, Engineering and Mathematics (STEM) initiative. Current best practices for developing relevant and engaging powerpoint presentations to deliver information to a variety of targeted audiences will be presented along with several examples.

  16. Automated Supernova Discovery (Abstract)

    Science.gov (United States)

    Post, R. S.

    2015-12-01

    (Abstract only) We are developing a system of robotic telescopes for automatic recognition of Supernovas as well as other transient events in collaboration with the Puckett Supernova Search Team. At the SAS2014 meeting, the discovery program, SNARE, was first described. Since then, it has been continuously improved to handle searches under a wide variety of atmospheric conditions. Currently, two telescopes are used to build a reference library while searching for PSN with a partial library. Since data is taken every night without clouds, we must deal with varying atmospheric and high background illumination from the moon. Software is configured to identify a PSN, reshoot for verification with options to change the run plan to acquire photometric or spectrographic data. The telescopes are 24-inch CDK24, with Alta U230 cameras, one in CA and one in NM. Images and run plans are sent between sites so the CA telescope can search while photometry is done in NM. Our goal is to find bright PSNs with magnitude 17.5 or less which is the limit of our planned spectroscopy. We present results from our first automated PSN discoveries and plans for PSN data acquisition.

  17. SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-04-01

    The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

  18. A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta

    OpenAIRE

    Carvalho, Marieta

    2014-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...

  19. Abstraction of Drift Seepage

    International Nuclear Information System (INIS)

    J.T. Birkholzer

    2004-01-01

    This model report documents the abstraction of drift seepage, conducted to provide seepage-relevant parameters and their probability distributions for use in Total System Performance Assessment for License Application (TSPA-LA). Drift seepage refers to the flow of liquid water into waste emplacement drifts. Water that seeps into drifts may contact waste packages and potentially mobilize radionuclides, and may result in advective transport of radionuclides through breached waste packages [''Risk Information to Support Prioritization of Performance Assessment Models'' (BSC 2003 [DIRS 168796], Section 3.3.2)]. The unsaturated rock layers overlying and hosting the repository form a natural barrier that reduces the amount of water entering emplacement drifts by natural subsurface processes. For example, drift seepage is limited by the capillary barrier forming at the drift crown, which decreases or even eliminates water flow from the unsaturated fractured rock into the drift. During the first few hundred years after waste emplacement, when above-boiling rock temperatures will develop as a result of heat generated by the decay of the radioactive waste, vaporization of percolation water is an additional factor limiting seepage. Estimating the effectiveness of these natural barrier capabilities and predicting the amount of seepage into drifts is an important aspect of assessing the performance of the repository. The TSPA-LA therefore includes a seepage component that calculates the amount of seepage into drifts [''Total System Performance Assessment (TSPA) Model/Analysis for the License Application'' (BSC 2004 [DIRS 168504], Section 6.3.3.1)]. The TSPA-LA calculation is performed with a probabilistic approach that accounts for the spatial and temporal variability and inherent uncertainty of seepage-relevant properties and processes. Results are used for subsequent TSPA-LA components that may handle, for example, waste package corrosion or radionuclide transport

  20. Book of abstracts

    International Nuclear Information System (INIS)

    1987-01-01

    The document contains abstracts of 24 review papers, 24 invited papers, 24 oral contributions and 120 posters. 10 review papers summarize the status of laser fusion research and progress in high-power laser facilities in major world laboratories. Four papers review research programs (laser-matter interaction studies and X-ray source development) based on KrF laser systems. Other review papers discuss the problems of laser energy conversion into X-rays in laser-heated cavities, X-ray lasing at shorter wavelengths, optimization of targets for inertial fusion. Two review papers are devoted to light ion fusion. The subjects of most invited papers are special problems of current laser plasma research, such as hot electron generation, nonlinear resonance absorption, energy accumulation limits, pellet ignition, conversion of laser light into X-rays, high-pressure plasma generation. Three invited papers review laser plasma research in Czechoslovakia, Poland and Spain. One paper suggests a new method of producing muonic superdense matter. The remaining inivited papers deal with the progress in XUV lasers and with laser plasma applications for further laser development. Of the papers accepted for oral presentation 12 papers discuss various problems of laser-plasma interaction; 4 papers deal with laser targets, 4 papers with laser-initiated X-ray sources, 3 papers with the diagnostics of laser-produced plasma. The last oral contribution presents the main principles of the excimer laser theory. The largest group of posters is related to laser-plasma interaction and energy absorption problems, to laser-target interaction and various methods of laser plasma diagnostics. The other posters deal with plasma applications in laser development, plasma mirrors, Brillouin and Raman scattering, X-ray emission, harmonic generation, electron acceleration, production of high-Z plasmas and other related problems. (J.U.)

  1. Advance Organizers: Concret Versus Abstract.

    Science.gov (United States)

    Corkill, Alice J.; And Others

    1988-01-01

    Two experiments examined the relative effects of concrete and abstract advance organizers on students' memory for subsequent prose. Results of the experiments are discussed in terms of the memorability, familiarity, and visualizability of concrete and abstract verbal materials. (JD)

  2. Typesafe Abstractions for Tensor Operations

    OpenAIRE

    Chen, Tongfei

    2017-01-01

    We propose a typesafe abstraction to tensors (i.e. multidimensional arrays) exploiting the type-level programming capabilities of Scala through heterogeneous lists (HList), and showcase typesafe abstractions of common tensor operations and various neural layers such as convolution or recurrent neural networks. This abstraction could lay the foundation of future typesafe deep learning frameworks that runs on Scala/JVM.

  3. Grounding abstractness: Abstract concepts and the activation of the mouth

    Directory of Open Access Journals (Sweden)

    Anna M Borghi

    2016-10-01

    Full Text Available One key issue for theories of cognition is how abstract concepts, such as freedom, are represented. According to the WAT (Words As social Tools proposal, abstract concepts activate both sensorimotor and linguistic/social information, and their acquisition modality involves the linguistic experience more than the acquisition of concrete concepts. We report an experiment in which participants were presented with abstract and concrete definitions followed by concrete and abstract target-words. When the definition and the word matched, participants were required to press a key, either with the hand or with the mouth. Response times and accuracy were recorded. As predicted, we found that abstract definitions and abstract words yielded slower responses and more errors compared to concrete definitions and concrete words. More crucially, there was an interaction between the target-words and the effector used to respond (hand, mouth. While responses with the mouth were overall slower, the advantage of the hand over the mouth responses was more marked with concrete than with abstract concepts. The results are in keeping with grounded and embodied theories of cognition and support the WAT proposal, according to which abstract concepts evoke linguistic-social information, hence activate the mouth. The mechanisms underlying the mouth activation with abstract concepts (re-enactment of acquisition experience, or re-explanation of the word meaning, possibly through inner talk are discussed. To our knowledge this is the first behavioral study demonstrating with real words that the advantage of the hand over the mouth is more marked with concrete than with abstract concepts, likely because of the activation of linguistic information with abstract concepts.

  4. Mechanical Engineering Department technical abstracts

    International Nuclear Information System (INIS)

    Denney, R.M.

    1982-01-01

    The Mechanical Engineering Department publishes listings of technical abstracts twice a year to inform readers of the broad range of technical activities in the Department, and to promote an exchange of ideas. Details of the work covered by an abstract may be obtained by contacting the author(s). Overall information about current activities of each of the Department's seven divisions precedes the technical abstracts

  5. Nuclear code abstracts (1975 edition)

    International Nuclear Information System (INIS)

    Akanuma, Makoto; Hirakawa, Takashi

    1976-02-01

    Nuclear Code Abstracts is compiled in the Nuclear Code Committee to exchange information of the nuclear code developments among members of the committee. Enlarging the collection, the present one includes nuclear code abstracts obtained in 1975 through liaison officers of the organizations in Japan participating in the Nuclear Energy Agency's Computer Program Library at Ispra, Italy. The classification of nuclear codes and the format of code abstracts are the same as those in the library. (auth.)

  6. The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

    Directory of Open Access Journals (Sweden)

    John M Morrison

    2012-03-01

    Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.

  7. ABSTRACT

    African Journals Online (AJOL)

    descriptive statistics, Z-test and multiple regressiion analysis. Results show that the ... protein intake from animal sources, which is less than 10gm/capita /day ... production offish and fish products through effective fisheries extension efforts ...

  8. ABSTRACT

    African Journals Online (AJOL)

    in Imo state, the gender-perceived production constraints; the relative ... to establishing if stereotyping such operations along gender lines will ... difference in returns accruing to male and female small ruminant ..... The bias against Sheep and.

  9. ABSTRACT

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Commemorating the 100th Anniversary of the Revolution of 1911 Promoting the Deep Development of the CPC History and National History by the Research and Publication of the History of the Revolution of …………1911 Zhu Jiamu (4)

  10. ABSTRACT

    African Journals Online (AJOL)

    Dr Obe

    inner forces (bending moments, shearing forces etc) are usually redistributed. Cracks that often appear within the walls of tall buildings during constructions point to this phenomenon. It has also been recognized that foundation engineering is complicated. (1). Also settlement has been accepted as stress induced and time ...

  11. Abstract

    African Journals Online (AJOL)

    1 Uyole Agr.icultural Research Institute, Ministry of Agriculture, Food Security and Co-operatives,. P.o Box 400 ... from this study suggest that participation in dairy market depended on access to both in-put and output ..... Socio-economics and.

  12. abstract

    Directory of Open Access Journals (Sweden)

    abstract abstract

    2016-07-01

    Full Text Available Introduction: Strawberry (fragaria×ananassa Duch. fruit characterized by short storage life, often estimated last less than one week even under optimum conditions at 8°C. The loss of fruit quality is often caused by gray mold (Botrytis cinerea that is the most frequent reported postharvest disease in strawberry during storage (6. In recent years, considerable attention has given to elimination of synthetic chemical and fungicides application and development of various alternative strategies for controlling fruit and vegetables diseases (2. One strategy is replacement of natural products with plant origin such as essential oil and methyl salicylate (MeSA. Essential oils are volatile, natural and complex compounds characterized by a strong odor formed by aromatic plants in form of secondary metabolites. In nature, essential similar oils that extract from lavender (Lavandula angustifolia play an important role in protection of the plants against pathogen incidence that can be replaced by synthetic fungicides (1, 4 and 14. MeSA is also a volatile natural compound synthesized from salicylic acid which has an important role in the plant defense-mechanism, as well as plant growth and development (5, 19 and 20. Therefore, the main objective of this research was to study the effects of MeSA and lavender essential oil (LEO on decay control caused by Botrytis cinerea as well as post-harvest quality indices of strawberry fruits during cold storage. Material and Methods: First, antifungal activity was studied by using a contact assay (in vitro, which produces hyphal growth inhibition. Briefly, potato dextrose agar (PDA plates were prepared using 8 cm diameter glass petri dishes and inhibitory percentage was determined. For in-vivo assessment of LEO and MeSA effects on Botrytis-caused fungal disease control, the experiment was conducted as factorial in completely randomized design (CRD with 3 replicates. The treatments were 3 concentration of LEO including 0, 500 and 1000 µl L-1 and 3 level of MeSA including 0, 0.1 and 0.2 mM. After treatment, the fruits were inoculated by Botrytis suspension and transferred to storage and quality parameters were evaluated after 7, 14 and 21 days. At each sampling time, disease incidence, weight loss, titratable acidity, pH, soluble solids content, vitamin C and antioxidant activity were measured. Results and Discussion: The results showed that both LEO and MeSA treatments had significant effects on inhibition of mycelium growth within in-vitro condition (p < 0.05. Inhibition rate of mycelium growth significantly improved by LEO and MeSA concentration increase of, (Table 1. At in-vivo assessment, diseases incidence of treated fruits with 500 µl L-1 LEO and 0.1 mM MeSA were 32% and 64% lower than untreated fruits, respectively (Fig. 1 and 2. During storage period, the percentage of infected fruits increased. In addition, LEO and MeSA treatments affected quality parameters of strawberry fruits including titratable acidity, soluble solids content, vitamin C and antioxidant activity. Treated fruits had a high content of soluble solids, vitamin C and antioxidant activity in comparison to untreated fruits (Table 3 and 4. Probably ascorbic acid decreased through fungal infection duo to cell wall break down during storage. Any factors such as essential oil and salicylate that inhibit fungal growth can help preserving vitamin C in stored products. High level of vitamin C and antioxidant activity was observed in treated fruits with 0.1 mM MeSA and 500 µl L-1 LEO. In controlling weight loss of fruits, 0.2 mM of MeSA and 500 µl L-1 of LEO had significant effects, although MeSA was more effective than LEO treatments, possibly due to elimination of respiration rates and fungi infection (Table 4. Therefore, LEO and MeSA with fungicide effects could be replaced with synthetic fungicides in controlling fungal diseases of strawberry and maintain fruits quality during storage. Conclusion: In conclusion, our results showed that LEO and MeSA treatments could be safe and used to prevent infection of strawberry during storage, although LEO was more effective than MeSA treatments. Concentration of 500 μl L-1 of LEO and 0.1 mM MeSA could control fungal infection of fruits during storage. Also, LEO and MeSA treatments can extend shelf life for over the minimum period required to transit strawberries to foreign markets and without affecting quality, adversely. However, future studies are necessary to fully understand the mechanisms by which LEO and MeSA treatments may act as a fungicide and increase their postharvest life.

  13. Abstract

    African Journals Online (AJOL)

    a route of HIV transmission with sex (p=0.003) and age (p=0.000) being highly ... preventing HIV, prevention of mother-to-child transmission of HIV (PMTCT), health behaviour and ..... order to determine which infant feeding methods were perceived ..... breast diseases, cancer, insufficient milk, work and pregnancy.

  14. Abstract

    African Journals Online (AJOL)

    ATTAMAH C. O

    female ̅=3.50; difference in mean{dm} = -0.70). Male entrepreneurs ... with the variance more on lack of information facilities (male ̅= 2.28; female. ̅= 2.60; dm = -0.32). ..... Issa R. (2009). Climate Change and Livestock Production Frontier.

  15. Abstract ~. ,

    African Journals Online (AJOL)

    and Marketed in'Morogoro Municipality,"Taniania. lR. ... It was concluded that water adulteration ofmilk in ... Despite the fact that infofmal milk marketing i{ ..... Least sqoares ~einsand standard error of means (SEM) for'milk quality variables;.

  16. ABSTRACT

    African Journals Online (AJOL)

    Objective: To determine the incidence of post operative SSI after primary total hip arthroplasty. Design: A retrospective cohort study. ... Conclusion: The risk of post operative SSI after total hip arthroplasties is low in the African setting. Further investigation is .... knee replacements for osteoarthritis. J. Bone Joint. Surg.

  17. Abstract

    Indian Academy of Sciences (India)

    2017-03-10

    Mar 10, 2017 ... factors with low to moderate effect which have been described (Klareskog et al. 2006). The strongest ... 2014). Several studies in GWAS and meta-analyses ... All patients and healthy controls gave informed consent to .... HLA-DQB1 encoded chain of MHC-II protein and HLA-DQA2 encoded chain of MHC-II ...

  18. Abstract

    African Journals Online (AJOL)

    Maru Shete

    business owned and controlled equally by the members that is targeted to break the ... The Poverty Reduction Strategy Programme of OSHO is focused in supporting the ..... The Report of United Nations (2005) indicates an improvement in the.

  19. Abstract

    African Journals Online (AJOL)

    PROF. O. E. OSUAGWU

    An Authoring system is a software with pre-programmed elements which allows both programmers ... doing things in all aspects of human endeavour. ... learning is offered through an Internet .... based or problem-based learning environment.

  20. abstract

    African Journals Online (AJOL)

    status of households in Owemi agricultural area of Imo state, isolate the determinants of ... importation, the country has hardly ever provided enough food for her teeming ..... Third in importance is the sale of valuable items as a coping strategy. The type ... while 70% preferred begging for food to dying of starvation. However,.

  1. Abstracts

    International Nuclear Information System (INIS)

    1989-09-01

    The proceedings contain 106 papers of which 2 fall under the INIS Scope. One concerns seismic risk assessment at radioactive waste repositories in the U.S., the other concerns the possibility of predicting earthquakes from changes in radon 222 levels in selected ground water springs of northern Italy. (M.D.)

  2. Abstract

    African Journals Online (AJOL)

    dell

    The study was conducted on high schools around the vicinity of Jimma. University easy to ... and community/Kebele leaders were sources of information and media ... biological, health sciences, social sciences ...... and one or more elementary.

  3. Abstract

    African Journals Online (AJOL)

    `123456789jkl''''#

    1, 2Department of Educational Technology Obafemi Awolowo University, Ile-Ife, Nigeria oasofowora@yahoo.com. 46 ... Geography teachers drawn from secondary schools in Osun State. ..... Elementary/Secondary Education Handbook an.

  4. Abstract

    African Journals Online (AJOL)

    `123456789jkl''''#

    extent of the integration of the new technology in teaching and learning Geography in Nigerian ... mounted pressure advocating for the removal ... which reduce opportunities for developing .... the fact the subject has distance itself from the.

  5. abstract

    Directory of Open Access Journals (Sweden)

    . user

    2016-02-01

    Full Text Available Introduction: One of the microbiological preparations used for this study was Effective Microorganisms (EM, being a commercial mixture of photosynthesizing bacteria, Actinomycetes, lactic acid bacteria, yeasts and fermenting fungi. The microbiological composition of the EM concentrateincludesStreptomyces albus, Propioni bacterium freudenreichil, Streptococcus lactis, Aspergillus oryzae, Mucor hiemalis, Saccharomycescerevisiae and Candida utilis. Moreover, EM also contains an unspecified amount of Lactobacillus sp. Rhodo pseudomonas sp. and Streptomyces griseus. Effective Microorganisms have a positive effect on the decomposition of organic matter, limiting putrefaction, increasing nitrogen content in the root medium of plants, phosphorus, improving soil fertility and as a result contributing to the growth and development of the root systems of plants. Selection of almond vegetative rootstocks for water stress tolerance is important for almond crop production in arid and semi-arid regions. The study of the eco-morphological characteristics that determine the success of a rootstock in a particular environment is a powerful tool for both agricultural management and breeding purposes. The aim of this work was to select the new rootstocks for water shortage tolerance, impact of water stress as well as Effective Microorganism (EM on morphological characteristics of almond rootstocks. Materials and Methods: In order to select the new rootstocks for water shortage tolerance, impact of water stress as well as EMonmorphologicalcharacteristics of almondrootstocks were studiedin thedepartment ofHorticulture, Ferdowsi University of Mashhad, in 2011-2012. The experiment was carried out with four replications in a completely random blockdesign to study the effects of two concentrations of EM (0 and 1%, three irrigation levels (normal irrigation 100%-control-and irrigation after depletion of 33 and 66% of available water, and four almond rootstocks including GF677 and selected natural hybrid of peach × almond (H1and H2, and almond vegetative rootstock (local control.In this study,EMtreatments for 60 days before stress treatments were applied so that in each irrigation, EM solution to a concentration of one percent was given to half of the experiment pots. Other pots were irrigated equally with normal water. Stress levels were applied from July as follow: full irrigation, watering after unloading 33% and 66% soil moisture availability. In order to evaluate the performance, seedling survival, plant growth, number of leaves, leaf area, root fresh and dry weight and leaves and root length were measured. Results and Discussion: Analysis of variance showed that between rootstock levels across all treatments were significantly differences at 0.01 level of probability. Comparison of means showed that the highest fresh and dry weight and leaf are awere observed forGF677and H1.Rootstockannualgrowth rate was also different. Most of the growth was related to the H1 Rootstocks. Thes urvival ratewas significantly different from the Rootstocks ofGF677,andH1showedthe highestpercentage of survival. The degree of adaptation to drought in varieties of almonds is different. The results showed that changes ingrowthparametersinGF677and H1were observed less often than other rootstocks. Because of strong roots,GF677and H1continue to attract more minerals under stress conditions. Analysis of variance showed that the between irrigation levels for all treatments were significantly different at 0.01 level of probability. Comparison of means showed that among the study traits, the highest amount was obtained from complete irrigation, while irrigationat66 percenthad the least amount. Water stress may directly affect photosyn thesis, through leaf photochemicalprocessorindirectly,byclosing stomata, reducingleaf area and growth. The results showed that the levels of(EM on the leaf surface, leaf number, annual growth, root dry weight and volume were significantly different (p

  6. Abstract

    African Journals Online (AJOL)

    UDS-CAPTURED

    examines the extent of women farmers' access to credit from Rural Banks (RBs) in the Upper East. Region of Ghana. .... In this regard, anybody who does not attempt to get credit from formal, semi-formal/endogenous or ... District and the Builsa Community Rural Bank with its headquarters at Sandema in the Builsa. District.

  7. Abstract

    African Journals Online (AJOL)

    ­E¢b

    development of its economy presupposes entrepreneurial direction, which is ... and independence. Ethiopian business men and women should take intelligent risks ... opportunities. Such a strategy helps Ethiopian entrepreneurship to grow. .... propensity, and high energy decreased as the cultural distance from the United ...

  8. Abstract

    Indian Academy of Sciences (India)

    2017-03-10

    Mar 10, 2017 ... autoimmune and infectious diseases including type 1 diabetes (Nakanishi and Inoko 2006) and chronic HCV infection (Tibbs et al. 1996). Additionally, it was suggested that it may be a shared epitope for RA (Li et al. 2013). According to these data and our findings, we can suggest that there is an interaction ...

  9. Abstract

    Directory of Open Access Journals (Sweden)

    Maria Jose Carvalho de Souza Domingues

    2003-01-01

    Full Text Available The practice of teaching, in actuality, shows the necessity of teachers and students coming together to form a behavior that is different from the traditional model of teaching. The unity formed from various types of knowledge and the relation between theory and practice show themselves to be fundamental. Starting in 2002, and in search of this unity, a project that hoped to unify the disciplines taught in the second semester of the course in Administration was implemented. During the semester, a single work sought to relate the theories studied with the reality of an organization. Each professor evaluated the works from the point of view of his discipline, as well as the presentation, in general, of the group. It can be affirmed that seeking to bring together various types of knowledge necessarily passes to a rethinking of the postures of teachers and students.

  10. ABSTRACTS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    4The Current Trends in Global Mineral Exploration and Development LIU Shucken (Information Center of Ministry of Land and Resources, Beijing 100812, China) Abstract: This paper introduces the main issues that the global mineral exploration and development are faced with. The main issues of focus include: the mineral exploration has rapidly recovered from the short depression caused by the effects of global financial crisis; most of the important mineral reserves have continued to grow; there has been continued rapid growth in mining development investment; the supply capacity of mineral products has increased; mergers and acquisitions of mining company are stirring, and multinational mergers & acquisitions has become mainstream,

  11. Abstract

    African Journals Online (AJOL)

    used standardised scales to measure the level of HIV stigma over time. A repeated .... with studies that focused so heavily 'on the beliefs and attitudes of those who are .... to harm the PLHA (e.g. ridicule, insults, blame), 8 items, alpha. = 0.886; (ii) ... self based on HIV status, 5 items, alpha = 0.906; (iii) health care neglect – in ...

  12. Abstract

    African Journals Online (AJOL)

    Getachew

    realistic distribution of no-show data in modeling the cost function was considered using data collected from the .... the paper models the cost function based on a realistic probability distributions based on the historical data is a .... Plot of Revenue generated vs. overbooking for two class case (at $500. Compensation Cost ...

  13. ABSTRACT

    Directory of Open Access Journals (Sweden)

    Michelle de Stefano Sabino

    2011-12-01

    Full Text Available This paper aims to describe and to analyze the integration observed in the Sintonia project with respect to the comparison of project management processes to the model of the Stage-Gate ®. The literature addresses these issues conceptually, but lack an alignment between them that is evident in practice. As a method was used single case study. The report is as if the Sintonia project, developed by PRODESP - Data Processing Company of São Paulo. The results show the integration of project management processes with the Stage-Gate model developed during the project life cycle. The formalization of the project was defined in stages in which allowed the exploitation of economies of repetition and recombination to the development of new projects. This study contributes to the technical vision in dealing with the integration of project management processes. It was concluded that this system represents an attractive way, in terms of creating economic value and technological innovation for the organization.

  14. Abstracts

    International Nuclear Information System (INIS)

    2001-01-01

    The minutes of the Latinamerican Geology Meeting and the 3. Uruguayan Meeting organized by the National Direction of Mining and Geology (DINAMIGE) and Uruguayan Geology Society (Uruguay) includes topics such as: paleontology, sedimentation, stratigraphy, fossils, paleoclimatology, geo tectonics, coal deposits, minerals res sources, tectonic evolution of the Andes Mountain Ranges, IGCP Project, Environmental geology, Hydrogeology, fuels, and geomorphology

  15. Abstracts

    International Nuclear Information System (INIS)

    2013-01-01

    The power point presentation is about: danger identification, caracterization, evaluation exposition, risk (CAC, 1997; FAO, 2007), European food safety authority, foodrisk organization, pathogens risk ranking, risk reduction, gubernamental responsability

  16. ABSTRACT

    Indian Academy of Sciences (India)

    Efforts have also been successfully made to include the study of rock art in the school/ college curriculum so as to help develop awareness amongst the students and general public about the need to preserve this cultural heritage for the posterity and also to highlight its importance in tourism industry. rock art and their ...

  17. ABSTRACT

    African Journals Online (AJOL)

    BSN

    A CHEMICAL STlJDY OF AN I 'DI GENO KNOWLED<:E SYSTEM OF ... preservation of "kindirmo" with water and ethanol extracts of seeds and husk of. CO\\\\'J)Ca for ... Such facilities arc ho1\\·ever not a\\ailable to most peasant animal farmers.

  18. Abstract

    African Journals Online (AJOL)

    PROF. OLIVER OSUAGWA

    Many mathematical models of stochastic dynamical systems were based on the assumption that the drift ... stochastic process with state space S is a ..... The algorithm was implemented through a MatLab script and the result of the simulation is.

  19. ABSTRACTS

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Wu Jie and Duan Yanchao. The current line drawing of Laterolog and its application. PI, 2011, 25(4) : 1 - 4 The current line plays an important role in the directly understanding the characteristics of Laterolog tool. A method of drawing current lines for the discrete potential data based on the Finite Element calculation is studied. It solves a series of key problems, including the selection of step length, the identification of direction, treatment of nmtation point and the control of stop. A drawing program is written by MATLAB software. Taking the current line drawing of the dual Laterolog logging as an example, we analyze the tool's investigation characteristics in the several formations such as homogeneous, low or high invasion, and invasion with shoulder. These results verify the effectiveness of the new method. The method can be applied to the other kinds of Laterolog tools to draw their current lines and analyze their investigation characteristics.

  20. Abstract

    African Journals Online (AJOL)

    on human development are sufficiently important to warrant an integration of. HIV and .... interaction of HIV and malaria22, The discussions that follow further sub- .... HIV —MTCT and the paediatric management of children born of ser0p0$l-.

  1. Abstract

    DEFF Research Database (Denmark)

    Tafdrup, Oliver

    2013-01-01

    Udgivet som en del af Tidskrifts specialudgivelse om Adorno. http://tidskrift.dk/data/50/Aforismesamling.pdf......Udgivet som en del af Tidskrifts specialudgivelse om Adorno. http://tidskrift.dk/data/50/Aforismesamling.pdf...

  2. Abstract concepts in grounded cognition

    NARCIS (Netherlands)

    Lakens, D.

    2010-01-01

    When people think about highly abstract concepts, they draw upon concrete experiences to structure their thoughts. For example, black knights in fairytales are evil, and knights in shining armor are good. The sensory experiences black and white are used to represent the abstract concepts of good and

  3. Modal abstractions of concurrent behavior

    DEFF Research Database (Denmark)

    Nielson, Flemming; Nanz, Sebastian; Nielson, Hanne Riis

    2011-01-01

    We present an effective algorithm for the automatic construction of finite modal transition systems as abstractions of potentially infinite concurrent processes. Modal transition systems are recognized as valuable abstractions for model checking because they allow for the validation as well...... as refutation of safety and liveness properties. However, the algorithmic construction of finite abstractions from potentially infinite concurrent processes is a missing link that prevents their more widespread usage for model checking of concurrent systems. Our algorithm is a worklist algorithm using concepts...... from abstract interpretation and operating upon mappings from sets to intervals in order to express simultaneous over- and underapprox-imations of the multisets of process actions available in a particular state. We obtain a finite abstraction that is 3-valued in both states and transitions...

  4. Technical abstracts: Mechanical engineering, 1990

    International Nuclear Information System (INIS)

    Broesius, J.Y.

    1991-01-01

    This document is a compilation of the published, unclassified abstracts produced by mechanical engineers at Lawrence Livermore National Laboratory (LLNL) during the calendar year 1990. Many abstracts summarize work completed and published in report form. These are UCRL-JC series documents, which include the full text of articles to be published in journals and of papers to be presented at meetings, and UCID reports, which are informal documents. Not all UCIDs contain abstracts: short summaries were generated when abstracts were not included. Technical Abstracts also provides descriptions of those documents assigned to the UCRL-MI (miscellaneous) category. These are generally viewgraphs or photographs presented at meetings. An author index is provided at the back of this volume for cross referencing

  5. Metaphor: Bridging embodiment to abstraction.

    Science.gov (United States)

    Jamrozik, Anja; McQuire, Marguerite; Cardillo, Eileen R; Chatterjee, Anjan

    2016-08-01

    Embodied cognition accounts posit that concepts are grounded in our sensory and motor systems. An important challenge for these accounts is explaining how abstract concepts, which do not directly call upon sensory or motor information, can be informed by experience. We propose that metaphor is one important vehicle guiding the development and use of abstract concepts. Metaphors allow us to draw on concrete, familiar domains to acquire and reason about abstract concepts. Additionally, repeated metaphoric use drawing on particular aspects of concrete experience can result in the development of new abstract representations. These abstractions, which are derived from embodied experience but lack much of the sensorimotor information associated with it, can then be flexibly applied to understand new situations.

  6. Identification of new proton-rich rare earth nuclei by means of the coupled system helium jet-isotope separator of SARA

    International Nuclear Information System (INIS)

    Ollivier, T.

    1986-01-01

    In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr

  7. Análise SWOT global da exploração dos suínos da raça Bísara

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...

  8. Abstract Interpretation and Attribute Gramars

    DEFF Research Database (Denmark)

    Rosendahl, Mads

    The objective of this thesis is to explore the connections between abstract interpretation and attribute grammars as frameworks in program analysis. Abstract interpretation is a semantics-based program analysis method. A large class of data flow analysis problems can be expressed as non-standard ...... is presented in the thesis. Methods from abstract interpretation can also be used in correctness proofs of attribute grammars. This proof technique introduces a new class of attribute grammars based on domain theory. This method is illustrated with examples....

  9. Knowledge acquisition for temporal abstraction.

    Science.gov (United States)

    Stein, A; Musen, M A; Shahar, Y

    1996-01-01

    Temporal abstraction is the task of detecting relevant patterns in data over time. The knowledge-based temporal-abstraction method uses knowledge about a clinical domain's contexts, external events, and parameters to create meaningful interval-based abstractions from raw time-stamped clinical data. In this paper, we describe the acquisition and maintenance of domain-specific temporal-abstraction knowledge. Using the PROTEGE-II framework, we have designed a graphical tool for acquiring temporal knowledge directly from expert physicians, maintaining the knowledge in a sharable form, and converting the knowledge into a suitable format for use by an appropriate problem-solving method. In initial tests, the tool offered significant gains in our ability to rapidly acquire temporal knowledge and to use that knowledge to perform automated temporal reasoning.

  10. Construct Abstraction for Automatic Information Abstraction from Digital Images

    Science.gov (United States)

    2006-05-30

    objects and features and the names of objects of objects and features. For example, in Figure 15 the parts of the fish could be named the ‘mouth... fish -1 fish -2 fish -3 tennis shoe tennis racquet...of abstraction and generality. For example, an algorithm might usefully find a polygon ( blob ) in an image and calculate numbers such as the

  11. Mechanical Engineering Department technical abstracts

    International Nuclear Information System (INIS)

    1984-01-01

    The Mechanical Engineering Department publishes abstracts twice a year to inform readers of the broad range of technical activities in the Department, and to promote an exchange of ideas. Details of the work covered by an abstract may be obtained by contacting the author(s). General information about the current role and activities of each of the Department's seven divisions precedes the technical abstracts. Further information about a division's work may be obtained from the division leader, whose name is given at the end of each divisional summary. The Department's seven divisions are as follows: Nuclear Test Engineering Division, Nuclear Explosives Engineering Division, Weapons Engineering Division, Energy Systems Engineering Division, Engineering Sciences Division, Magnetic Fusion Engineering Division and Materials Fabrication Division

  12. Abstraction by Set-Membership

    DEFF Research Database (Denmark)

    Mödersheim, Sebastian Alexander

    2010-01-01

    The abstraction and over-approximation of protocols and web services by a set of Horn clauses is a very successful method in practice. It has however limitations for protocols and web services that are based on databases of keys, contracts, or even access rights, where revocation is possible, so...... that the set of true facts does not monotonically grow with the transitions. We extend the scope of these over-approximation methods by defining a new way of abstraction that can handle such databases, and we formally prove that the abstraction is sound. We realize a translator from a convenient specification...... language to standard Horn clauses and use the verifier ProVerif and the theorem prover SPASS to solve them. We show by a number of examples that this approach is practically feasible for wide variety of verification problems of security protocols and web services....

  13. Elements of abstract harmonic analysis

    CERN Document Server

    Bachman, George

    2013-01-01

    Elements of Abstract Harmonic Analysis provides an introduction to the fundamental concepts and basic theorems of abstract harmonic analysis. In order to give a reasonably complete and self-contained introduction to the subject, most of the proofs have been presented in great detail thereby making the development understandable to a very wide audience. Exercises have been supplied at the end of each chapter. Some of these are meant to extend the theory slightly while others should serve to test the reader's understanding of the material presented. The first chapter and part of the second give

  14. Biocards and Level of Abstraction

    DEFF Research Database (Denmark)

    Lenau, Torben Anker; Keshwani, Sonal; Chakrabarti, Amaresh

    2015-01-01

    Biocards are formal descriptions of biological phenomena and their underlying functional principles. They are used in bioinspired design to document search results and to communicate the findings for use in the further design process. The present study explored the effect of abstraction level used...

  15. Teaching abstraction in introductory courses

    NARCIS (Netherlands)

    Koppelman, Herman; van Dijk, Betsy

    Abstraction is viewed as a key concept in computer science. It is not only an important concept but also one that is difficult to master. This paper focuses on the problems that novices experience when they first encounter this concept. Three assignments from introductory courses are analyzed, to

  16. Abstract Interpretation of Mobile Ambients

    DEFF Research Database (Denmark)

    Hansen, René Rydhof; Jensen, J. G.; Nielson, Flemming

    1999-01-01

    We demonstrate that abstract interpretation is useful for analysing calculi of computation such as the ambient calculus (which is based on the p-calculus); more importantly, we show that the entire development can be expressed in a constraint-based formalism that is becoming exceedingly popular...

  17. IRAP 2006, Book of Abstracts

    International Nuclear Information System (INIS)

    2006-01-01

    This publications related with Hacettepe University, Turkish Atomic Energy Authority, The Scientific and Technological Research Council of Turkey, International Atomic Energy Agency, CEA-Saclay, CEA-Saclay Drecam, ANKAmall Shopping Center and Ion Beam Applications Industrial that was held in Antalya, Turkey, 23-28 September 2006. A separate abstract was prepared for each paper

  18. IRAP 2006, Book of Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    This publications related with Hacettepe University, Turkish Atomic Energy Authority, The Scientific and Technological Research Council of Turkey, International Atomic Energy Agency, CEA-Saclay, CEA-Saclay Drecam, ANKAmall Shopping Center and Ion Beam Applications Industrial that was held in Antalya, Turkey, 23-28 September 2006. A separate abstract was prepared for each paper.

  19. The Complexity of Abstract Machines

    Directory of Open Access Journals (Sweden)

    Beniamino Accattoli

    2017-01-01

    Full Text Available The lambda-calculus is a peculiar computational model whose definition does not come with a notion of machine. Unsurprisingly, implementations of the lambda-calculus have been studied for decades. Abstract machines are implementations schema for fixed evaluation strategies that are a compromise between theory and practice: they are concrete enough to provide a notion of machine and abstract enough to avoid the many intricacies of actual implementations. There is an extensive literature about abstract machines for the lambda-calculus, and yet—quite mysteriously—the efficiency of these machines with respect to the strategy that they implement has almost never been studied. This paper provides an unusual introduction to abstract machines, based on the complexity of their overhead with respect to the length of the implemented strategies. It is conceived to be a tutorial, focusing on the case study of implementing the weak head (call-by-name strategy, and yet it is an original re-elaboration of known results. Moreover, some of the observation contained here never appeared in print before.

  20. Abstract Interpretation Using Attribute Grammar

    DEFF Research Database (Denmark)

    Rosendahl, Mads

    1990-01-01

    This paper deals with the correctness proofs of attribute grammars using methods from abstract interpretation. The technique will be described by defining a live-variable analysis for a small flow-chart language and proving it correct with respect to a continuation style semantics. The proof...

  1. Learning abstract algebra with ISETL

    CERN Document Server

    Dubinsky, Ed

    1994-01-01

    Most students in abstract algebra classes have great difficulty making sense of what the instructor is saying. Moreover, this seems to remain true almost independently of the quality of the lecture. This book is based on the constructivist belief that, before students can make sense of any presentation of abstract mathematics, they need to be engaged in mental activities which will establish an experiential base for any future verbal explanation. No less, they need to have the opportunity to reflect on their activities. This approach is based on extensive theoretical and empirical studies as well as on the substantial experience of the authors in teaching astract algebra. The main source of activities in this course is computer constructions, specifically, small programs written in the mathlike programming language ISETL; the main tool for reflections is work in teams of 2-4 students, where the activities are discussed and debated. Because of the similarity of ISETL expressions to standard written mathematics...

  2. Abstract Cauchy problems three approaches

    CERN Document Server

    Melnikova, Irina V

    2001-01-01

    Although the theory of well-posed Cauchy problems is reasonably understood, ill-posed problems-involved in a numerous mathematical models in physics, engineering, and finance- can be approached in a variety of ways. Historically, there have been three major strategies for dealing with such problems: semigroup, abstract distribution, and regularization methods. Semigroup and distribution methods restore well-posedness, in a modern weak sense. Regularization methods provide approximate solutions to ill-posed problems. Although these approaches were extensively developed over the last decades by many researchers, nowhere could one find a comprehensive treatment of all three approaches.Abstract Cauchy Problems: Three Approaches provides an innovative, self-contained account of these methods and, furthermore, demonstrates and studies some of the profound connections between them. The authors discuss the application of different methods not only to the Cauchy problem that is not well-posed in the classical sense, b...

  3. ESGAR 2007. Book of abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-06-15

    The book includes the abstracts of all contributions presented during ESGAR (European Society of Gastrointestinal and Abdominal Radiology) 2007. The contributions of the symposium and the scientific sessions cover the following topics: abdominal MRI; interactive liver diagnosis; rectal cancer; liver metastases; pancreas: technical advances, lesion characterisation and staging; hepatic interventions; upper GI tract: multimodality evaluation; Crohn's disease evaluation; focal liver lesions: multimodality evaluation; CTC-computer aided diagnosis; bile ducts: imaging and intervention; GI tract: imaging and intervention; small bowel and appendix: cross-sectional imaging; CT and MR colonography; trauma and acute abdominal conditions: imaging and intervention; vascular and diffuse liver disease; liver contrast enhanced US. The second part covers the abstract of 248 presentations.

  4. Cryogenic foam insulation: Abstracted publications

    Science.gov (United States)

    Williamson, F. R.

    1977-01-01

    A group of documents were chosen and abstracted which contain information on the properties of foam materials and on the use of foams as thermal insulation at cryogenic temperatures. The properties include thermal properties, mechanical properties, and compatibility properties with oxygen and other cryogenic fluids. Uses of foams include applications as thermal insulation for spacecraft propellant tanks, and for liquefied natural gas storage tanks and pipelines.

  5. The abstract unconscious in painting

    OpenAIRE

    Parker, David

    2009-01-01

    The Abstract Unconscious in Painting addresses painting as experiential process, critically examining the psychological factors involved in the formation of imagery as it emerges through imaginative responses to the process of mark making and the structuring of space and form. The paper sets this process in relation to theoretical material drawn from Jungian and Post Jungian Psychology ( Avens, 1980; Hillman, 1975) the arts ( Gombrich, 1960; Kuspit, 2000; McKeever, 2005; Worringer, 1908) and ...

  6. Abstract specialization and its applications

    OpenAIRE

    Puebla Sánchez, Alvaro Germán; Hermenegildo, Manuel V.

    2003-01-01

    The aim of program specialization is to optimize programs by exploiting certain knowledge about the context in which the program will execute. There exist many program manipulation techniques which allow specializing the program in different ways. Among them, one of the best known techniques is partial evaluation, often referred to simply as program specialization, which optimizes programs by specializing them for (partially) known input data. In this work we describe abstract specia...

  7. Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973

    Directory of Open Access Journals (Sweden)

    Guillermina Feudal

    2017-12-01

    Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.

  8. Indico CONFERENCE: Define the Call for Abstracts

    CERN Multimedia

    CERN. Geneva; Ferreira, Pedro

    2017-01-01

    In this tutorial, you will learn how to define and open a call for abstracts. When defining a call for abstracts, you will be able to define settings related to the type of questions asked during a review of an abstract, select the users who will review the abstracts, decide when to open the call for abstracts, and more.

  9. Operating System Abstraction Layer (OSAL)

    Science.gov (United States)

    Yanchik, Nicholas J.

    2007-01-01

    This viewgraph presentation reviews the concept of the Operating System Abstraction Layer (OSAL) and its benefits. The OSAL is A small layer of software that allows programs to run on many different operating systems and hardware platforms It runs independent of the underlying OS & hardware and it is self-contained. The benefits of OSAL are that it removes dependencies from any one operating system, promotes portable, reusable flight software. It allows for Core Flight software (FSW) to be built for multiple processors and operating systems. The presentation discusses the functionality, the various OSAL releases, and describes the specifications.

  10. National Physics Conference. Paper Abstracts

    International Nuclear Information System (INIS)

    Marinela Dumitriu, Editorial Coordination.

    1995-01-01

    This book contains the abstracts of the proceedings of the annual Romanian Physics Conference organized by Romanian Physics Society. The conference was held on November 30 to December 2, 1995 in the city of Baia Mare. It was organized in the following nine sections: 1 - Astrophysics, Particle Physics, Nuclear Physics, Molecular and Atomic Physics; 2 - Plasma Physics; 3 - Biophysics; 4 - Technical Physics; 5 - Theoretical Physics; 6 -The Physics of Energy; 7 - The Physics of Environment 8 - Solid State Physics; 9 - Optical and Quantum Electronics. The full texts can be obtained on request from the Romanian Physical Society or directly from authors

  11. In-Package Chemistry Abstraction

    Energy Technology Data Exchange (ETDEWEB)

    P.S. Domski

    2003-07-21

    The work associated with the development of this model report was performed in accordance with the requirements established in ''Technical Work Plan for Waste Form Degradation Modeling, Testing, and Analyses in Support of SR and LA'' (BSC 2002a). The in-package chemistry model and in-package chemistry model abstraction are developed to predict the bulk chemistry inside of a failed waste package and to provide simplified expressions of that chemistry. The purpose of this work is to provide the abstraction model to the Performance Assessment Project and the Waste Form Department for development of geochemical models of the waste package interior. The scope of this model report is to describe the development and validation of the in-package chemistry model and in-package chemistry model abstraction. The in-package chemistry model will consider chemical interactions of water with the waste package materials and the waste form for commercial spent nuclear fuel (CSNF) and codisposed high-level waste glass (HLWG) and N Reactor spent fuel (CDNR). The in-package chemistry model includes two sub-models, the first a water vapor condensation (WVC) model, where water enters a waste package as vapor and forms a film on the waste package components with subsequent film reactions with the waste package materials and waste form--this is a no-flow model, the reacted fluids do not exit the waste package via advection. The second sub-model of the in-package chemistry model is the seepage dripping model (SDM), where water, water that may have seeped into the repository from the surrounding rock, enters a failed waste package and reacts with the waste package components and waste form, and then exits the waste package with no accumulation of reacted water in the waste package. Both of the submodels of the in-package chemistry model are film models in contrast to past in-package chemistry models where all of the waste package pore space was filled with water. The

  12. Abstract decomposition theorem and applications

    CERN Document Server

    Grossberg, R; Grossberg, Rami; Lessmann, Olivier

    2005-01-01

    Let K be an Abstract Elementary Class. Under the asusmptions that K has a nicely behaved forking-like notion, regular types and existence of some prime models we establish a decomposition theorem for such classes. The decomposition implies a main gap result for the class K. The setting is general enough to cover \\aleph_0-stable first-order theories (proved by Shelah in 1982), Excellent Classes of atomic models of a first order tehory (proved Grossberg and Hart 1987) and the class of submodels of a large sequentially homogenuus \\aleph_0-stable model (which is new).

  13. In-Package Chemistry Abstraction

    International Nuclear Information System (INIS)

    P.S. Domski

    2003-01-01

    The work associated with the development of this model report was performed in accordance with the requirements established in ''Technical Work Plan for Waste Form Degradation Modeling, Testing, and Analyses in Support of SR and LA'' (BSC 2002a). The in-package chemistry model and in-package chemistry model abstraction are developed to predict the bulk chemistry inside of a failed waste package and to provide simplified expressions of that chemistry. The purpose of this work is to provide the abstraction model to the Performance Assessment Project and the Waste Form Department for development of geochemical models of the waste package interior. The scope of this model report is to describe the development and validation of the in-package chemistry model and in-package chemistry model abstraction. The in-package chemistry model will consider chemical interactions of water with the waste package materials and the waste form for commercial spent nuclear fuel (CSNF) and codisposed high-level waste glass (HLWG) and N Reactor spent fuel (CDNR). The in-package chemistry model includes two sub-models, the first a water vapor condensation (WVC) model, where water enters a waste package as vapor and forms a film on the waste package components with subsequent film reactions with the waste package materials and waste form--this is a no-flow model, the reacted fluids do not exit the waste package via advection. The second sub-model of the in-package chemistry model is the seepage dripping model (SDM), where water, water that may have seeped into the repository from the surrounding rock, enters a failed waste package and reacts with the waste package components and waste form, and then exits the waste package with no accumulation of reacted water in the waste package. Both of the submodels of the in-package chemistry model are film models in contrast to past in-package chemistry models where all of the waste package pore space was filled with water. The current in

  14. Shoestring Budget Radio Astronomy (Abstract)

    Science.gov (United States)

    Hoot, J. E.

    2017-12-01

    (Abstract only) The commercial exploitation of microwave frequencies for cellular, WiFi, Bluetooth, HDTV, and satellite digital media transmission has brought down the cost of the components required to build an effective radio telescope to the point where, for the cost of a good eyepiece, you can construct and operate a radio telescope. This paper sets forth a family of designs for 1421 MHz telescopes. It also proposes a method by which operators of such instruments can aggregate and archive data via the Internet. With 90 or so instruments it will be possible to survey the entire radio sky for transients with a 24 hour cadence.

  15. Reconstruction of abstract quantum theory

    International Nuclear Information System (INIS)

    Drieschner, M.; Goernitz, T.; von Weizsaecker, C.F.

    1988-01-01

    Understanding quantum theory as a general theory of prediction, we reconstruct abstract quantum theory. Abstract means the general frame of quantum theory, without reference to a three-dimensional position space, to concepts like particle or field, or to special laws of dynamics. Reconstruction is the attempt to do this by formulating simple and plausible postulates on prediction in order to derive the basic concepts of quantum theory from them. Thereby no law of classical physics is presupposed which would then have to be quantized. We briefly discuss the relationship of theory and interpretation in physics and the fundamental role of time as a basic concept for physics. Then a number of assertions are given, formulated as succinctly as possible in order to make them easily quotable and comparable. The assertations are arranged in four groups: heuristic principles, verbal definitions of some terms, three basic postulates, and consequences. The three postulates of separable alternatives, indeterminism, and kinematics are the central points of this work. These brief assertions are commented upon, and their relationship with the interpretation of quantum theory is discussed. Also given are an outlook on the further development into concrete quantum theory and some philosophical reflections

  16. An introduction to abstract algebra

    CERN Document Server

    Robinson, Derek JS

    2003-01-01

    This is a high level introduction to abstract algebra which is aimed at readers whose interests lie in mathematics and in the information and physical sciences. In addition to introducing the main concepts of modern algebra, the book contains numerous applications, which are intended to illustrate the concepts and to convince the reader of the utility and relevance of algebra today. In particular applications to Polya coloring theory, latin squares, Steiner systems and error correcting codes are described. Another feature of the book is that group theory and ring theory are carried further than is often done at this level. There is ample material here for a two semester course in abstract algebra. The importance of proof is stressed and rigorous proofs of almost all results are given. But care has been taken to lead the reader through the proofs by gentle stages. There are nearly 400 problems, of varying degrees of difficulty, to test the reader''s skill and progress. The book should be suitable for students ...

  17. Abstract Expression Grammar Symbolic Regression

    Science.gov (United States)

    Korns, Michael F.

    This chapter examines the use of Abstract Expression Grammars to perform the entire Symbolic Regression process without the use of Genetic Programming per se. The techniques explored produce a symbolic regression engine which has absolutely no bloat, which allows total user control of the search space and output formulas, which is faster, and more accurate than the engines produced in our previous papers using Genetic Programming. The genome is an all vector structure with four chromosomes plus additional epigenetic and constraint vectors, allowing total user control of the search space and the final output formulas. A combination of specialized compiler techniques, genetic algorithms, particle swarm, aged layered populations, plus discrete and continuous differential evolution are used to produce an improved symbolic regression sytem. Nine base test cases, from the literature, are used to test the improvement in speed and accuracy. The improved results indicate that these techniques move us a big step closer toward future industrial strength symbolic regression systems.

  18. WIPR-2010 Book of abstracts

    International Nuclear Information System (INIS)

    2015-01-01

    The main objective of the workshop was to review advanced and preclinical studies on innovative positron emitting radionuclides to assess their usefulness and potentials. Presentations were organized around 4 issues: 1) preclinical and clinical point of view, 2) production of innovative PET radionuclides, 3) from complexation chemistry to PET imaging and 4) from research to clinic. Emphasis has been put on "6"4Cu, "6"8Ga, "8"9Zr, "4"4Sc but specific aspects such as production or purification have been considered for "6"6Ga, "6"7Ga, "5"2Fe, "8"6Y, and "6"8Ge radionuclides. This document gathers the abstracts of most contributions

  19. Abstract algebra an introductory course

    CERN Document Server

    Lee, Gregory T

    2018-01-01

    This carefully written textbook offers a thorough introduction to abstract algebra, covering the fundamentals of groups, rings and fields. The first two chapters present preliminary topics such as properties of the integers and equivalence relations. The author then explores the first major algebraic structure, the group, progressing as far as the Sylow theorems and the classification of finite abelian groups. An introduction to ring theory follows, leading to a discussion of fields and polynomials that includes sections on splitting fields and the construction of finite fields. The final part contains applications to public key cryptography as well as classical straightedge and compass constructions. Explaining key topics at a gentle pace, this book is aimed at undergraduate students. It assumes no prior knowledge of the subject and contains over 500 exercises, half of which have detailed solutions provided.

  20. Norddesign 2012 - Book of Abstract

    DEFF Research Database (Denmark)

    . Conceptualisation and Innovative thinking. Research approaches and topics: Human Behaviour and Cognition. Cooperation and Multidisciplinary Design. Staging and Management of Design. Communication in Design. Design education and teaching: Programmes and Syllabuses. New Courses. Integrated and Multi-disciplinary. We...... fate of the ideas behind the conferences. In that view the conferences have been thematically open and the organization has been tight with a limited number of participants that allows a good overview of all the papers and a lot of informal discussion between the participants. The present conference...... has been organized in line with the original ideas. The topics mentioned in the call for abstracts were: Product Development: Integrated, Multidisciplinary, Product life oriented and Distributed. Multi-product Development. Innovation and Business Models. Engineering Design and Industrial Design...

  1. Spectrophotometry of Symbiotic Stars (Abstract)

    Science.gov (United States)

    Boyd, D.

    2017-12-01

    (Abstract only) Symbiotic stars are fascinating objects - complex binary systems comprising a cool red giant star and a small hot object, often a white dwarf, both embedded in a nebula formed by a wind from the giant star. UV radiation from the hot star ionizes the nebula, producing a range of emission lines. These objects have composite spectra with contributions from both stars plus the nebula and these spectra can change on many timescales. Being moderately bright, they lend themselves well to amateur spectroscopy. This paper describes the symbiotic star phenomenon, shows how spectrophotometry can be used to extract astrophysically useful information about the nature of these systems, and gives results for three symbiotic stars based on the author's observations.

  2. Transplantation as an abstract good

    DEFF Research Database (Denmark)

    Hoeyer, Klaus; Jensen, Anja Marie Bornø; Olejaz, Maria

    2015-01-01

    This article investigates valuations of organ transfers that are currently seen as legitimising increasingly aggressive procurement methods in Denmark. Based on interviews with registered donors and the intensive care unit staff responsible for managing organ donor patients we identify three types...... a more general salience in the organ transplant field by way of facilitating a perception of organ transplantation as an abstract moral good rather than a specific good for specific people. Furthermore, we suggest that multiple forms of ignorance sustain each other: a desire for ignorance with respect...... to the prioritisation of recipients sustains pressure for more organs; this pressure necessitates more aggressive measures in organ procurement and these measures increase the need for ignorance in relation to the actual procedures as well as the actual recipients. These attempts to avoid knowledge are in remarkable...

  3. A Modal-Logic Based Graph Abstraction

    NARCIS (Netherlands)

    Bauer, J.; Boneva, I.B.; Kurban, M.E.; Rensink, Arend; Ehrig, H; Heckel, R.; Rozenberg, G.; Taentzer, G.

    2008-01-01

    Infinite or very large state spaces often prohibit the successful verification of graph transformation systems. Abstract graph transformation is an approach that tackles this problem by abstracting graphs to abstract graphs of bounded size and by lifting application of productions to abstract

  4. Argonne Code Center: compilation of program abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Butler, M.K.; DeBruler, M.; Edwards, H.S.; Harrison, C. Jr.; Hughes, C.E.; Jorgensen, R.; Legan, M.; Menozzi, T.; Ranzini, L.; Strecok, A.J.

    1977-08-01

    This publication is the eleventh supplement to, and revision of, ANL-7411. It contains additional abstracts and revisions to some earlier abstracts and other pages. Sections of the complete document ANL-7411 are as follows: preface, history and acknowledgements, abstract format, recommended program package contents, program classification guide and thesaurus, and the abstract collection. (RWR)

  5. Argonne Code Center: compilation of program abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Butler, M.K.; DeBruler, M.; Edwards, H.S.

    1976-08-01

    This publication is the tenth supplement to, and revision of, ANL-7411. It contains additional abstracts and revisions to some earlier abstracts and other pages. Sections of the document are as follows: preface; history and acknowledgements; abstract format; recommended program package contents; program classification guide and thesaurus; and abstract collection. (RWR)

  6. Argonne Code Center: compilation of program abstracts

    International Nuclear Information System (INIS)

    Butler, M.K.; DeBruler, M.; Edwards, H.S.; Harrison, C. Jr.; Hughes, C.E.; Jorgensen, R.; Legan, M.; Menozzi, T.; Ranzini, L.; Strecok, A.J.

    1977-08-01

    This publication is the eleventh supplement to, and revision of, ANL-7411. It contains additional abstracts and revisions to some earlier abstracts and other pages. Sections of the complete document ANL-7411 are as follows: preface, history and acknowledgements, abstract format, recommended program package contents, program classification guide and thesaurus, and the abstract collection

  7. Argonne Code Center: compilation of program abstracts

    International Nuclear Information System (INIS)

    Butler, M.K.; DeBruler, M.; Edwards, H.S.

    1976-08-01

    This publication is the tenth supplement to, and revision of, ANL-7411. It contains additional abstracts and revisions to some earlier abstracts and other pages. Sections of the document are as follows: preface; history and acknowledgements; abstract format; recommended program package contents; program classification guide and thesaurus; and abstract collection

  8. An abstract approach to music.

    Energy Technology Data Exchange (ETDEWEB)

    Kaper, H. G.; Tipei, S.

    1999-04-19

    In this article we have outlined a formal framework for an abstract approach to music and music composition. The model is formulated in terms of objects that have attributes, obey relationships, and are subject to certain well-defined operations. The motivation for this approach uses traditional terms and concepts of music theory, but the approach itself is formal and uses the language of mathematics. The universal object is an audio wave; partials, sounds, and compositions are special objects, which are placed in a hierarchical order based on time scales. The objects have both static and dynamic attributes. When we realize a composition, we assign values to each of its attributes: a (scalar) value to a static attribute, an envelope and a size to a dynamic attribute. A composition is then a trajectory in the space of aural events, and the complex audio wave is its formal representation. Sounds are fibers in the space of aural events, from which the composer weaves the trajectory of a composition. Each sound object in turn is made up of partials, which are the elementary building blocks of any music composition. The partials evolve on the fastest time scale in the hierarchy of partials, sounds, and compositions. The ideas outlined in this article are being implemented in a digital instrument for additive sound synthesis and in software for music composition. A demonstration of some preliminary results has been submitted by the authors for presentation at the conference.

  9. 1986 annual information meeting. Abstracts

    International Nuclear Information System (INIS)

    1986-01-01

    Abstracts are presented for the following papers: Geohydrological Research at the Y-12 Plant (C.S. Haase); Ecological Impacts of Waste Disposal Operations in Bear Creek Valley Near the Y-12 Plant (J.M. Loar); Finite Element Simulation of Subsurface Contaminant Transport: Logistic Difficulties in Handling Large Field Problems (G.T. Yeh); Dynamic Compaction of a Radioactive Waste Burial Trench (B.P. Spalding); Comparative Evaluation of Potential Sites for a High-Level Radioactive Waste Repository (E.D. Smith); Changing Priorities in Environmental Assessment and Environmental Compliance (R.M. Reed); Ecology, Ecotoxicology, and Ecological Risk Assessment (L.W. Barnthouse); Theory and Practice in Uncertainty Analysis from Ten Years of Practice (R.H. Gardner); Modeling Landscape Effects of Forest Decline (V.H. Dale); Soil Nitrogen and the Global Carbon Cycle (W.M. Post); Maximizing Wood Energy Production in Short-Rotation Plantations: Effect of Initial Spacing and Rotation Length (L.L. Wright); and Ecological Communities and Processes in Woodland Streams Exhibit Both Direct and Indirect Effects of Acidification (J.W. Elwood)

  10. Handedness shapes children's abstract concepts.

    Science.gov (United States)

    Casasanto, Daniel; Henetz, Tania

    2012-03-01

    Can children's handedness influence how they represent abstract concepts like kindness and intelligence? Here we show that from an early age, right-handers associate rightward space more strongly with positive ideas and leftward space with negative ideas, but the opposite is true for left-handers. In one experiment, children indicated where on a diagram a preferred toy and a dispreferred toy should go. Right-handers tended to assign the preferred toy to a box on the right and the dispreferred toy to a box on the left. Left-handers showed the opposite pattern. In a second experiment, children judged which of two cartoon animals looked smarter (or dumber) or nicer (or meaner). Right-handers attributed more positive qualities to animals on the right, but left-handers to animals on the left. These contrasting associations between space and valence cannot be explained by exposure to language or cultural conventions, which consistently link right with good. Rather, right- and left-handers implicitly associated positive valence more strongly with the side of space on which they can act more fluently with their dominant hands. Results support the body-specificity hypothesis (Casasanto, 2009), showing that children with different kinds of bodies think differently in corresponding ways. Copyright © 2011 Cognitive Science Society, Inc.

  11. WD1145+017 (Abstract)

    Science.gov (United States)

    Motta, M.

    2017-12-01

    (Abstract only) WD1145 is a 17th magnitude white dwarf star 570 light years away in Virgo that was discovered to have a disintegrating planetoid in close orbit by Andrew Vanderburg, a graduate student at Harvard CfA, while data mining the elucidate the nature of its rather bizarre transit light curves. I obtained multiple observations of WD1145 over the course of a year, and found a series of complex transit light curves that could only be interpreted as a ring complex or torus in close orbit around WD1145. Combined with data from other amateur astronomers, professional observations, and satellite data, it became clear that WD1145 has a small planetoid in close orbit at the Roche limit and is breaking apart, forming a ring of debris material that is then raining down on the white dwarf. The surface of the star is "polluted" by heavy metals, determined by spectroscopic data. Given that in the intense gravitational field of a white dwarf any heavy metals could not for long last on the surface, this confirms that we are tracking in real time the destruction of a small planet by its host star.

  12. EURORIB 2010, Book of abstracts

    International Nuclear Information System (INIS)

    Tsoneva, N.; Lenske, H.; Casten, R.

    2012-01-01

    The second international EURORIB conference 'EURORIB'10' will be held from June 6. to June 11. 2010 in Lamoura (France). Our nuclear physics community is eagerly awaiting the construction of the next generation of Radioactive Ion Beam (RIB) facilities in Europe: HIE-ISOLDE at CERN, NUSTAR at FAIR, SPES at LNL, SPIRAL2 at GANIL and the future EURISOL. The collaborations built around these facilities are exploring new experimental and theoretical ideas that will advance our understanding of nuclear structure through studies of exotic nuclei. Following in the spirit of the conference held in Giens in 2008, EURORIB'10 will provide the opportunity for the different collaborations to come together and present these ideas, and explore the synergy between the research programmes based around the hypothetical severe acprojects. The main topics to be discussed at the conference are: 1) At and beyond the drip line, 2) Shell structure far from stability, 3) Fusion reactions and synthesis of heavy and superheavy nuclei, 4) Dynamics and thermodynamics of exotic nuclear systems, 5) Radioactive ion beams in nuclear astrophysics, 6) New modes of radioactivity, 7) Fundamental interactions, 8) Applications in other fields, 9) Future RIB facilities, 10) Production and manipulation of RIB, and 11) Working group meetings on synergy in instrumentation and data acquisition. This document gathers only the abstracts of the papers. (authors)

  13. Attracting Girls into Physics (abstract)

    Science.gov (United States)

    Gadalla, Afaf

    2009-04-01

    A recent international study of women in physics showed that enrollment in physics and science is declining for both males and females and that women are severely underrepresented in careers requiring a strong physics background. The gender gap begins early in the pipeline, from the first grade. Girls are treated differently than boys at home and in society in ways that often hinder their chances for success. They have fewer freedoms, are discouraged from accessing resources or being adventurous, have far less exposure to problem solving, and are not encouraged to choose their lives. In order to motivate more girl students to study physics in the Assiut governorate of Egypt, the Assiut Alliance for the Women and Assiut Education District collaborated in renovating the education of physics in middle and secondary school classrooms. A program that helps in increasing the number of girls in science and physics has been designed in which informal groupings are organized at middle and secondary schools to involve girls in the training and experiences needed to attract and encourage girls to learn physics. During implementation of the program at some schools, girls, because they had not been trained in problem-solving as boys, appeared not to be as facile in abstracting the ideas of physics, and that was the primary reason for girls dropping out of science and physics. This could be overcome by holding a topical physics and technology summer school under the supervision of the Assiut Alliance for the Women.

  14. The triconnected abstraction of process models

    OpenAIRE

    Polyvyanyy, Artem; Smirnov, Sergey; Weske, Mathias

    2009-01-01

    Contents: Artem Polyvanny, Sergey Smirnow, and Mathias Weske The Triconnected Abstraction of Process Models 1 Introduction 2 Business Process Model Abstraction 3 Preliminaries 4 Triconnected Decomposition 4.1 Basic Approach for Process Component Discovery 4.2 SPQR-Tree Decomposition 4.3 SPQR-Tree Fragments in the Context of Process Models 5 Triconnected Abstraction 5.1 Abstraction Rules 5.2 Abstraction Algorithm 6 Related Work and Conclusions

  15. Nuclear works. Book of abstracts

    International Nuclear Information System (INIS)

    Candel, Danielle; Calberg-Challot, Marie; Alexander, Catherine; Bergsman, Anne; Meyer, Morgan; Taebi, Behnam; Kloosterman, Jan Leen; Kelfaoui, Mahdi; Gingras, Yves; Laborie, Leonard; Beltran, Alain; Bouvier, Yves; Raineau, Laurence; Poirot-Delpech, Sophie; Ollivon, Franck; Mueller, Birgit; Lemarchand, Frederick; Rivat, Emmanuel; Mormont, Marc; Aparicio, Luis; Fassert, Christine; Lehtonen, Markku; Billet, Philippe; Girard, Berenice; Fournier, Pierre; Marion, Richard; Lot, Nicolas

    2012-01-01

    the conception of a LILW repository (Marc Mormont, Anne Bergmans), The contribution of Social Sciences and Humanities to the scientific program for radioactive waste management of Andra (Luis Aparicio), The public expert and the nuclear catastrophe (Christine Fassert); 5 - Nuclear governance: Did Fukushima put an end to nuclear revival? A post-Fukushima debates analysis in Finnish, French and British media (Markku Lehtonen), Nuclear secrecy at the test of the right to participation (Philippe Billet), Nuclear science, politics and national construction: what remains from Nehru's India in these times of uncertainty? (Berenice Girard); 6 - Working in the nuclear industry. Training and work collectives: Nuclear industry: a workers-less world? (Pierre Fournier), Ambiguity dynamics at NPPs, a pluri-disciplinary approach (Nicolas Lot), Sino-French nuclear engineering curriculums: what kind of innovation configuration? (Richard Marion). This document brings together the French and English abstracts of the different talks

  16. Abstracting audit data for lightweight intrusion detection

    KAUST Repository

    Wang, Wei; Zhang, Xiangliang; Pitsilis, Georgios

    2010-01-01

    are used to validate the two strategies of data abstraction. The extensive test results show that the process of exemplar extraction significantly improves the detection efficiency and has a better detection performance than PCA in data abstraction. © 2010

  17. Abstract methods in partial differential equations

    CERN Document Server

    Carroll, Robert W

    2012-01-01

    Detailed, self-contained treatment examines modern abstract methods in partial differential equations, especially abstract evolution equations. Suitable for graduate students with some previous exposure to classical partial differential equations. 1969 edition.

  18. Introduction to abstract algebra, solutions manual

    CERN Document Server

    Nicholson, W Keith

    2012-01-01

    Praise for the Third Edition ". . . an expository masterpiece of the highest didactic value that has gained additional attractivity through the various improvements . . ."-Zentralblatt MATH The Fourth Edition of Introduction to Abstract Algebra continues to provide an accessible approach to the basic structures of abstract algebra: groups, rings, and fields. The book's unique presentation helps readers advance to abstract theory by presenting concrete examples of induction, number theory, integers modulo n, and permutations before the abstract structures are defined. Readers can immediately be

  19. Writing a Structured Abstract for the Thesis

    Science.gov (United States)

    Hartley, James

    2010-01-01

    This article presents the author's suggestions on how to improve thesis abstracts. The author describes two books on writing abstracts: (1) "Creating Effective Conference Abstracts and Posters in Biomedicine: 500 tips for Success" (Fraser, Fuller & Hutber, 2009), a compendium of clear advice--a must book to have in one's hand as one prepares a…

  20. Efficient abstraction selection in reinforcement learning

    NARCIS (Netherlands)

    Seijen, H. van; Whiteson, S.; Kester, L.

    2013-01-01

    This paper introduces a novel approach for abstraction selection in reinforcement learning problems modelled as factored Markov decision processes (MDPs), for which a state is described via a set of state components. In abstraction selection, an agent must choose an abstraction from a set of

  1. 2013 SYR Accepted Poster Abstracts.

    Science.gov (United States)

    2013-01-01

    SYR 2013 Accepted Poster abstracts: 1. Benefits of Yoga as a Wellness Practice in a Veterans Affairs (VA) Health Care Setting: If You Build It, Will They Come? 2. Yoga-based Psychotherapy Group With Urban Youth Exposed to Trauma. 3. Embodied Health: The Effects of a Mind�Body Course for Medical Students. 4. Interoceptive Awareness and Vegetable Intake After a Yoga and Stress Management Intervention. 5. Yoga Reduces Performance Anxiety in Adolescent Musicians. 6. Designing and Implementing a Therapeutic Yoga Program for Older Women With Knee Osteoarthritis. 7. Yoga and Life Skills Eating Disorder Prevention Among 5th Grade Females: A Controlled Trial. 8. A Randomized, Controlled Trial Comparing the Impact of Yoga and Physical Education on the Emotional and Behavioral Functioning of Middle School Children. 9. Feasibility of a Multisite, Community based Randomized Study of Yoga and Wellness Education for Women With Breast Cancer Undergoing Chemotherapy. 10. A Delphi Study for the Development of Protocol Guidelines for Yoga Interventions in Mental Health. 11. Impact Investigation of Breathwalk Daily Practice: Canada�India Collaborative Study. 12. Yoga Improves Distress, Fatigue, and Insomnia in Older Veteran Cancer Survivors: Results of a Pilot Study. 13. Assessment of Kundalini Mantra and Meditation as an Adjunctive Treatment With Mental Health Consumers. 14. Kundalini Yoga Therapy Versus Cognitive Behavior Therapy for Generalized Anxiety Disorder and Co-Occurring Mood Disorder. 15. Baseline Differences in Women Versus Men Initiating Yoga Programs to Aid Smoking Cessation: Quitting in Balance Versus QuitStrong. 16. Pranayam Practice: Impact on Focus and Everyday Life of Work and Relationships. 17. Participation in a Tailored Yoga Program is Associated With Improved Physical Health in Persons With Arthritis. 18. Effects of Yoga on Blood Pressure: Systematic Review and Meta-analysis. 19. A Quasi-experimental Trial of a Yoga based Intervention to Reduce Stress and

  2. Sharing AIS Related Anomalies (SARA)

    Science.gov (United States)

    2016-03-01

    78 6.3.7 SQL Versus NoSQL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 6.4 Data Processing...43 6.1 Overview of SQL and NoSQL differences, from [56]. . . . . . . . . . . . . . . . . . 82 A.1 Description of the ship anomaly upload use...constraints must be considered. These requirements, however, can only be defined when lower level implementation decisions, such as SQL versus NoSQL

  3. Severe accident recriticality analyses (SARA)

    DEFF Research Database (Denmark)

    Frid, W.; Højerup, C.F.; Lindholm, I.

    2001-01-01

    with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality-both super-prompt power bursts and quasi steady-state power......Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies......, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g(-1), was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s(-1). In most cases, however, the predicted energy deposition was smaller, below...

  4. Automata Learning through Counterexample Guided Abstraction Refinement

    DEFF Research Database (Denmark)

    Aarts, Fides; Heidarian, Faranak; Kuppens, Harco

    2012-01-01

    to a small set of abstract events that can be handled by automata learning tools. In this article, we show how such abstractions can be constructed fully automatically for a restricted class of extended finite state machines in which one can test for equality of data parameters, but no operations on data...... are allowed. Our approach uses counterexample-guided abstraction refinement: whenever the current abstraction is too coarse and induces nondeterministic behavior, the abstraction is refined automatically. Using Tomte, a prototype tool implementing our algorithm, we have succeeded to learn – fully......Abstraction is the key when learning behavioral models of realistic systems. Hence, in most practical applications where automata learning is used to construct models of software components, researchers manually define abstractions which, depending on the history, map a large set of concrete events...

  5. Engineering Abstractions in Model Checking and Testing

    DEFF Research Database (Denmark)

    Achenbach, Michael; Ostermann, Klaus

    2009-01-01

    Abstractions are used in model checking to tackle problems like state space explosion or modeling of IO. The application of these abstractions in real software development processes, however, lacks engineering support. This is one reason why model checking is not widely used in practice yet...... and testing is still state of the art in falsification. We show how user-defined abstractions can be integrated into a Java PathFinder setting with tools like AspectJ or Javassist and discuss implications of remaining weaknesses of these tools. We believe that a principled engineering approach to designing...... and implementing abstractions will improve the applicability of model checking in practice....

  6. Minimalism in architecture: Abstract conceptualization of architecture

    Directory of Open Access Journals (Sweden)

    Vasilski Dragana

    2015-01-01

    Full Text Available Minimalism in architecture contains the idea of the minimum as a leading creative tend to be considered and interpreted in working through phenomena of empathy and abstraction. In the Western culture, the root of this idea is found in empathy of Wilhelm Worringer and abstraction of Kasimir Malevich. In his dissertation, 'Abstraction and Empathy' Worringer presented his thesis on the psychology of style through which he explained the two opposing basic forms: abstraction and empathy. His conclusion on empathy as a psychological basis of observation expression is significant due to the verbal congruence with contemporary minimalist expression. His intuition was enhenced furthermore by figure of Malevich. Abstraction, as an expression of inner unfettered inspiration, has played a crucial role in the development of modern art and architecture of the twentieth century. Abstraction, which is one of the basic methods of learning in psychology (separating relevant from irrelevant features, Carl Jung is used to discover ideas. Minimalism in architecture emphasizes the level of abstraction to which the individual functions are reduced. Different types of abstraction are present: in the form as well as function of the basic elements: walls and windows. The case study is an example of Sou Fujimoto who is unequivocal in its commitment to the autonomy of abstract conceptualization of architecture.

  7. Analysis of complex networks using aggressive abstraction.

    Energy Technology Data Exchange (ETDEWEB)

    Colbaugh, Richard; Glass, Kristin.; Willard, Gerald

    2008-10-01

    This paper presents a new methodology for analyzing complex networks in which the network of interest is first abstracted to a much simpler (but equivalent) representation, the required analysis is performed using the abstraction, and analytic conclusions are then mapped back to the original network and interpreted there. We begin by identifying a broad and important class of complex networks which admit abstractions that are simultaneously dramatically simplifying and property preserving we call these aggressive abstractions -- and which can therefore be analyzed using the proposed approach. We then introduce and develop two forms of aggressive abstraction: 1.) finite state abstraction, in which dynamical networks with uncountable state spaces are modeled using finite state systems, and 2.) onedimensional abstraction, whereby high dimensional network dynamics are captured in a meaningful way using a single scalar variable. In each case, the property preserving nature of the abstraction process is rigorously established and efficient algorithms are presented for computing the abstraction. The considerable potential of the proposed approach to complex networks analysis is illustrated through case studies involving vulnerability analysis of technological networks and predictive analysis for social processes.

  8. 8th Czechoslovak spectroscopic conference. Abstracts

    International Nuclear Information System (INIS)

    1988-01-01

    Volume 2 of the conference proceedings contains abstracts of 17 invited papers and 119 poster presentations, devoted to molecular spectroscopy. Abstracts of 2 poster presentations were inputted in INIS, one dealing with organic complexes of 99 Tc, the other with electronic spectra of lanthanide ions. (A.K.)

  9. An abstract machine for module replacement

    OpenAIRE

    Walton, Chris; Krl, Dilsun; Gilmore, Stephen

    1998-01-01

    In this paper we define an abstract machine model for the mλ typed intermediate language. This abstract machine is used to give a formal description of the operation of run-time module replacement from the programming language Dynamic ML. The essential technical device which we employ for module replacement is a modification of two-space copying garbage collection.

  10. Abstract Object Creation in Dynamic Logic

    NARCIS (Netherlands)

    I. Grabe (Immo); F.S. de Boer (Frank); W. Ahrendt (Wolfgang); A. Cavalcanti; D.R. Dams

    2009-01-01

    textabstractIn this paper we give a representation of a weakest precondition calculus for abstract object creation in dynamic logic, the logic underlying the KeY theorem prover. This representation allows to both specify and verify properties of objects at the abstraction level of the

  11. 8th Czechoslovak spectroscopic conference. Abstracts

    International Nuclear Information System (INIS)

    1988-01-01

    Volume 3 of the conference proceedings contains abstracts of 17 invited papers, 101 poster presentations and 7 papers of instrument manufacturers, devoted to special spectroscopic techniques including X-ray microanalysis, X-ray spectral analysis, Moessbauer spectrometry, mass spectrometry, instrumental activation analysis and other instrumental radioanalytical methods, electron spectrometry, and techniques of environmental analysis. Sixty abstracts were inputted in INIS. (A.K.)

  12. Data Abstraction Mechanisms in Sina/st

    NARCIS (Netherlands)

    Meyrowitz, N.K.; Aksit, Mehmet; Tripathi, Anand

    1988-01-01

    This paper describes a new data abstraction mechanism in an object-oriented model of computing. The data abstraction mechanism described here has been devised in the context of the design of Sina/st language. In Sina/st no language constructs have been adopted for specifying inheritance or

  13. Geometry of abstraction in quantum computation

    NARCIS (Netherlands)

    Pavlovic, Dusko; Abramsky, S.; Mislove, M.W.

    2012-01-01

    Quantum algorithms are sequences of abstract operations, per formed on non-existent computers. They are in obvious need of categorical semantics. We present some steps in this direction, following earlier contribu tions of Abramsky, Goecke and Selinger. In particular, we analyze function abstraction

  14. A Brief Introduction to Chinese Biological Abstracts

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Chinese Biological Abstracts (CBA), a state-level indexing and abstracting journal published monthly, is jointly sponsored by the Library of the Chinese Academy of Sciences, the Shanghai Institutes for Biological Sciences as well as the Biological Information Network of the Chinese Academy of Sciences, published and distributed by the Shanghai Institutes for Biological Sciences, and approved by the State Scientific and Technological Commission.

  15. Using fairness to make abstractions work

    NARCIS (Netherlands)

    D. Bosnacki; N. Ioustinova (Natalia); N. Sidorova

    2003-01-01

    textabstractAbstractions often introduce infinite traces which have no corresponding traces at the concrete level and can lead to the failure of the verification. Refinement does not always help to eliminate those traces. In this paper, we consider a timer abstraction that introduces a cyclic

  16. Abstract Machines for Programming Language Implementation

    NARCIS (Netherlands)

    Diehl, Stephan; Hartel, Pieter H.; Sestoft, Peter

    We present an extensive, annotated bibliography of the abstract machines designed for each of the main programming paradigms (imperative, object oriented, functional, logic and concurrent). We conclude that whilst a large number of efficient abstract machines have been designed for particular

  17. User-Extensible Graphics Using Abstract Structure,

    Science.gov (United States)

    1987-08-01

    Flex 6 The Algol68 model of the graphical abstract structure 5 The creation of a PictureDefinition 6 The making of a picture from a PictureDefinition 7...data together with the operations that can be performed on that data. i 7! ś I _ § 4, The Alqol68 model of the graphical abstract structure Every

  18. Abstraction Power in Computer Science Education

    DEFF Research Database (Denmark)

    Bennedsen, Jens Benned; Caspersen, Michael Edelgaard

    2006-01-01

    The paper is a discussion of the hypothesis that a person’s abstraction power (or ability) has a positive influence on their ability to program.......The paper is a discussion of the hypothesis that a person’s abstraction power (or ability) has a positive influence on their ability to program....

  19. Bounded Rationality of Generalized Abstract Fuzzy Economies

    Directory of Open Access Journals (Sweden)

    Lei Wang

    2014-01-01

    Full Text Available By using a nonlinear scalarization technique, the bounded rationality model M for generalized abstract fuzzy economies in finite continuous spaces is established. Furthermore, by using the model M, some new theorems for structural stability and robustness to (λ,ϵ-equilibria of generalized abstract fuzzy economies are proved.

  20. Hydrogen abstraction reactions by amide electron adducts

    International Nuclear Information System (INIS)

    Sevilla, M.D.; Sevilla, C.L.; Swarts, S.

    1982-01-01

    Electron reactions with a number of peptide model compounds (amides and N-acetylamino acids) in aqueous glasses at low temperature have been investigated using ESR spectroscopy. The radicals produced by electron attachment to amides, RC(OD)NDR', are found to act as hydrogen abstracting agents. For example, the propionamide electron adduct is found to abstract from its parent propionamide. Electron adducts of other amides investigated show similar behavior except for acetamide electron adduct which does not abstract from its parent compound, but does abstract from other amides. The tendency toward abstraction for amide electron adducts are compared to electron adducts of several carboxylic acids, ketones, aldehydes and esters. The comparison suggests the hydrogen abstraction tendency of the various deuterated electron adducts (DEAs) to be in the following order: aldehyde DEA > acid DEA = approximately ester DEA > ketone DEA > amide DEA. In basic glasses the hydrogen abstraction ability of the amide electron adducts is maintained until the concentration of base is increased sufficiently to convert the DEA to its anionic form, RC(O - )ND 2 . In this form the hydrogen abstracting ability of the radical is greatly diminished. Similar results were found for the ester and carboxylic acid DEA's tested. (author)

  1. Notas sobre Feral y las cigüeñas, de Fernando Alonso, y la "Historia del califa cigüeña" (Wilhelm Hauff, Sara Cone Bryant

    Directory of Open Access Journals (Sweden)

    Hans Christian Hagedorn

    2011-01-01

    Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.

  2. Abstract Spatial Reasoning as an Autistic Strength

    Science.gov (United States)

    Stevenson, Jennifer L.; Gernsbacher, Morton Ann

    2013-01-01

    Autistic individuals typically excel on spatial tests that measure abstract reasoning, such as the Block Design subtest on intelligence test batteries and the Raven’s Progressive Matrices nonverbal test of intelligence. Such well-replicated findings suggest that abstract spatial processing is a relative and perhaps absolute strength of autistic individuals. However, previous studies have not systematically varied reasoning level – concrete vs. abstract – and test domain – spatial vs. numerical vs. verbal, which the current study did. Autistic participants (N = 72) and non-autistic participants (N = 72) completed a battery of 12 tests that varied by reasoning level (concrete vs. abstract) and domain (spatial vs. numerical vs. verbal). Autistic participants outperformed non-autistic participants on abstract spatial tests. Non-autistic participants did not outperform autistic participants on any of the three domains (spatial, numerical, and verbal) or at either of the two reasoning levels (concrete and abstract), suggesting similarity in abilities between autistic and non-autistic individuals, with abstract spatial reasoning as an autistic strength. PMID:23533615

  3. Interdisciplinary perspectives on abstracts for information retrieval

    Directory of Open Access Journals (Sweden)

    Soon Keng Chan

    2004-10-01

    Full Text Available The paper examines the abstract genre from the perspectives of English for Specific Purposes (ESP practitioners and information professionals. It aims to determine specific interdisciplinary interests in the abstract, and to explore areas of collaboration in terms of research and pedagogical practices. A focus group (FG comprising information professionals from the Division of Information Studies, Nanyang Technological University, Singapore, convened for a discussion on the subject of abstracts and abstracting. Two major issues that have significant implications for ESP practices emerged during the discussion. While differences in terms of approach to and objectives of the abstract genre are apparent between information professionals and language professionals, the demands for specific cognitive processes involved in abstracting proved to be similar. This area of similarity provides grounds for awareness raising and collaboration between the two disciplines. While ESP practitioners need to consider adding the dimension of information science to the rhetorical and linguistic scaffolding that they have been providing to novice-writers, information professionals can contribute useful insights about the qualities of abstracts that have the greatest impact in meeting the end-users' needs in information search.

  4. Abstract Interpretation as a Programming Language

    DEFF Research Database (Denmark)

    Rosendahl, Mads

    2013-01-01

    examine different programming styles and ways to represent states. Abstract interpretation is primarily a technique for derivation and specification of program analysis. As with denotational semantics we may also view abstract interpretations as programs and examine the implementation. The main focus...... in this paper is to show that results from higher-order strictness analysis may be used more generally as fixpoint operators for higher-order functions over lattices and thus provide a technique for immediate implementation of a large class of abstract interpretations. Furthermore, it may be seen...

  5. Collected abstracts on particle beam diagnostic systems

    International Nuclear Information System (INIS)

    Hickok, R.L.

    1979-01-01

    This report contains a compilation of abstracts on work related to particle beam diagnostics for high temperature plasmas. The abstracts were gathered in early 1978 and represent the status of the various programs as of that date. It is not suggested that this is a comprehensive list of all the work that is going on in the development of particle beam diagnostics, but it does provide a representative view of the work in this field. For example, no abstracts were received from the U.S.S.R. even though they have considerable activity in particle beam diagnostics

  6. Abstraction in artificial intelligence and complex systems

    CERN Document Server

    Saitta, Lorenza

    2013-01-01

    Abstraction is a fundamental mechanism underlying both human and artificial perception, representation of knowledge, reasoning and learning. This mechanism plays a crucial role in many disciplines, notably Computer Programming, Natural and Artificial Vision, Complex Systems, Artificial Intelligence and Machine Learning, Art, and Cognitive Sciences. This book first provides the reader with an overview of the notions of abstraction proposed in various disciplines by comparing both commonalities and differences.  After discussing the characterizing properties of abstraction, a formal model, the K

  7. 2002 Conference Programme and Book of Abstracts

    International Nuclear Information System (INIS)

    2002-01-01

    The 25th Annual (Silver Jubilee) Conference 2002 Conference Programme and Book of Abstracts gives a brief on the Nigerian Institute of Physics, the Sheda Science and Technology Complex. It carries the Conference programme and carries the abstracts of all the papers presented. The abstracts cover a wide range of subjects including topics in atmospheric physics, education, policy and planning, geophysics, instrumentation, mathematical sciences, theoretical physics, nuclear and health physics, solid state, electronic and health physics. We are grateful to the Nigerian Institute of Physics for this volume

  8. Functional Correspondence between Evaluators and Abstract Machines

    DEFF Research Database (Denmark)

    Ager, Mads Stig; Biernacki, Dariusz; Danvy, Olivier

    2003-01-01

    We bridge the gap between functional evaluators and abstract machines for the λ-calculus, using closure conversion, transformation into continuation-passing style, and defunctionalization.We illustrate this approach by deriving Krivine's abstract machine from an ordinary call-by-name evaluator...... and by deriving an ordinary call-by-value evaluator from Felleisen et al.'s CEK machine. The first derivation is strikingly simpler than what can be found in the literature. The second one is new. Together, they show that Krivine's abstract machine and the CEK machine correspond to the call-by-name and call...

  9. Abstracts of Remediation Case Studies, Volume 9

    Science.gov (United States)

    This report, published by the Federal Remediation Technologies Roundtable (FRTR), is a collection of recently published abstracts summarizing 13 cost and performance case studies on the use of remediation technologies at contaminated sites.

  10. Pulmonary toxicology of respirable particles. [Lead abstract

    Energy Technology Data Exchange (ETDEWEB)

    Sanders, C.L.; Cross, F.T.; Dagle, G.E.; Mahaffey, J.A. (eds.)

    1980-09-01

    Separate abstracts were prepared for the 44 papers presented in these proceedings. The last paper (Stannard) in the proceedings is an historical review of the field of inhalation toxicology and is not included in the analytics. (DS)

  11. Photochemical hydrogen abstractions as radiationless transitions

    International Nuclear Information System (INIS)

    Burrows, H.D.; Formosinho, S.J.

    1977-01-01

    The tunnel-effect theory of radiationless transitions is applied to the quenching of the uranyl ion excited state by aliphatic compounds. The most important mechanism kinetically is suggested to involve chemical quenching via hydrogen abstraction, and rates for these reactions are analysed theoretically. Good agreement between theory and experiment is observed for a number of alcohols and ethers, and the reactions are suggested to possess considerable charge-transfer character. With t-butanol it is suggested that abstraction occurs preferentially from the hydroxylic hydrogen. Theoretical analysis of the rates of hydrogen abstraction from carboxylic acids suggests that the reaction geometry in this case may be different from the reaction with alcohols or ethers. The possibility that excited uranyl ion can abstract a hydrogen atom from water is examined, and theoretical evidence is presented to suggest that this is the main route for deactivation of uranyl ion lowest excited state in water at room temperature. (author)

  12. Abstract: Cultural Humility in Nursing Practice | Nkurunziza ...

    African Journals Online (AJOL)

    Abstract: Cultural Humility in Nursing Practice. ... For example, Rwandan colleagues work from a collectivist viewpoint. ... In contrast, the U.S. healthcare system is based on individualism, rooted in a belief in the separation and autonomy of ...

  13. Final program and book of abstracts

    International Nuclear Information System (INIS)

    1999-01-01

    The Israel Nuclear Society, Israel Society of radiation protection, Israel Society of medical Physics and Israel Society of Radiation Research combined in the 20th conference of the Nuclear Societies in Israel. Extended abstracts are presented

  14. GIBS Geospatial Data Abstraction Library (GDAL)

    Data.gov (United States)

    National Aeronautics and Space Administration — GDAL is an open source translator library for raster geospatial data formats that presents a single abstract data model to the calling application for all supported...

  15. Transport safety research abstracts. No. 1

    International Nuclear Information System (INIS)

    1991-07-01

    The Transport Safety Research Abstracts is a collection of reports from Member States of the International Atomic Energy Agency, and other international organizations on research in progress or just completed in the area of safe transport of radioactive material. The main aim of TSRA is to draw attention to work that is about to be published, thus enabling interested parties to obtain further information through direct correspondence with the investigators. Information contained in this issue covers work being undertaken in 6 Member States and contracted by 1 international organization; it is hoped with succeeding issues that TSRA will be able to widen this base. TSRA is modelled after other IAEA publications describing work in progress in other programme areas, namely Health Physics Research Abstracts (No. 14 was published in 1989), Waste Management Research Abstracts (No. 20 was published in 1990), and Nuclear Safety Research Abstracts (No. 2 was published in 1990)

  16. Final program and book of abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-12-20

    The Israel Nuclear Society, Israel Society of radiation protection, Israel Society of medical Physics and Israel Society of Radiation Research combined in the 20th conference of the Nuclear Societies in Israel. Extended abstracts are presented.

  17. Abstraction and climate change in Europe

    OpenAIRE

    Laize, Cedric

    2014-01-01

    Invited oral presentation at the British Hydrological Society National meeting on "Hydroecology and water abstraction: science, practice and licence reform", Birmingham, 18 December 2013. Link below: full paper in River Research and Applications (Laize et al., 2014)

  18. CUBE (Computer Use By Engineers) symposium abstracts

    International Nuclear Information System (INIS)

    Ruminer, J.J.

    1978-07-01

    This report presents the abstracts for the CUBE (Computer Use by Engineers) Symposium, October 4, through 6, 1978. Contributors are from Lawrence Livermore Laboratory, Los Alamos Scientific Laboratory, and Sandia Laboratories

  19. Earth Sciences Division collected abstracts: 1980

    Energy Technology Data Exchange (ETDEWEB)

    Henry, A.L.; Hornady, B.F. (eds.)

    1981-10-15

    This report is a compilation of abstracts of papers, reports, and talks presented during 1980 at national and international meetings by members of the Earth Sciences Division, Lawrence Livermore National Laboratory. The arrangement is alphabetical (by author). For a given report, a bibliographic reference appears under the name of each coauthor, but the abstract itself is given only under the name of the first author (indicated in capital letters) or the first Earth Sciences Division author.

  20. Earth Sciences Division collected abstracts: 1980

    International Nuclear Information System (INIS)

    Henry, A.L.; Hornady, B.F.

    1981-01-01

    This report is a compilation of abstracts of papers, reports, and talks presented during 1980 at national and international meetings by members of the Earth Sciences Division, Lawrence Livermore National Laboratory. The arrangement is alphabetical (by author). For a given report, a bibliographic reference appears under the name of each coauthor, but the abstract itself is given only under the name of the first author (indicated in capital letters) or the first Earth Sciences Division author

  1. Mathematical Abstraction: Constructing Concept of Parallel Coordinates

    Science.gov (United States)

    Nurhasanah, F.; Kusumah, Y. S.; Sabandar, J.; Suryadi, D.

    2017-09-01

    Mathematical abstraction is an important process in teaching and learning mathematics so pre-service mathematics teachers need to understand and experience this process. One of the theoretical-methodological frameworks for studying this process is Abstraction in Context (AiC). Based on this framework, abstraction process comprises of observable epistemic actions, Recognition, Building-With, Construction, and Consolidation called as RBC + C model. This study investigates and analyzes how pre-service mathematics teachers constructed and consolidated concept of Parallel Coordinates in a group discussion. It uses AiC framework for analyzing mathematical abstraction of a group of pre-service teachers consisted of four students in learning Parallel Coordinates concepts. The data were collected through video recording, students’ worksheet, test, and field notes. The result shows that the students’ prior knowledge related to concept of the Cartesian coordinate has significant role in the process of constructing Parallel Coordinates concept as a new knowledge. The consolidation process is influenced by the social interaction between group members. The abstraction process taken place in this group were dominated by empirical abstraction that emphasizes on the aspect of identifying characteristic of manipulated or imagined object during the process of recognizing and building-with.

  2. Abstracting audit data for lightweight intrusion detection

    KAUST Repository

    Wang, Wei

    2010-01-01

    High speed of processing massive audit data is crucial for an anomaly Intrusion Detection System (IDS) to achieve real-time performance during the detection. Abstracting audit data is a potential solution to improve the efficiency of data processing. In this work, we propose two strategies of data abstraction in order to build a lightweight detection model. The first strategy is exemplar extraction and the second is attribute abstraction. Two clustering algorithms, Affinity Propagation (AP) as well as traditional k-means, are employed to extract the exemplars, and Principal Component Analysis (PCA) is employed to abstract important attributes (a.k.a. features) from the audit data. Real HTTP traffic data collected in our institute as well as KDD 1999 data are used to validate the two strategies of data abstraction. The extensive test results show that the process of exemplar extraction significantly improves the detection efficiency and has a better detection performance than PCA in data abstraction. © 2010 Springer-Verlag.

  3. Abstracts and abstracting a genre and set of skills for the twenty-first century

    CERN Document Server

    Koltay, Tibor

    2010-01-01

    Despite their changing role, abstracts remain useful in the digital world. Highly beneficial to information professionals and researchers who work and publish in different fields, this book summarizes the most important and up-to-date theory of abstracting, as well as giving advice and examples for the practice of writing different kinds of abstracts. The book discusses the length, the functions and basic structure of abstracts, outlining a new approach to informative and indicative abstracts. The abstractors' personality, their linguistic and non-linguistic knowledge and skills are also discu

  4. Frontopolar cortex mediates abstract integration in analogy.

    Science.gov (United States)

    Green, Adam E; Fugelsang, Jonathan A; Kraemer, David J M; Shamosh, Noah A; Dunbar, Kevin N

    2006-06-22

    Integration of abstractly similar relations during analogical reasoning was investigated using functional magnetic resonance imaging. Activation elicited by an analogical reasoning task that required both complex working memory and integration of abstractly similar relations was compared to activation elicited by a non-analogical task that required complex working memory in the absence of abstract relational integration. A left-sided region of the frontal pole of the brain (BA 9/10) was selectively active for the abstract relational integration component of analogical reasoning. Analogical reasoning also engaged a left-sided network of parieto-frontal regions. Activity in this network during analogical reasoning is hypothesized to reflect categorical alignment of individual component terms that make up analogies. This parieto-frontal network was also engaged by the complex control task, which involved explicit categorization, but not by a simpler control task, which did not involve categorization. We hypothesize that frontopolar cortex mediates abstract relational integration in complex reasoning while parieto-frontal regions mediate working memory processes, including manipulation of terms for the purpose of categorical alignment, that facilitate this integration.

  5. 05421 Abstracts Collection - Data Always and Everywhere

    DEFF Research Database (Denmark)

    Alonso, G.; Jensen, Christian Søndergaard; Mitschang, B.

    2006-01-01

    From 16.10.05 to 21.10.05, the Dagstuhl Seminar 05421, Data Always and Everywhere - Management of Mobile, Ubiquitous, Pervasive, and Sensor Data, was held in the International Conference and Research Center, Schloss Dagstuhl. During the seminar, all participants were given the opportunity...... to present their current research, and ongoing activities and open problems were discussed. This document is a collection of the abstracts of the presentations given during the seminar. Some abstracts offer links to extended abstracts, full papers, and other supporting documents. A separate companion...... document summarizes the seminar. The authors wish to acknowledge Victor Teixeira de Almeida, who served as collector for the seminar and thus played a key role in collecting materials from the seminar participants...

  6. Abstracts – eine facettenreiche Textsorte der Wissenschaft

    Directory of Open Access Journals (Sweden)

    Ines Busch-Lauer

    2012-01-01

    Full Text Available Der Beitrag beschreibt die Relevanz der informationsverdichtenden Textsorte Abstract in der Wissenschaftskommunikation. Im Mittelpunkt stehen die Definition, die Klassifikation und die Struktur sowie ausgewählte Merkmale dieser Textsorte.Im ersten Teil des Beitrags werden die unterschiedlichen Arten von Abstracts anhand von Textbeispielen aus der Linguistik, der Medizin und den Technikwissenschaften expliziert. Im zweiten Teil untersucht der Beitrag anhand von Abstracts, die von deutschen Studierenden der Technik- und Ingenieurwissenschaften im Rahmen ihrer fachbezogenen Englischausbildung verfasst wurden, inwieweit die textsortenimmanenten Merkmale auch von Lernenden in der Textproduktion in der Fremdsprache umgesetzt wurden. Mit dieser qualitativ beschreibenden Untersuchung trägt die Studie zur kontrastiven Fachtextsortenbeschreibung und andererseits als Praxisbericht zur Vermittlung von Textsorten im fachbezogenen Fremdsprachenunterricht an Hochschulen bei.

  7. Abstract Interpretation as a Programming Language

    Directory of Open Access Journals (Sweden)

    Mads Rosendahl

    2013-09-01

    Full Text Available In David Schmidt's PhD work he explored the use of denotational semantics as a programming language. It was part of an effort to not only treat formal semantics as specifications but also as interpreters and input to compiler generators. The semantics itself can be seen as a program and one may examine different programming styles and ways to represent states. Abstract interpretation is primarily a technique for derivation and specification of program analysis. As with denotational semantics we may also view abstract interpretations as programs and examine the implementation. The main focus in this paper is to show that results from higher-order strictness analysis may be used more generally as fixpoint operators for higher-order functions over lattices and thus provide a technique for immediate implementation of a large class of abstract interpretations. Furthermore, it may be seen as a programming paradigm and be used to write programs in a circular style.

  8. Earth Sciences Division collected abstracts: 1979

    International Nuclear Information System (INIS)

    Henry, A.L.; Schwartz, L.L.

    1980-01-01

    This report is a compilation of abstracts of papers, internal reports, and talks presented during 1979 at national and international meetings by members of the Earth Sciences Division, Lawrence Livermore Laboratory. The arrangement is alphabetical (by author). For a given report, a bibliographic reference appears under the name of each coauthor, but the abstract iself is given only under the name of the first author or the first Earth Sciences Division author. A topical index at the end of the report provides useful cross references, while indicating major areas of research interest in the Earth Sciences Division

  9. Object-oriented programming with gradual abstraction

    DEFF Research Database (Denmark)

    Nørmark, Kurt; Thomsen, Lone Leth; Thomsen, Bent

    2013-01-01

    We describe an experimental object-oriented programming language, ASL2, that supports program development by means of a series of abstraction steps. The language allows immediate object construction, and it is possible to use the constructed objects for concrete problem solving tasks. Classes...... restrictive. As a central mechanism, weakly classified objects are allowed to borrow methods from each other. ASL2 supports class generalization, as a counterpart to class specialization and inheritance in mainstream object-oriented programming languages. The final abstraction step discussed in this paper...

  10. Regulatory and technical reports (abstract index journal)

    International Nuclear Information System (INIS)

    1994-03-01

    This compilation consists of bibliographic data and abstracts for the formal regulatory and technical reports issued by the US Nuclear Regulatory Commission staff and its contractors. There are four types of reports included: staff reports, conference reports, contractor reports, and international agreement reports. In addition to the main citations with abstracts, the following are also included: Secondary report number index; Personal author index; Subject index; NRC originating organization indices for staff reports and international agreement reports; NRC contract sponsor index; Contractor index; International organization index; and Licensed facility index

  11. Arche papers on the mathematics of abstraction

    CERN Document Server

    Cook, Roy T

    2007-01-01

    This volume collects together a number of important papers concerning both the method of abstraction generally and the use of particular abstraction principles to reconstruct central areas of mathematics along logicist lines. Gottlob Frege's original logicist project was, in effect, refuted by Russell's paradox. Crispin Wright has recently revived Frege's enterprise, however, providing a philosophical and technical framework within which a reconstruction of arithmetic is possible. While the Neo-Fregean project has recieved extensive attention and discussion, the present volume is unique in pre

  12. Abstraction carrying code and resource-awareness

    OpenAIRE

    Hermenegildo, Manuel V.; Albert Albiol, Elvira; López García, Pedro; Puebla Sánchez, Alvaro Germán

    2005-01-01

    Proof-Carrying Code (PCC) is a general approach to mobile code safety in which the code supplier augments the program with a certifícate (or proof). The intended benefit is that the program consumer can locally validate the certifícate w.r.t. the "untrusted" program by means of a certifícate checker—a process which should be much simpler, eíñcient, and automatic than generating the original proof. Abstraction Carrying Code (ACC) is an enabling technology for PCC in which an abstract mod...

  13. From Outermost Reduction Semantics to Abstract Machine

    DEFF Research Database (Denmark)

    Danvy, Olivier; Johannsen, Jacob

    to transform a reduction-based normalization function into a reduction-free one where the reduction sequence is not enumerated. This reduction-free normalization function takes the form of an abstract machine that navigates from one redex site to the next without systematically detouring via the root...... of a redex. In this article, we consider such an outermost reduction semantics with backward-overlapping rules, and we investigate how to apply refocusing to still obtain a reduction-free normalization function in the form of an abstract machine....

  14. Abstracting massive data for lightweight intrusion detection in computer networks

    KAUST Repository

    Wang, Wei; Liu, Jiqiang; Pitsilis, Georgios; Zhang, Xiangliang

    2016-01-01

    detection. Data abstraction refers to abstract or extract the most relevant information from the massive dataset. In this work, we propose three strategies of data abstraction, namely, exemplar extraction, attribute selection and attribute abstraction. We

  15. Water Pollution Abstracts. Volume 43, Number 4, Abstracts 645-849.

    Science.gov (United States)

    WATER POLLUTION, *ABSTRACTS, PURIFICATION, WASTES(INDUSTRIAL), CONTROL, SEWAGE, WATER SUPPLIES, PUBLIC HEALTH, PETROLEUM PRODUCTS, DEGRADATION, DAMS...ESTUARIES, PLANKTON, PHOTOSYNTHESIS, VIRUSES, SEA WATER , MICROBIOLOGY, UNITED KINGDOM.

  16. Topological superposition of abstractions of stochastic processes

    NARCIS (Netherlands)

    Bujorianu, L.M.; Bujorianu, M.C.

    2008-01-01

    In this paper, we present a sound integration mechanism for Markov processes that are abstractions of stochastic hybrid systems (SHS). In a previous work, we have defined a very general model of SHS and we proved that the realization of an SHS is a Markov process. Moreover, we have developed a

  17. Language abstraction in word of mouth

    NARCIS (Netherlands)

    Schellekens, G.A.C.; Verlegh, P.W.J.; Smidts, A.

    2010-01-01

    This research examines the language that consumers use in word of mouth. For both positive and negative product experiences, we demonstrate that consumers use more abstract terms when they describe experiences that are in line with the valence of their product attitude. This effect cannot be

  18. Abstract algebra an inquiry based approach

    CERN Document Server

    Hodge, Jonathan K; Sundstrom, Ted

    2013-01-01

    ""This book arose from the authors' approach to teaching abstract algebra. They place an emphasis on active learning and on developing students' intuition through their investigation of examples. … The text is organized in such a way that it is possible to begin with either rings or groups.""-Florentina Chirtes, Zentralblatt MATH 1295

  19. Abstracts of Research Papers 1977 AAHPER Convention.

    Science.gov (United States)

    Sage, George H., Ed.

    This volume of abstracts describes papers written on the following topics: (1) Strength Physiology; (2) Learning Disabilities (motor); (3) Physiology - General; (4) Work Capacity; (5) Measurement and Recreation; (6) Biomechanics; (7) Professional Preparation (physical education); (8) Muscle Performance; (9) Sociology of Sport; (10) History of…

  20. Functional Abstraction of Stochastic Hybrid Systems

    NARCIS (Netherlands)

    Bujorianu, L.M.; Blom, Henk A.P.; Hermanns, H.

    2006-01-01

    The verification problem for stochastic hybrid systems is quite difficult. One method to verify these systems is stochastic reachability analysis. Concepts of abstractions for stochastic hybrid systems are needed to ease the stochastic reachability analysis. In this paper, we set up different ways

  1. Natural radiation environment III. [Lead Abstract

    Energy Technology Data Exchange (ETDEWEB)

    Gesell, T.F.; Lowder, W.M. (eds.)

    1980-01-01

    Separate abstracts were prepared for the 52 research papers presented at this symposium in April 1978. The major topics in this volume deal with penetrating radiation measurements, radiation surveys and population exposure, radioactivity in the indoor environment, and technologically enhanced natural radioactivity. (KRM)

  2. Hilson Adolescent Profile (HAP): Hilson Research Abstracts.

    Science.gov (United States)

    Hilson Research Inc., Kew Gardens, NY.

    Abstracts and bibliographic citations are given for the following documents concerned with the use and characteristics of the Hilson Adolescent Profile (HAP): (1) "Use of the Hilson Adolescent Profile To Compare Juvenile Offenders with Junior and Senior High School Students" (R. E. Inwald and K. E. Brobst); (2) "The Effectiveness of…

  3. A Modal Logic for Abstract Delta Modeling

    NARCIS (Netherlands)

    F.S. de Boer (Frank); M. Helvensteijn (Michiel); J. Winter (Joost)

    2012-01-01

    htmlabstractAbstract Delta Modeling is a technique for implementing (software) product lines. Deltas are put in a partial order which restricts their application and are then sequentially applied to a core product in order to form specific products in the product line. In this paper we explore the

  4. Regulatory and technical reports (Abstract index journal)

    International Nuclear Information System (INIS)

    1990-12-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  5. Geometry of abstraction in quantum computation

    NARCIS (Netherlands)

    Pavlovic, Dusko; Abramsky, S.; Mislove, M.W.

    2012-01-01

    Quantum algorithms are sequences of abstract operations, per­ formed on non-existent computers. They are in obvious need of categorical semantics. We present some steps in this direction, following earlier contribu­ tions of Abramsky, Goecke and Selinger. In particular, we analyze function

  6. Title TBA: Revising the Abstract Submission Process.

    Science.gov (United States)

    Tibon, Roni; Open Science Committee, Cbu; Henson, Richard

    2018-04-01

    Academic conferences are among the most prolific scientific activities, yet the current abstract submission and review process has serious limitations. We propose a revised process that would address these limitations, achieve some of the aims of Open Science, and stimulate discussion throughout the entire lifecycle of the scientific work. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.

  7. Geometric Abstract Art and Public Health Data

    Centers for Disease Control (CDC) Podcasts

    2016-10-18

    Dr. Salaam Semaan, a CDC behavioral scientist, discusses the similarities between geometric abstract art and public health data analysis.  Created: 10/18/2016 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 10/18/2016.

  8. Towards Abstract Interpretation of Epistemic Logic

    DEFF Research Database (Denmark)

    Ajspur, Mai; Gallagher, John Patrick

    applicable to infinite models. The abstract model-checker allows model-checking with infinite-state models. When applied to the problem of whether M |= φ, it terminates and returns the set of states in M at which φ might hold. If the set is empty, then M definitely does not satisfy φ, while if the set is non...

  9. Correlations and fluctuations '98. Collected abstracts

    International Nuclear Information System (INIS)

    Csoergoe, T.; Hegyi, S.; Hwa, R.C.; Jancso, G.

    1998-01-01

    The proceedings of the 8. International workshop on multiparticle production contains the abstracts of papers on various topics of correlations and fluctuations. Hydrodynamic models, Bose-Einstein correlations, hadron-hadron interactions, heavy ion reactions are discussed in detail. 54 items are indexed separately for the INIS database. (K.A.)

  10. Regulatory and technical reports (abstract index journal)

    International Nuclear Information System (INIS)

    1991-06-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  11. Regulatory and technical reports (abstract index journal)

    International Nuclear Information System (INIS)

    1990-05-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  12. Regulatory and technical reports (Abstract Index Journal)

    International Nuclear Information System (INIS)

    1990-03-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, international organization, and licensed facility

  13. CMP 2012: conference of moldavian physicists. Abstracts

    International Nuclear Information System (INIS)

    2012-10-01

    This book includes abstracts on various aspects of: materials processing and characterization, crystal growth methods, solid-state and crystal technology, development of condensed matter theory and modeling of materials properties, solid-state device physics, nano science and nano technology, heterostructures, superlattices, quantum wells and wires, advanced quantum physics for nano systems, etc.

  14. A Brief Introduction to Chinese Biological Abstracts

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Chinese Biological Abstracts sponsored by the Library, the Shanghai Institutes for Biological Sciences, the Biological Documentation and Information Network, all of the Chinese Academy of Sciences, commenced publication in 1987 and was initiated to provide access to the Chinese information in the field of biology.

  15. Sounding Relationships. Conference programme & Book of abstracts

    DEFF Research Database (Denmark)

    2009-01-01

    Content: Welcome to Aalborg.  Inge Nygaard Pedersen: Welcome from the chair of the organizing committee Tony Wigram Wlcome from the chair of the scientific committee Rita Cancino: Welcome from the head of faculty Hanne Mette Ridder: Welcome from the Danish Association of Music Therapists (MTL......) Sounding Relationships General Information Daily Program Social Program List of Participants Scientific Program Book of Abstracts...

  16. Regulatory and technical reports (Abstract Index Journal)

    International Nuclear Information System (INIS)

    1992-11-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors, proceedings of conferences and workshops, grants, and international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  17. NSF-RANN trace contaminants abstracts

    International Nuclear Information System (INIS)

    Copenhaver, E.D.; Harnden, D.S.

    1976-10-01

    Specific areas of interest of the Environmental Aspects of Trace Contaminants Program are organic chemicals of commerce, metals and organometallic compounds, air-borne contaminants, and environmental assay methodology. Fifty-three abstracts of literature on trace contaminants are presented. Author, keyword, and permuted title indexes are included

  18. CMP 2009: conference of moldavian physicists. Abstracts

    International Nuclear Information System (INIS)

    2009-11-01

    This book includes 151 abstracts on various aspects of: materials processing and characterization, crystal growth methods, solid-state and crystal technology, development of condensed matter theory and modeling of materials properties, solid-state device physics, nano science and nano technology, heterostructures, superlattices, quantum wells and wires, advanced quantum physics for nano systems, etc.

  19. Youth Studies Abstracts, Vol. 3 No. 1.

    Science.gov (United States)

    Youth Studies Abstracts, 1984

    1984-01-01

    These abstracts summarize 73 research projects that were conducted in Australia during 1982 and 1983 to investigate various issues related to youth employment and unemployment. Included among the topics addressed in the individual research projects are the following: economic developments, education and rural communities; employment (changing…

  20. A Sound Abstraction of the Parsing Problem

    DEFF Research Database (Denmark)

    Mödersheim, Sebastian Alexander; Katsoris, Georgios

    2014-01-01

    In formal verification, cryptographic messages are often represented by algebraic terms. This abstracts not only from the intricate details of the real cryptography, but also from the details of the non-cryptographic aspects: the actual formatting and structuring of messages. We introduce a new a...

  1. Abstracts of Research, July 1975-June 1976.

    Science.gov (United States)

    Ohio State Univ., Columbus. Computer and Information Science Research Center.

    Abstracts of research papers in computer and information science are given for 62 papers in the areas of information storage and retrieval; computer facilities; information analysis; linguistics analysis; artificial intelligence; information processes in physical, biological, and social systems; mathematical technigues; systems programming;…

  2. Abstracts: NRC Waste Management Program reports

    Energy Technology Data Exchange (ETDEWEB)

    Heckman, R.A.; Minichino, C.

    1979-11-01

    This document consists of abstracts of all reports published by the Nuclear Regulatory Commission (NRC) Waste Management Program at Lawrence Livermore Laboratory (LLL). It will be updated at regular intervals. Reports are arranged in numerical order, within each category. Unless otherwise specified, authors are LLL scientists and engineers.

  3. Regulatory and technical reports (abstract index journal)

    International Nuclear Information System (INIS)

    1992-06-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  4. Regulatory and technical reports (Abstract Index Journal)

    International Nuclear Information System (INIS)

    1993-02-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors, proceedings of conferences and workshops, grants, and international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  5. Development of Abstract Grammatical Categorization in Infants

    Science.gov (United States)

    Cyr, Marilyn; Shi, Rushen

    2013-01-01

    This study examined abstract syntactic categorization in infants, using the case of grammatical gender. Ninety-six French-learning 14-, 17-, 20-, and 30-month-olds completed the study. In a preferential looking procedure infants were tested on their generalized knowledge of grammatical gender involving pseudonouns and gender-marking determiners.…

  6. Regulatory and technical reports (Abstract Index Journal)

    International Nuclear Information System (INIS)

    1991-03-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  7. Regulatory and technical reports (abstract index journal)

    International Nuclear Information System (INIS)

    1993-08-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  8. Abstraction of Dynamical Systems by Timed Automata

    DEFF Research Database (Denmark)

    Wisniewski, Rafael; Sloth, Christoffer

    2011-01-01

    To enable formal verification of a dynamical system, given by a set of differential equations, it is abstracted by a finite state model. This allows for application of methods for model checking. Consequently, it opens the possibility of carrying out the verification of reachability and timing re...

  9. Behavioral technique for workflow abstraction and matching

    NARCIS (Netherlands)

    Klai, K.; Ould Ahmed M'bareck, N.; Tata, S.; Dustdar, S.; Fiadeiro, J.L.; Sheth, A.

    2006-01-01

    This work is in line with the CoopFlow approach dedicated for workflow advertisement, interconnection, and cooperation in virtual organizations. In order to advertise workflows into a registry, we present in this paper a novel method to abstract behaviors of workflows into symbolic observation

  10. Waste management research abstracts No. 17

    International Nuclear Information System (INIS)

    1986-11-01

    The research data sheets contained in this issue have been collected during the period ending August 1986, and reflect research currently in progress in the field of radioactive waste management. This publication covers a wide range of programmes in the IAEA Member States. Abstracts intended for inclusion in this publication were submitted in the English, French, Russian or Spanish language

  11. Abstracts: NRC Waste Management Program reports

    International Nuclear Information System (INIS)

    Heckman, R.A.; Minichino, C.

    1979-11-01

    This document consists of abstracts of all reports published by the Nuclear Regulatory Commission (NRC) Waste Management Program at Lawrence Livermore Laboratory (LLL). It will be updated at regular intervals. Reports are arranged in numerical order, within each category. Unless otherwise specified, authors are LLL scientists and engineers

  12. Regulatory and technical reports (Abstract Index Journal)

    International Nuclear Information System (INIS)

    1993-05-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  13. Regulatory and technical reports (abstract index journal)

    International Nuclear Information System (INIS)

    1994-06-01

    This compilation consists of bibliographic data and abstracts for the formal regulatory and technical reports issued by the US Nuclear Regulatory Commission (NRC) Staff and its contractors. It is NRC's intention to publish this compilation quarterly and to cumulate it annually

  14. Final program and book of abstracts

    International Nuclear Information System (INIS)

    Alfassi, Z.; German, U.; Goldstein, M.; Weinstein, M.

    2004-01-01

    The Israel Nuclear Societies consists of the following individual societies: The Israel Nuclear Society, Israel Society of Radiation Protection, Israel Society of Medical Physics and Israel Society of Nuclear Medicine. The annual meeting book of abstracts contains the full text of the presentations in the scopes of each participating society

  15. Embodied cognition, abstract concepts, and body manipulation

    Directory of Open Access Journals (Sweden)

    Katinka eDijkstra

    2014-08-01

    Full Text Available Current approaches on cognition hold that concrete concepts are grounded in concrete experiences. There is no consensus, however, as to whether this is equally true for abstract concepts. In this review we discuss how the body might be involved in understanding abstract concepts through metaphor activation. Substantial research has been conducted on the activation of common orientational metaphors with bodily manipulations, such as ‘power is up’ and ‘more is up’ representations. We will focus on the political metaphor that has a more complex association between the concept and the concrete domain. However, the outcomes of studies on this political metaphor have not always been consistent, possibly because the experimental manipulation was not implicit enough. The inclusion of new technological devices in this area of research, such as the Wii Balance Board, seems promising in order to assess the groundedness of abstract conceptual spatial metaphors in an implicit manner. This may aid further research to effectively demonstrate the interrelatedness between the body and more abstract representations.

  16. Abstracts, Third Space Processing Symposium, Skylab results

    Science.gov (United States)

    1974-01-01

    Skylab experiments results are reported in abstracts of papers presented at the Third Space Processing Symposium. Specific areas of interest include: exothermic brazing, metals melting, crystals, reinforced composites, glasses, eutectics; physics of the low-g processes; electrophoresis, heat flow, and convection demonstrations flown on Apollo missions; and apparatus for containerless processing, heating, cooling, and containing materials.

  17. Regulatory and technical reports (Abstract Index Journal)

    International Nuclear Information System (INIS)

    1989-11-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  18. Waste management research abstracts No. 18

    International Nuclear Information System (INIS)

    1987-12-01

    The eighteenth issue of this publication contains over 750 abstracts from 33 IAEA member countries comprehending various aspects of radioactive waste management. Radioactive waste disposal, processing and storage, geochemical and geological investigations related to waste management, mathematical models and environmental impacts are reviewed

  19. Normalization by evaluation with typed abstract syntax

    DEFF Research Database (Denmark)

    Danvy, Olivier; Rhiger, Morten; Rose, Kristoffer H.

    2001-01-01

    In higher-order abstract syntax, the variables and bindings of an object language are represented by variables and bindings of a meta-language. Let us consider the simply typed λ-calculus as object language and Haskell as meta-language. For concreteness, we also throw in integers and addition, bu...

  20. Regulatory and technical reports (Abstract index journal)

    International Nuclear Information System (INIS)

    1989-08-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  1. Regulatory and technical reports (Abstract Index Journal)

    International Nuclear Information System (INIS)

    1991-12-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors, proceedings of conferences and workshops, grants, and international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  2. Alemayehu Yismaw Demamu Abstract Ethiopia overhauled its ...

    African Journals Online (AJOL)

    Abstract. Ethiopia overhauled its arbitration laws with the enactment of the Civil Code and .... 2 United Nations Commission on International Trade Law, UNCITRAL Model Law on International Commercial ...... investment agreement between Ethiopia and Great Britain and Northern Ireland under Article 8, Ethiopia and.

  3. Content Abstract Classification Using Naive Bayes

    Science.gov (United States)

    Latif, Syukriyanto; Suwardoyo, Untung; Aldrin Wihelmus Sanadi, Edwin

    2018-03-01

    This study aims to classify abstract content based on the use of the highest number of words in an abstract content of the English language journals. This research uses a system of text mining technology that extracts text data to search information from a set of documents. Abstract content of 120 data downloaded at www.computer.org. Data grouping consists of three categories: DM (Data Mining), ITS (Intelligent Transport System) and MM (Multimedia). Systems built using naive bayes algorithms to classify abstract journals and feature selection processes using term weighting to give weight to each word. Dimensional reduction techniques to reduce the dimensions of word counts rarely appear in each document based on dimensional reduction test parameters of 10% -90% of 5.344 words. The performance of the classification system is tested by using the Confusion Matrix based on comparative test data and test data. The results showed that the best classification results were obtained during the 75% training data test and 25% test data from the total data. Accuracy rates for categories of DM, ITS and MM were 100%, 100%, 86%. respectively with dimension reduction parameters of 30% and the value of learning rate between 0.1-0.5.

  4. Abstract: Implementing Infection Control Measures in Neonatology ...

    African Journals Online (AJOL)

    Abstract. Background Neonatal infection is a primary cause of morbidity and mortality globally. Objective The project's objective is to facilitate quality improvement by reduction of hospital-acquired infection (HAI) in hospitalized neonates. Methods Current infection control practices were surveyed and three main areas were ...

  5. Earth Sciences Division, collected abstracts-1977

    International Nuclear Information System (INIS)

    Quitiquit, W.A.; Ledbetter, G.P.; Henry, A.L.

    1978-01-01

    This report is a compilation of abstracts of papers, internal reports, and talks presented during 1977 at national and international meetings by members of the Earth Sciences Division, Lawrence Livermore Laboratory. It is arranged alphabetically by author and includes a cross-reference by subject indicating the areas of research interest of the Earth Sciences Division

  6. Abstraction of man-made shapes

    KAUST Repository

    Mehra, Ravish; Zhou, Qingnan; Long, Jeremy; Sheffer, Alla; Gooch, Amy Ashurst; Mitra, Niloy J.

    2009-01-01

    Man-made objects are ubiquitous in the real world and in virtual environments. While such objects can be very detailed, capturing every small feature, they are often identified and characterized by a small set of defining curves. Compact, abstracted shape descriptions based on such curves are often visually more appealing than the original models, which can appear to be visually cluttered. We introduce a novel algorithm for abstracting three-dimensional geometric models using characteristic curves or contours as building blocks for the abstraction. Our method robustly handles models with poor connectivity, including the extreme cases of polygon soups, common in models of man-made objects taken from online repositories. In our algorithm, we use a two-step procedure that first approximates the input model using a manifold, closed envelope surface and then extracts from it a hierarchical abstraction curve network along with suitable normal information. The constructed curve networks form a compact, yet powerful, representation for the input shapes, retaining their key shape characteristics while discarding minor details and irregularities. © 2009 ACM.

  7. Regulatory and technical reports (abstract index journal)

    International Nuclear Information System (INIS)

    1991-11-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  8. Regulatory and technical reports (Abstract Index Journal)

    International Nuclear Information System (INIS)

    1989-07-01

    This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility

  9. Using Group Explorer in Teaching Abstract Algebra

    Science.gov (United States)

    Schubert, Claus; Gfeller, Mary; Donohue, Christopher

    2013-01-01

    This study explores the use of Group Explorer in an undergraduate mathematics course in abstract algebra. The visual nature of Group Explorer in representing concepts in group theory is an attractive incentive to use this software in the classroom. However, little is known about students' perceptions on this technology in learning concepts in…

  10. Retributivist Arguments against Presuming Innocence : Answering to Duff

    NARCIS (Netherlands)

    van Dijk, A.A.

    2013-01-01

    Factors justifying not presuming innocence are generally incorporated into the Presumption of Innocence (PoI). A confusing discourse has resulted: numerous guilt-presuming acts are deemed consistent with the PoI. I argue for an unusually broad PoI: any act that might convey to a reasonable actor

  11. Fuel: Logs, sticks, needles, duff, and much more

    Science.gov (United States)

    Russell T. Graham; Theresa Benevidez Jain; Alan E. Harvey

    2000-01-01

    Fuels burned by either prescribed or wildfires are complex and important components of forested ecosystems. Fine fuels consisting of fallen limbs, twigs, and leaves of shrubs and trees are rich in nutrients. If these fuels are not immediately burned, nutrients can leach from these materials into the forest floor, especially if they overwinter. Larger fuels consisting...

  12. Abstraction of Drift-Scale Coupled Processes

    International Nuclear Information System (INIS)

    Francis, N.D.; Sassani, D.

    2000-01-01

    This Analysis/Model Report (AMR) describes an abstraction, for the performance assessment total system model, of the near-field host rock water chemistry and gas-phase composition. It also provides an abstracted process model analysis of potentially important differences in the thermal hydrologic (TH) variables used to describe the performance of a geologic repository obtained from models that include fully coupled reactive transport with thermal hydrology and those that include thermal hydrology alone. Specifically, the motivation of the process-level model comparison between fully coupled thermal-hydrologic-chemical (THC) and thermal-hydrologic-only (TH-only) is to provide the necessary justification as to why the in-drift thermodynamic environment and the near-field host rock percolation flux, the essential TH variables used to describe the performance of a geologic repository, can be obtained using a TH-only model and applied directly into a TSPA abstraction without recourse to a fully coupled reactive transport model. Abstraction as used in the context of this AMR refers to an extraction of essential data or information from the process-level model. The abstraction analysis reproduces and bounds the results of the underlying detailed process-level model. The primary purpose of this AMR is to abstract the results of the fully-coupled, THC model (CRWMS M andO 2000a) for effects on water and gas-phase composition adjacent to the drift wall (in the near-field host rock). It is assumed that drift wall fracture water and gas compositions may enter the emplacement drift before, during, and after the heating period. The heating period includes both the preclosure, in which the repository drifts are ventilated, and the postclosure periods, with backfill and drip shield emplacement at the time of repository closure. Although the preclosure period (50 years) is included in the process models, the postclosure performance assessment starts at the end of this initial period

  13. Science Day 2005 Poster Abstracts: Nuclear Physics

    International Nuclear Information System (INIS)

    Kline, K.M.

    2005-01-01

    Abstracts for 11 posters are presented from the Nuclear Physics section. Titles and authors of the posters/abstracts are as follows: 'Fusion and fission: converting mass to energy' by Jeffery Latkowski, 'Studies of inertial confinement fusion targets wtih HYDRA' by Marty Marinak, 'Prospects for demonstrating ignition on the National Ignition Facility in 2010 with noncryogenic double-shell targets' by Peter Amendt, 'Exploring the fast-ignition approach to fusion energy' by Richard Town, 'Simulating the National Ignition Facility with arbitrary Langrangian Eulerian methods and adaptive grids' by Alice Koniges, 'New energy sources: extracting energy from radioisotope materials' by Jeff Morse, 'Production of superheavy elements' by Ken Moody and Josh Patten, 'Nuclear physics from scratch: ab initio description of nuclei with effective interaction' by Eric Ormand, 'Finding fission with scintillator and a stopwatch: statistical theory of fission chains' by Neal Snyderman, 'Mass to energy: how Einstein's equation is helping homeland security' by Jason Pruet, and 'Nuclear Car Wash' by Dennis Slaughter

  14. Abstraction Mechanisms in the BETA Programming Language

    DEFF Research Database (Denmark)

    Kristensen, Bent Bruun; Madsen, Ole Lehrmann; Møller-Pedersen, Birger

    1983-01-01

    . It is then necessary that the abstraction mechanisms are powerful in order to define more specialized constructs. BETA is an object oriented language like SIMULA 67 ([SIMULA]) and SMALLTALK ([SMALLTALK]). By this is meant that a construct like the SIMULA class/subclass mechanism is fundamental in BETA. In contrast......]) --- covering both data, procedural and control abstractions, substituting constructs like class, procedure, function and type. Correspondingly objects, procedure activation records and variables are all regarded as special cases of the basic building block of program executions: the entity. A pattern thus......The BETA programming language is developed as part of the BETA project. The purpose of this project is to develop concepts, constructs and tools in the field of programming and programming languages. BETA has been developed from 1975 on and the various stages of the language are documented in [BETA...

  15. Health physics research abstracts no. 11

    International Nuclear Information System (INIS)

    1984-07-01

    The present issue No. 11 of Health Physics Research Abstracts is the continuation of a series of Bulletins published by the Agency since 1967. They collect reports from Member States on Health Physics research in progress or just completed. The main aim in issuing such reports is to draw attention to work that is about to be published and to enable interested scientists to obtain further information through direct correspondence with the investigators. The attention of users of this publication is drawn to the fact that abstracts of published documents on Health Physics are published eventually in INIS Atomindex, which is one of the output products of the Agency's International Nuclear Information System. The present issue contains 235 reports received up to December 1983 from the following Member States. In parentheses the country's ISO code and number of reports are given

  16. Old Romanian pluralized mass and abstract nouns

    Directory of Open Access Journals (Sweden)

    Gabriela Pană Dindelegan

    2017-09-01

    Full Text Available The analysis of a rich old Romanian corpus shows that the ‘pluralization’ of mass and abstract nouns is extremely frequent in old Romanian. The semantic effects of pluralization are similar for mass and abstract nouns, consisting in the creation of denotative and/or connotative semantic variants. Of the plural endings, –uri is specialized for the pluralization of mass nouns in Daco-Romanian. The evolution of the ending –uri illustrates the specific process by which a grammatical (plural morpheme is converted into a lexical morpheme (the so-called ‘lexical plurals’. ‘Lexical plurals’ have isolated occurrences in other Romance languages, but they have not reached the spread and regularity they display in Romanian.

  17. Abstract Level Parallelization of Finite Difference Methods

    Directory of Open Access Journals (Sweden)

    Edwin Vollebregt

    1997-01-01

    Full Text Available A formalism is proposed for describing finite difference calculations in an abstract way. The formalism consists of index sets and stencils, for characterizing the structure of sets of data items and interactions between data items (“neighbouring relations”. The formalism provides a means for lifting programming to a more abstract level. This simplifies the tasks of performance analysis and verification of correctness, and opens the way for automaticcode generation. The notation is particularly useful in parallelization, for the systematic construction of parallel programs in a process/channel programming paradigm (e.g., message passing. This is important because message passing, unfortunately, still is the only approach that leads to acceptable performance for many more unstructured or irregular problems on parallel computers that have non-uniform memory access times. It will be shown that the use of index sets and stencils greatly simplifies the determination of which data must be exchanged between different computing processes.

  18. Effect of Groundwater Abstraction on Fen Ecosystems

    DEFF Research Database (Denmark)

    Johansen, Ole; Pedersen, Morten Lauge; Jensen, Jacob Birk

    2011-01-01

    within a distance of 1.5 km to a planned well field. In the river valley the interaction between groundwater and surface water is strongly affected by low permeable sediments. These sediments reduce the direct discharge to the river and have a large impact on the functioning and presence of the rich fen......Quantifying the effects of groundwater abstraction on fen ecosystems located in discharge areas can be complicated. The water level in fens is close to the terrain surface most of the year and it is controlled by a relatively constant groundwater exfiltration. It is difficult to measure...... the exfiltration fluxes and thus water level data is typically used to evaluate if the ecosystem is affected. The paper presents collected data and analysis from a case study, where the hydrological effect of groundwater abstraction on rich fens and springs in a Danish river valley has been studied. The natural...

  19. FFCAct Clearinghouse, Directory of abstracts. Revision 1

    International Nuclear Information System (INIS)

    Harwood, T.

    1994-05-01

    The Federal Facility Compliance Act (FFCAct) Clearinghouse is a card catalog of information about the FFCAct and its requirements for developing Site Treatment Plans (STP). The information available in the clearinghouse includes abstracts describing computer applications, technical reports, and a list of technical experts. Information can be accessed for use in responding to FFCAct requirements, and the clearinghouse provides search capabilities on particular topics and issues related to STP development. Appendix A includes: contacts from each site, for which contact has been made, who are developing STPs; the FFCAct Clearinghouse Fact Sheet and; additional hard copy forms to be used to populate the database. This report contains 50 abstracts related to the Radioactive Waste Technical Support Program

  20. ILL2020 Vision - Posters and Abstracts

    International Nuclear Information System (INIS)

    Baker, M.L.; Bocian, A.; Bousige, C.; Cermak, P.; Cooper, J.F.K.; Cronenberg, G.; Ford, S.; Hennig, M.; Jones, A.O.F.; Knoll, W.; Leung, K.; Mourigal, M.; Sigrist, M.S.; Trapp, M.; Wang, Weiwei; Martinez Pena, J.L.; Ruegg, C.; Bramwell, S.; Klotz, S.; Fragneto, G.; Fouquet, P.; Nesvizhevsky, V.V.; Harrison, A.; Andersen, K.; Lelievre-Berna, E.; Schober, H.; Enderle, M.; Jobic, H.; Wilson, C.C.; Teschner, D.; Bourges, P.; Braden, M.; McMorrow, D.; Snogerup Linse, S.; Podjarny, A.; Richardson, J.; Schurtenberger, P.; Farago, B.; Pfrang, C.; Simpson, G.; Plonka-Spehr, C.; Nuttall, W.J.; Chapon, L.C.; Koza, M.M.; Withers, P.J.; Zabel, H.; Lyonnard, S.; Morineau, D.; Salmon, P.S.; Johnson, M.; Forsyth, T.; Wagner, R.

    2011-01-01

    The aim of the Millennium Programme is to maintain and develop the ILL's instrument suite as the world reference, as well as to upgrade our support facilities and basic neutron technologies so that they continue to satisfy changing demands from the user community. This document gathers the abstracts of the poster session and the paper abstracts. The posters present the latest achievements in the application of neutrons diffraction for instance to the dynamics of molecules or the study of magnetism. The topics of the papers is more about the need for new equipment than about research topics. The proposals for new or upgraded equipment includes neutron spin-echo spectrometers, multimodal diffractometers, time-of-flight spectrometers, small angle neutron spectrometers, and high magnetic field devices for spectroscopy

  1. Earth Sciences Division, collected abstracts, 1978

    International Nuclear Information System (INIS)

    Taasevigen, D.K.; Henry, A.L.; Madsen, S.K.

    1979-01-01

    Abstracts of papers, internal reports, and talks presented during 1978 at national and international meetings by members of the Earth Sciences Division of the Lawrence Livermore Laboratory are compiled. The arrangement is alphabetical (by author). For any given report, a bibliographic reference appears under the name of each coauthor. A topical index at the end provides useful cross references, while indicating major areas of research interest in the Earth Sciences Division

  2. Poster Abstract: Towards NILM for Industrial Settings

    DEFF Research Database (Denmark)

    Holmegaard, Emil; Kjærgaard, Mikkel Baun

    2015-01-01

    Industry consumes a large share of the worldwide electricity consumption. Disaggregated information about electricity consumption enables better decision-making and feedback tools to optimize electricity consumption. In industrial settings electricity loads consist of a variety of equipment, whic...... consumption for six months, at an industrial site. In this poster abstract we provide initial results for how industrial equipment challenge NILM algorithms. These results thereby open up for evaluating the use of NILM in industrial settings....

  3. Book of abstracts. Invited and contributed papers

    International Nuclear Information System (INIS)

    1995-01-01

    The book is a collection of abstracts submitted to the International Nuclear Physics Conference held on August 21-26, 1995 in Beijing, China. The conference is organized by China Institute of Atomic Energy. The main topics of the conference are: relativistic nuclear collisions, mesons and baryons in nuclei, hadron structure and quarks in nuclei, formation and properties of hot nuclei, nuclear reactions at low and intermediate energies, nuclear structure, radioactive nuclear beams, nuclear astrophysics, fundamental interaction and symmetries, applied nuclear physics

  4. Squeezed States and Uncertainty Relations. Abstracts

    International Nuclear Information System (INIS)

    Masahito, Hayashi; Reynaud, S.; Jaekel, M.Th.; Fiuraaek, J.; Garcia-Patron, R.; Cerf, N.J.; Hage, B.; Chelkowski, S.; Franzen, A.; Lastzka, N.; Vahlbruch, N.; Danzmann, K.; Schnabel, R.; Hassan, S.S.; Joshi, A.; Jakob, M.; Bergou, J.A.; Kozlovskii, A.V.; Prakash, H.; Kumar, R.

    2005-01-01

    The purpose of the conference was to bring together people working in the field of quantum optics, with special emphasis on non-classical light sources and related areas, quantum computing, statistical mechanics and mathematical physics. As a novelty, this edition will include the topics of quantum imaging, quantum phase noise and number theory in quantum mechanics. This document gives the program of the conference and gathers the abstracts

  5. Video Abstracting at a Semantical Level

    OpenAIRE

    von Wenzlawowicz, Till

    2018-01-01

    One the most common form of a video abstract is the movie trailer. Contemporary movie trailers share a common structure across genres which allows for an automatic generation and also reflects the corresponding moviea s composition. In this thesis a system for the automatic generation of trailers is presented. In addition to action trailers, the system is able to deal with further genres such as Horror and comedy trailers, which were first manually analyzed in order to identify their basic st...

  6. Waste management research abstracts no. 21

    International Nuclear Information System (INIS)

    1992-12-01

    The 21th issue of this publication contains over 700 abstracts from 35 IAEA Member Countries comprehending various aspects of radioactive waste management. Radioactive waste disposal, processing and storage, geochemical and geological investigations related to waste management, mathematical models and environmental impacts are reviewed. Many programs involve cooperation among several countries and further international cooperation is expected to be promoted through availability of compiled information on research programs, institutions and scientists engaged in waste management

  7. Waste management research abstracts. No. 20

    International Nuclear Information System (INIS)

    1990-10-01

    The 20th issue of this publication contains over 700 abstracts from 32 IAEA Member Countries comprehending various aspects of radioactive waste management. Radioactive waste disposal, processing and storage, geochemical and geological investigations related to waste management, mathematical models and environmental impacts are reviewed. Many programs involve cooperation among several countries and further international cooperation is expected to be promoted through availability of compiled information on research programs, institutions and scientists engaged in waste management

  8. Exoplanet Observing: from Art to Science (Abstract)

    Science.gov (United States)

    Conti, D. M.; Gleeson, J.

    2017-12-01

    (Abstract only) This paper will review the now well-established best practices for conducting high precision exoplanet observing with small telescopes. The paper will also review the AAVSO's activities in promoting these best practices among the amateur astronomer community through training material and online courses, as well as through the establishment of an AAVSO Exoplanet Database. This latter development will be an essential element in supporting followup exoplanet observations for upcoming space telescope missions such as TESS and JWST.

  9. EIA data index: an abstract journal

    International Nuclear Information System (INIS)

    1980-12-01

    The individual tables, graphs, and formatted data presented in the statistical publications of the Energy Information Administration (EIA) are abstracted and indexed. Included are a complete subject index and a report number listing for all EIA publications as well as complete ordering information for these publications. The abstracts of the tables and graphs are arranged by broad subject categories (e.g., coal, petroleum, natural gas, energy analysis and modeling) with further division occurring by subcategories (e.g., reserves, drilling and production, processing). Included here are those publications and their statistical contents which were released by the EIA from its formation in October 1977 through approximately the first half of 1980. Updates will be on a semiannual basis. The EIA Data Index is a companion volume to the EIA Publications Directory: A User's Guide (DOE/EIA-0149), which provides abstracts and indexes to all EIA publications at the document level. Both of these publications are generated from the Federal Energy Data Index (FEDEX) data base which has been developed by the EIA in cooperation with the Technical Information Center of the US Department of Energy

  10. The abstract representations in speech processing.

    Science.gov (United States)

    Cutler, Anne

    2008-11-01

    Speech processing by human listeners derives meaning from acoustic input via intermediate steps involving abstract representations of what has been heard. Recent results from several lines of research are here brought together to shed light on the nature and role of these representations. In spoken-word recognition, representations of phonological form and of conceptual content are dissociable. This follows from the independence of patterns of priming for a word's form and its meaning. The nature of the phonological-form representations is determined not only by acoustic-phonetic input but also by other sources of information, including metalinguistic knowledge. This follows from evidence that listeners can store two forms as different without showing any evidence of being able to detect the difference in question when they listen to speech. The lexical representations are in turn separate from prelexical representations, which are also abstract in nature. This follows from evidence that perceptual learning about speaker-specific phoneme realization, induced on the basis of a few words, generalizes across the whole lexicon to inform the recognition of all words containing the same phoneme. The efficiency of human speech processing has its basis in the rapid execution of operations over abstract representations.

  11. SATURATED ZONE FLOW AND TRANSPORT MODEL ABSTRACTION

    International Nuclear Information System (INIS)

    B.W. ARNOLD

    2004-01-01

    The purpose of the saturated zone (SZ) flow and transport model abstraction task is to provide radionuclide-transport simulation results for use in the total system performance assessment (TSPA) for license application (LA) calculations. This task includes assessment of uncertainty in parameters that pertain to both groundwater flow and radionuclide transport in the models used for this purpose. This model report documents the following: (1) The SZ transport abstraction model, which consists of a set of radionuclide breakthrough curves at the accessible environment for use in the TSPA-LA simulations of radionuclide releases into the biosphere. These radionuclide breakthrough curves contain information on radionuclide-transport times through the SZ. (2) The SZ one-dimensional (I-D) transport model, which is incorporated in the TSPA-LA model to simulate the transport, decay, and ingrowth of radionuclide decay chains in the SZ. (3) The analysis of uncertainty in groundwater-flow and radionuclide-transport input parameters for the SZ transport abstraction model and the SZ 1-D transport model. (4) The analysis of the background concentration of alpha-emitting species in the groundwater of the SZ

  12. Ad Oculos. Images, Imagination and Abstract Thinking

    Directory of Open Access Journals (Sweden)

    Alessandra Cirafici

    2018-03-01

    Full Text Available The unusual edition of Elements of Euclid released for publishing in 1847 by Oliver Byrne offers the occasion to suggest a few elements for discussion on the uniqueness of the ‘representation’ of geometric-mathematical thinking—and more in general of the abstract thinking—enshrined in its ‘nature of a pure imaginative vision able to connect the intelligible with the tangible’. The purpose is, thus, a reasoning on images and communicative artefacts, that, when articulated, provide different variations of the idea of ‘transcription’ of complex theoretical structures from one language (that of abstract logic to another (that of sensory experience, with a view to facilitate, ease and make more accurate the noetic process. Images able over time to facilitate the understanding of complex and abstract theoretical principles—since able to show them in an extremely concrete way, ad oculos,—and which at some points could reveal the horizons of art interpretation to inscrutable and figurative meaningless formulas.

  13. Constraint-Based Abstract Semantics for Temporal Logic

    DEFF Research Database (Denmark)

    Banda, Gourinath; Gallagher, John Patrick

    2010-01-01

    Abstract interpretation provides a practical approach to verifying properties of infinite-state systems. We apply the framework of abstract interpretation to derive an abstract semantic function for the modal mu-calculus, which is the basis for abstract model checking. The abstract semantic funct...

  14. New Features in the ADS Abstract Service

    Science.gov (United States)

    Eichhorn, G.; Accomazzi, A.; Grant, C. S.; Kurtz, M. J.; ReyBacaicoa, V.; Murray, S. S.

    2001-11-01

    The ADS Abstract Service contains over 2.3 million references in four databases: Astronomy/Astrophysics/Planetary Sciences, Instrumentation, Physics/Geophysics, and Preprints. We provide abstracts and articles free to the astronomical community for all major and many smaller astronomy journals, PhD theses, conference proceedings, and technical reports. These four databases can be queried either separately of jointly. The ADS also has scanned 1.3 million pages in 180,000 articles in the ADS Article Service. This literature archive contains all major Astronomy journals and many smaller journals, as well as conference proceedings, including the abstract books from all the LPSCs back to volume 2. A new feature gives our users the ability to see list of articles that were also read by the readers of a given article. This is a powerful tool to find out what current articles are relevant in a particular field of study. We have recently expanded the citation and reference query capabilities. It allows our users to select papers for which they want to see references or citations and then retrieve these citations/references. Another new capability is the ability to sort a list of articles by their citation count. As usual, users should be reminded that the citations in ADS are incomplete because we do not obtain reference lists from all publishers. In addition, we cannot match all references (e.g. in press, private communications, author errors, some conference papers, etc.). Anyone using the citations for analysis of publishing records should keep this in mind. More work on expanding the citation and reference features is planned over the next year. ADS Home Page http://ads.harvard.edu/

  15. National fuel cell seminar. Program and abstracts. [Abstracts of 40 papers

    Energy Technology Data Exchange (ETDEWEB)

    None

    1977-01-01

    Abstracts of 40 papers are presented. Topics include fuel cell systems, phosphoric acid fuel cells, molten carbonate fuel cells, solid fuel and solid electrolyte fuel cells, low temperature fuel cells, and fuel utilization. (WHK)

  16. The eighth national electromagnetics meeting. Extended abstracts

    International Nuclear Information System (INIS)

    Eloranta, E.; Jokela, K.

    1998-01-01

    The National Electromagnetics Meeting has been arranged annually since 1991 in Finland. The purpose of the meeting is to convene the persons working with problems of electromagnetics and to enhance the interaction between different research groups in different disciplines. The eighth meeting was held at the Radiation and Nuclear Safety Authority (STUK) August 27, 1998. The meeting is also the national meeting of the URSI (L'Union Radio-Scientifique Internationals)(Commission B: Fields and Waves) and the IEEE MTT/AP/ED Finland Chapter (Institute of Electrical and Electronics Engineers, Inc.). The report includes the extended abstracts of the presentations given in the National Electromagnetics Meeting at STUK. (orig.)

  17. 1. National Congress of Environmental Science: Abstracts

    International Nuclear Information System (INIS)

    1995-01-01

    The First National Congress of Environmental Sciences had a plural participation in the environmental thematic. The public universities and the research institutes of the different states of Mexico submitted papers containing proposals of scientific and technological solutions to the problems of management of hazardous wastes: water and land pollution; new methods of evaluation to pollutants of air and water; protection and conservation of relevant species of the ecology; control of genetic alterations; development and conservation of natural resources, and environmental education. Another part of the abstracts is dedicated to the posters session (Author)

  18. Health physics research abstracts No. 13

    International Nuclear Information System (INIS)

    1987-05-01

    No. 13 of Health Physics Research Abstracts is the continuation of a series of bulletins published by the IAEA since 1967 and which collect reports from Member States on health physics research in progress or just completed. The present issue contains 370 reports received up to March 1987 and covers the following topics: Personnel monitoring, dosimetry, assessment of dose to man, operational radiation protection techniques, radiation levels, effects of radiation, environmental studies, pathways and monitoring, analysis and evaluation of radiation hazards resulting from the operation of nuclear facilities, radiation accidents and emergency preparedness, epidemiology of radiation damage, optimization of radiation protection, research programmes and projects

  19. Static analysis of software the abstract interpretation

    CERN Document Server

    Boulanger, Jean-Louis

    2013-01-01

    The existing literature currently available to students and researchers is very general, covering only the formal techniques of static analysis. This book presents real examples of the formal techniques called ""abstract interpretation"" currently being used in various industrial fields: railway, aeronautics, space, automotive, etc. The purpose of this book is to present students and researchers, in a single book, with the wealth of experience of people who are intrinsically involved in the realization and evaluation of software-based safety critical systems. As the authors are people curr

  20. I. Central Europe Symposium of Radiographers. Abstracts

    International Nuclear Information System (INIS)

    1996-08-01

    The publication contains abstracts of 20 contributions, out of which 2 have been inputted in INIS. One describes computed tomography methods employed by the Faculty Hospital in Hradec Kralove for liver angiography by using a contrast medium and for locating small hypervascular pancreatic islet-cell tumors. The other contribution informs about the use of linear accelerators and an afterloading system by the Faculty Hospital in Ceske Budejovice for radiotherapy of tumors of mammary glands, lymphatic nodes, the cervix, and of metastases. (M.D.)

  1. China nuclear science and technology report. Abstracts

    International Nuclear Information System (INIS)

    1994-01-01

    The bibliographies and abstracts of China Nuclear Science and Technology Reports published in 1993 (Report Numbers CNIC-00675∼CNIC-00800) are presented. The items are arranged according to INIS subject categories, which mainly are physical sciences, chemistry, materials, earth sciences, life sciences, isotopes, isotope and radiation applications, engineering and technology, and other aspects of nuclear energy. The numbers on the left corners of the entries are report numbers, and on the right corners the serial numbers. A report number index is annexed

  2. Thirteen international workshop on nuclear theory. Abstracts

    International Nuclear Information System (INIS)

    1994-01-01

    This brochure contains the abstracts of reports delivered by 40 participants at the 13. International Workshop on Nuclear Theory organized by the Nuclear Theory Group in the Institute for Nuclear research and Nuclear Energy of the Bulgarian academy of Sciences. The main topics treated in the lectures were nucleon correlation effects in nuclei, collective nuclear motions, Wigner quantum systems, pre-equilibrium neutron and photon emission from nuclei, particle-nuclei collision processes at high energies, few-body states, optical potential for neutron-nucleus scattering, relativistic generator coordinate calculations and variational nuclear structure calculations. All reports are included in INIS separately

  3. The eighth national electromagnetics meeting. Extended abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Eloranta, E.; Jokela, K. [eds.

    1998-09-01

    The National Electromagnetics Meeting has been arranged annually since 1991 in Finland. The purpose of the meeting is to convene the persons working with problems of electromagnetics and to enhance the interaction between different research groups in different disciplines. The eighth meeting was held at the Radiation and Nuclear Safety Authority (STUK) August 27, 1998. The meeting is also the national meeting of the URSI (L`Union Radio-Scientifique Internationals)(Commission B: Fields and Waves) and the IEEE MTT/AP/ED Finland Chapter (Institute of Electrical and Electronics Engineers, Inc.). The report includes the extended abstracts of the presentations given in the National Electromagnetics Meeting at STUK. (orig.)

  4. 13th Radiochemical Conference. Booklet of Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-04-01

    The Conference included the following sessions: (i) Opening plenary presentations (6 contributions); (ii) Chemistry of natural radionuclides, discovery of radium and polonium (6 verbal presentations + 5 poster presentations); (iii) Radionuclides in the environment, radioecology (29 + 48); (iv) Activation analysis and other radioanalytical methods (36 + 49); (v) Ionizing radiation in science and technology (12 + 12); (vi) Chemistry of actinide and trans-actinide elements (11 + 14); (vii) Separation methods, speciation (18 + 41); (viii) Production and application of radionuclides (14 + 29); and (ix) Radiochemical problems in nuclear waste management (12 + 22). The majority of verbal presentations has been input to INIS, mostly in the form of the full authors` abstracts. (P.A.)

  5. 13th Radiochemical Conference. Booklet of Abstracts

    International Nuclear Information System (INIS)

    1998-04-01

    The Conference included the following sessions: (i) Opening plenary presentations (6 contributions); (ii) Chemistry of natural radionuclides, discovery of radium and polonium (6 verbal presentations + 5 poster presentations); (iii) Radionuclides in the environment, radioecology (29 + 48); (iv) Activation analysis and other radioanalytical methods (36 + 49); (v) Ionizing radiation in science and technology (12 + 12); (vi) Chemistry of actinide and trans-actinide elements (11 + 14); (vii) Separation methods, speciation (18 + 41); (viii) Production and application of radionuclides (14 + 29); and (ix) Radiochemical problems in nuclear waste management (12 + 22). The majority of verbal presentations has been input to INIS, mostly in the form of the full authors' abstracts. (P.A.)

  6. An Abstract Model of Historical Processes

    Directory of Open Access Journals (Sweden)

    Michael Poulshock

    2017-06-01

    Full Text Available A theoretical model is presented which provides a way to simulate, at a very abstract level, power struggles in the social world. In the model, agents can benefit or harm each other, to varying degrees and with differing levels of influence. The agents interact over time, using the power they have to try to get more of it, while being constrained in their strategic choices by social inertia. The outcomes of the model are probabilistic. More research is needed to determine whether the model has any empirical validity.

  7. Introduction to the theory of abstract algebras

    CERN Document Server

    Pierce, Richard S

    2014-01-01

    Intended for beginning graduate-level courses, this text introduces various aspects of the theory of abstract algebra. The book is also suitable as independent reading for interested students at that level as well as a primary source for a one-semester course that an instructor may supplement to expand to a full year. Author Richard S. Pierce, a Professor of Mathematics at Seattle's University of Washington, places considerable emphasis on applications of the theory and focuses particularly on lattice theory.After a preliminary review of set theory, the treatment presents the basic definitions

  8. On implicit abstract neutral nonlinear differential equations

    Energy Technology Data Exchange (ETDEWEB)

    Hernández, Eduardo, E-mail: lalohm@ffclrp.usp.br [Universidade de São Paulo, Departamento de Computação e Matemática, Faculdade de Filosofia Ciências e Letras de Ribeirão Preto (Brazil); O’Regan, Donal, E-mail: donal.oregan@nuigalway.ie [National University of Ireland, School of Mathematics, Statistics and Applied Mathematics (Ireland)

    2016-04-15

    In this paper we continue our developments in Hernández and O’Regan (J Funct Anal 261:3457–3481, 2011) on the existence of solutions for abstract neutral differential equations. In particular we extend the results in Hernández and O’Regan (J Funct Anal 261:3457–3481, 2011) for the case of implicit nonlinear neutral equations and we focus on applications to partial “nonlinear” neutral differential equations. Some applications involving partial neutral differential equations are presented.

  9. Meetings on Particle Physics - Abstracts and Slides

    International Nuclear Information System (INIS)

    Hirsch, M.; Machado, P.; Bertuzzo, E.; Villanova del Moral, A.; Wingerter, A.; Lellouch, L.; Garron, N.; Portelli, A.; Vulvert, G.; Zerwas, D.; Djouadi, A.; Drieu la Rochelle, G.; Fairbairn, M.; Le Boulc'h, Q.; Dumont, B.; Da Silva, J.; Brax, P.; Weiland, C.; Gelis, F.; Mehtar-Tani, Y.; Epelbaum, T.; Meunier, E.; Dudas, E.; Jezo, T.; Urbano, A.; Smith, C.; Machet, B.; Nezri, E.; Salam, G.; Kosnik, N.; Greynat, D.; Petrov, K.

    2014-01-01

    RPP (Meetings on Particle Physics) annual meetings are aimed at gathering the theoretical particle physicists' community, providing the participants with the opportunity not only to present their research topics, but also to make contact with the latest developments in adjacent fields. RPP-2012 will have a few review talks on topics such as flavors, Higgs bosons, astro-particle physics and cosmology, heavy ions, physics beyond the standard model, and quantum chromodynamics. This document gathers the slides of the presentations, a few presentations are accompanied by an abstract.

  10. Book of abstracts. Invited and contributed papers

    International Nuclear Information System (INIS)

    1995-01-01

    The book is a collection of abstracts submitted to the International Nuclear Physics Conference held in August 21-26 1995 in Beijing, China. The conference is organized by China Institute of Atomic Energy. The main topics of the conference are: relativistic nuclear collisions, mesons and baryons in nuclei, hadron structure and quarks in nuclei, formation and properties of hot nuclei, nuclear reactions at low and intermediate energies, nuclear structure, radioactive nuclear beams, nuclear astrophysics, fundamental interaction and symmetries, applied nuclear physics. This second part contains papers about nuclear reactions at low and intermediate energies, nuclear structure, radioactive nuclear beams, nuclear astrophysics, fundamental interaction and symmetries, applied nuclear physics, and the author index

  11. Exponentially Convergent Algorithms for Abstract Differential Equations

    CERN Document Server

    Gavrilyuk, Ivan; Vasylyk, Vitalii

    2011-01-01

    This book presents new accurate and efficient exponentially convergent methods for abstract differential equations with unbounded operator coefficients in Banach space. These methods are highly relevant for the practical scientific computing since the equations under consideration can be seen as the meta-models of systems of ordinary differential equations (ODE) as well as the partial differential equations (PDEs) describing various applied problems. The framework of functional analysis allows one to obtain very general but at the same time transparent algorithms and mathematical results which

  12. Health physics research abstracts No. 12

    International Nuclear Information System (INIS)

    1985-11-01

    The No. 12 of Health Physics Research Abstracts is the continuation of a series of Bulletins published by the IAEA since 1967 and which collect reports from Member States on Health Physics research in progress or just completed. The present issue contains 386 reports received up to December 1984 and covering the following topics: personnel monitoring, dosimetry, assessment of dose to man, operational radiation protection techniques, biological effects of radiations, environmental studies, pathways and monitoring, radiation hazards resulting from the operation of nuclear facilities, radiation accidents and emergency plans, epidemiology of radiation damage, optimization of radiation protection, research programs and projects

  13. China nuclear science and technology report. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-01-01

    The bibliographies and abstracts of China Nuclear Science and Technology Reports published in 1993 (Report Numbers CNIC-00675{approx}CNIC-00800) are presented. The items are arranged according to INIS subject categories, which mainly are physical sciences, chemistry, materials, earth sciences, life sciences, isotopes, isotope and radiation applications, engineering and technology, and other aspects of nuclear energy. The numbers on the left corners of the entries are report numbers, and on the right corners the serial numbers. A report number index is annexed.

  14. I. Central Europe Symposium of Radiographers. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-01

    The publication contains abstracts of 20 contributions, out of which 2 have been inputted in INIS. One describes computed tomography methods employed by the Faculty Hospital in Hradec Kralove for liver angiography by using a contrast medium and for locating small hypervascular pancreatic islet-cell tumors. The other contribution informs about the use of linear accelerators and an afterloading system by the Faculty Hospital in Ceske Budejovice for radiotherapy of tumors of mammary glands, lymphatic nodes, the cervix, and of metastases. (M.D.).

  15. DSNF AND OTHER WASTE FORM DEGRADATION ABSTRACTION

    International Nuclear Information System (INIS)

    Thornton, T.A.

    2000-01-01

    The purpose of this analysis/model report (AMR) is to select and/or abstract conservative degradation models for DOE-(US. Department of Energy) owned spent nuclear fuel (DSNF) and the immobilized ceramic plutonium (Pu) disposition waste forms for application in the proposed monitored geologic repository (MGR) postclosure Total System Performance Assessment (TSPA). Application of the degradation models abstracted herein for purposes other than TSPA should take into consideration the fact that they are, in general, very conservative. Using these models, the forward reaction rate for the mobilization of radionuclides, as solutes or colloids, away from the waste fondwater interface by contact with repository groundwater can then be calculated. This forward reaction rate generally consists of the dissolution reaction at the surface of spent nuclear fuel (SNF) in contact with water, but the degradation models, in some cases, may also include and account for the physical disintegration of the SNF matrix. The models do not, however, account for retardation, precipitation, or inhibition of the migration of the mobilized radionuclides in the engineered barrier system (EBS). These models are based on the assumption that all components of the DSNF waste form are released congruently with the degradation of the matrix

  16. DSNF and other waste form degradation abstraction

    Energy Technology Data Exchange (ETDEWEB)

    Thornton, Thomas A.

    2000-12-20

    The purpose of this analysis/model report (AMR) is to select and/or abstract conservative degradation models for DOE-(US. Department of Energy) owned spent nuclear fuel (DSNF) and the immobilized ceramic plutonium (Pu) disposition waste forms for application in the proposed monitored geologic repository (MGR) postclosure Total System Performance Assessment (TSPA). Application of the degradation models abstracted herein for purposes other than TSPA should take into consideration the fact that they are, in general, very conservative. Using these models, the forward reaction rate for the mobilization of radionuclides, as solutes or colloids, away from the waste fondwater interface by contact with repository groundwater can then be calculated. This forward reaction rate generally consists of the dissolution reaction at the surface of spent nuclear fuel (SNF) in contact with water, but the degradation models, in some cases, may also include and account for the physical disintegration of the SNF matrix. The models do not, however, account for retardation, precipitation, or inhibition of the migration of the mobilized radionuclides in the engineered barrier system (EBS). These models are based on the assumption that all components of the DSNF waste form are released congruently with the degradation of the matrix.

  17. Current Abstracts Nuclear Reactors and Technology

    Energy Technology Data Exchange (ETDEWEB)

    Bales, J.D.; Hicks, S.C. [eds.

    1993-01-01

    This publication Nuclear Reactors and Technology (NRT) announces on a monthly basis the current worldwide information available from the open literature on nuclear reactors and technology, including all aspects of power reactors, components and accessories, fuel elements, control systems, and materials. This publication contains the abstracts of DOE reports, journal articles, conference papers, patents, theses, and monographs added to the Energy Science and Technology Database during the past month. Also included are US information obtained through acquisition programs or interagency agreements and international information obtained through acquisition programs or interagency agreements and international information obtained through the International Energy Agency`s Energy Technology Data Exchange or government-to-government agreements. The digests in NRT and other citations to information on nuclear reactors back to 1948 are available for online searching and retrieval on the Energy Science and Technology Database and Nuclear Science Abstracts (NSA) database. Current information, added daily to the Energy Science and Technology Database, is available to DOE and its contractors through the DOE Integrated Technical Information System. Customized profiles can be developed to provide current information to meet each user`s needs.

  18. Processing abstract language modulates motor system activity.

    Science.gov (United States)

    Glenberg, Arthur M; Sato, Marc; Cattaneo, Luigi; Riggio, Lucia; Palumbo, Daniele; Buccino, Giovanni

    2008-06-01

    Embodiment theory proposes that neural systems for perception and action are also engaged during language comprehension. Previous neuroimaging and neurophysiological studies have only been able to demonstrate modulation of action systems during comprehension of concrete language. We provide neurophysiological evidence for modulation of motor system activity during the comprehension of both concrete and abstract language. In Experiment 1, when the described direction of object transfer or information transfer (e.g., away from the reader to another) matched the literal direction of a hand movement used to make a response, speed of responding was faster than when the two directions mismatched (an action-sentence compatibility effect). In Experiment 2, we used single-pulse transcranial magnetic stimulation to study changes in the corticospinal motor pathways to hand muscles while reading the same sentences. Relative to sentences that do not describe transfer, there is greater modulation of activity in the hand muscles when reading sentences describing transfer of both concrete objects and abstract information. These findings are discussed in relation to the human mirror neuron system.

  19. Physical and Chemical Environmental Abstraction Model

    International Nuclear Information System (INIS)

    Nowak, E.

    2000-01-01

    As directed by a written development plan (CRWMS M and O 1999a), Task 1, an overall conceptualization of the physical and chemical environment (P/CE) in the emplacement drift is documented in this Analysis/Model Report (AMR). Included are the physical components of the engineered barrier system (EBS). The intended use of this descriptive conceptualization is to assist the Performance Assessment Department (PAD) in modeling the physical and chemical environment within a repository drift. It is also intended to assist PAD in providing a more integrated and complete in-drift geochemical model abstraction and to answer the key technical issues raised in the U.S. Nuclear Regulatory Commission (NRC) Issue Resolution Status Report (IRSR) for the Evolution of the Near-Field Environment (NFE) Revision 2 (NRC 1999). EBS-related features, events, and processes (FEPs) have been assembled and discussed in ''EBS FEPs/Degradation Modes Abstraction'' (CRWMS M and O 2000a). Reference AMRs listed in Section 6 address FEPs that have not been screened out. This conceptualization does not directly address those FEPs. Additional tasks described in the written development plan are recommended for future work in Section 7.3. To achieve the stated purpose, the scope of this document includes: (1) the role of in-drift physical and chemical environments in the Total System Performance Assessment (TSPA) (Section 6.1); (2) the configuration of engineered components (features) and critical locations in drifts (Sections 6.2.1 and 6.3, portions taken from EBS Radionuclide Transport Abstraction (CRWMS M and O 2000b)); (3) overview and critical locations of processes that can affect P/CE (Section 6.3); (4) couplings and relationships among features and processes in the drifts (Section 6.4); and (5) identities and uses of parameters transmitted to TSPA by some of the reference AMRs (Section 6.5). This AMR originally considered a design with backfill, and is now being updated (REV 00 ICN1) to address

  20. Is the Abstract a Mere Teaser? Evaluating Generosity of Article Abstracts in the Environmental Sciences

    Directory of Open Access Journals (Sweden)

    Liana Ermakova

    2018-05-01

    Full Text Available An abstract is not only a mirror of the full article; it also aims to draw attention to the most important information of the document it summarizes. Many studies have compared abstracts with full texts for their informativeness. In contrast to previous studies, we propose to investigate this relation based not only on the amount of information given by the abstract but also on its importance. The main objective of this paper is to introduce a new metric called GEM to measure the “generosity” or representativeness of an abstract. Schematically speaking, a generous abstract should have the best possible score of similarity for the sections important to the reader. Based on a questionnaire gathering information from 630 researchers, we were able to weight sections according to their importance. In our approach, seven sections were first automatically detected in the full text. The accuracy of this classification into sections was above 80% compared with a dataset of documents where sentences were assigned to sections by experts. Second, each section was weighted according to the questionnaire results. The GEM score was then calculated as a sum of weights of sections in the full text corresponding to sentences in the abstract normalized over the total sum of weights of sections in the full text. The correlation between GEM score and the mean of the scores assigned by annotators was higher than the correlation between scores from different experts. As a case study, the GEM score was calculated for 36,237 articles in environmental sciences (1930–2013 retrieved from the French ISTEX database. The main result was that GEM score has increased over time. Moreover, this trend depends on subject area and publisher. No correlation was found between GEM score and citation rate or open access status of articles. We conclude that abstracts are more generous in recent publications and cannot be considered as mere teasers. This research should be pursued

  1. Tailored model abstraction in performance assessments

    International Nuclear Information System (INIS)

    Kessler, J.H.

    1995-01-01

    Total System Performance Assessments (TSPAs) are likely to be one of the most significant parts of making safety cases for the continued development and licensing of geologic repositories for the disposal of spent fuel and HLW. Thus, it is critical that the TSPA model capture the 'essence' of the physical processes relevant to demonstrating the appropriate regulation is met. But how much detail about the physical processes must be modeled and understood before there is enough confidence that the appropriate essence has been captured? In this summary the level of model abstraction that is required is discussed. Approaches for subsystem and total system performance analyses are outlined, and the role of best estimate models is examined. It is concluded that a conservative approach for repository performance, based on limited amount of field and laboratory data, can provide sufficient confidence for a regulatory decision

  2. 2009 PNST prospective - Book of abstracts

    International Nuclear Information System (INIS)

    Aulanier, Guillaume; Jacquey, Christian; Bocchialini, Karine; Savoini, Philippe; Mazelle, Christian; Galtier, Sebastien; Passot, Thierry; Appourchaux, Thierry; Pincon, Jean-Louis; Lathuillere, Chantal; Dudok de Wit, Thierry; Lignieres, Francois; Malherbe, Jean-Marie; Jacquey, Christian; Fontaine, Dominique; Vilmer, Nicole

    2009-09-01

    PNST (Programme National Soleil-Terre/Sun-Earth National Program) is dedicated to analysis of the Sun-Earth system, from generation of the solar magnetic field, flares and coronal mass ejections, until impact on the terrestrial magnetosphere, ionosphere and thermosphere. Research activities carried out in the frame of Programme National Soleil-Terre (PNST) rely on both ground-based and space-borne instruments. One of the main objectives of PNST is to stimulate coordinated studies and to optimize scientific return of these instruments. The 2009 PNST prospective colloquium comprised 9 sessions: 1 - Eruptive activity in plasmas; 2 - Particles heating and acceleration; 3 - Energy transfers at different scales and turbulence; 4 - Coupling between the different envelopes; 5 - Sun-Earth relations and space meteorology; 6 - Sun and star prototypes; 7 - Databases, services; 8 - Instrumentation; 9 - Prospective. This document is the book of abstracts of the colloquium

  3. DyNano-2010, Book of abstracts

    International Nuclear Information System (INIS)

    Bjoemeholm, O.; Boutu, W.; Gauthier, D.; Xunyou, Ge; Xiaochi, Liu; Carre, B.; Merdji, H.; Winkler, M.; Harnes, J.; Saethre, L.J.; Boerve, K.J.

    2012-01-01

    The amazing progresses made in the recent years by the instrumentation in terms of spectral brightness of the X-ray sources (new synchrotron radiation facilities, X-ray Free Electron Lasers etc.), detection schemes (multi-channel analysis due to intensive use of position sensitive detectors, time-resolved techniques etc.) and production sources of clusters (pure and mixed, atomic and molecular clusters) and nano-particles permit nowadays highly accurate spectroscopic studies of more and more complex objects. There were dedicated sessions on the following topics: 1) recent progress in Nano-object's investigations, 2) synchrotron radiation based spectroscopic investigations of clusters and nano-particles, 3) Structure and properties of size-selected clusters, 4) electronic and nuclear decay of clusters, 5) new insights in structure and dynamics of complex species, and 6) clusters and nano-particles and new light sources. This document gathers only the abstracts of the papers

  4. VEST: Abstract vector calculus simplification in Mathematica

    Science.gov (United States)

    Squire, J.; Burby, J.; Qin, H.

    2014-01-01

    We present a new package, VEST (Vector Einstein Summation Tools), that performs abstract vector calculus computations in Mathematica. Through the use of index notation, VEST is able to reduce three-dimensional scalar and vector expressions of a very general type to a well defined standard form. In addition, utilizing properties of the Levi-Civita symbol, the program can derive types of multi-term vector identities that are not recognized by reduction, subsequently applying these to simplify large expressions. In a companion paper Burby et al. (2013) [12], we employ VEST in the automation of the calculation of high-order Lagrangians for the single particle guiding center system in plasma physics, a computation which illustrates its ability to handle very large expressions. VEST has been designed to be simple and intuitive to use, both for basic checking of work and more involved computations.

  5. MicroCar 2003. Abstracts of papers

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    Mechatronics for automotive applications is an important trend, combining mechanics, electronics and information technology. Micro- and nanomechatronics, particularly innovative research disciplines, will help create, in combination with advanced solutions from microsystem technologies, e.g. the electronic packaging, a range of entirely new developments in automobiles. Under the umbrella of the Automotive Suppliers Fair Z2003, it is happening for the very first time now that a momentous scientific conference, such as the MicroCar 2003, brings together representatives from car manufacturers and the electronics industry, as well as a large number of experts from technical colleges, universities and research institutes to discuss the new potentials and possibilities presented by the use of micro and nanomaterials in Leipzig. With the presentation of 50 papers, speakers will inform about their latest research results as well as current trends in micro and nanotechnologies for automotives. This issue is publishing the abstracts of this scientific event.

  6. Bioremediation case studies: Abstracts. Final report

    International Nuclear Information System (INIS)

    Devine, K.

    1992-03-01

    The report contains abstracts of 132 case studies of bioremediation technology applied to hazardous waste clean-up. It was prepared to compile bioremediation studies in a variety of locations and treating diverse contaminants, most of which were previously undocumented. All data are based on vendor-supplied information and there was no opportunity to independently confirm its accuracy. These 132 case studies, from 10 different biotechnology companies, provide users with reference information about on-going and/or completed field applications and studies. About two-thirds of the cases were at full-scale clean-up level with the remainder at pilot or laboratory scale. In 74 percent of the cases, soil was at least one of the media treated. Soil alone accounts for 46 percent of the cases. Petroleum-related wastes account for the largest contaminant with 82 cases. Thirty-one states are represented in the case studies

  7. 23. Blois meeting 2011- Slides and abstracts

    International Nuclear Information System (INIS)

    Grannis, P.; LeCompte, T.J.; Godbole, R.; Silk, J.; Glover, N.; Verzocchi, M.; Punzi, G.; Maltoni, F.; Narain, M.; Golutvin, A.; Swanson, E.; Iijima, T.; Loizides, C.; Salgado, C.; Oz, Y.; Buchmueller, O.; Pomarol, A.; Taffard, A.; Myers, S.; Lisi, E.; Lindner, M.; Pascoli, S.; Lunardini, C.; Terning, J.; Horava, P.; Gomez, C.; Oberlack, U.; Gunion, J.; Patanchon, G.; Kowalski, M.; Binetruy, P.; Rezzolla, L.; Barsuglia, M.; Montaruli, T.; Sigl, G.; Lykken, J.; Tsybychev, D.; Blanc, F.; Yusa, Yosuke; Oakes, L.; Deschamps, O.; Kolomensky, Y.; Etzion, E.; Espagnon, B.; Niebuhr, C.; Grebenyuk, J.; Blessing, S.; Saoulidou, L.; Bifani, S.; Benhabib, L.; Piskunova, O.; Santel, D.; Fulsom, B.; Zhong, Bin; Tian, Haolai; Fantechi, R.; Daskalakis, G.; Marrouche, J.; Ubiali, M.; Petroff, P.; Bernhard, R.; Kuehn, S.; Aharrouche, M.; Jorda Lope, C.; Sorin, V.; Venturi, N.; Zaro, M.; Desai, Satish; Yu, Geum Bong; Elmsheuser, J.; Botta, C.; Couderc, F.; Rauch, M.; Lister, A.; Saleem, M.; Aldaya Martin, M.; Takeuchi, M.; Soustruznik, K.; Rao, Kanishka; Moreau, G.; Janicsko, J.; Garrido, X.; Mueller, T.; Mehdiyev, R.; Zimmerman, E.; Li, T.; Raselli, G.L.; Bellerive, A.; Manecki, S.M.; Studenikin, A.; Lamblin, J.; Censier, B.; Cooley, J.; Moulin, E.; Baldini, L.; Carmona-Benitez, C.; Tytgat, M.; Faldowski, A.; Rao, Soumya; Serra, J.; Neiman, Y.; Novikov, V.; De Aquino, P.; Vazquez-Jauregui, E.; Canonica, L.; Cattaneo, P.; Gruenendahl, S.; Widl, E.E.; Cote, D.; Falkowski, A.; Torre, R.; Vidal, M.; De Guio, F.; Cuhadar, Donszelmann; Colin, P.; Komin, Nukri; Palioselitis, D.; Baret, B.; Toscano, S.; Roth, M.; Deligny, O.; Guy, Julien; Chotard, N.; Rapetti, D.; Lychkovskiy, O.; Staggs, S.; Wehus, I.C.

    2013-01-01

    This conference on 'Particle Physics and Cosmology' will emphasize the increasing interplay between high energy accelerator based physics and cosmology. The meeting will be articulated around the results and their impact on current theories from the 3 major new experimental and observational facilities which are coming on line or have recently been commissioned: the Large Hadron Collider at CERN, the Planck satellite, and the Herschel satellite. The topics will include: -) the Standard Model in particle physics, in new data and analyses, -) the search for the Higgs boson, -) theories of and searches for physics beyond the Standard Model, -) heavy flavour physics, -) neutrino physics (astrophysical and laboratory), -) dark matter, dark energy and recent advances in cosmology. This document gathers the program, the slides and some abstracts of the presentations

  8. Interfacing microbiology and biotechnology. Conference abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Maupin, Julia A.

    2001-05-19

    The Interfacing Microbiology and Biotechnology Conference was attended by over 100 faculty, post-docs, students, and research scientists from the US, Europe, and Latin America. The conference successfully stimulated communication and the dissemination of knowledge among scientists involved in basic and applied research. The focus of the conference was on microbial physiology and genetics and included sessions on C1 metabolism, archaeal metabolism, proteases and chaperones, gene arrays, and metabolic engineering. The meeting provided the setting for in-depth discussions between scientists who are internationally recognized for their research in these fields. The following objectives were met: (1) The promotion of interaction and future collaborative projects among scientists involved in basic and applied research which incorporates microbial physiology, genetics, and biochemistry; (2) the facilitation of communication of new research findings through seminars, posters, and abstracts; (3 ) the stimulation of enthusiasm and education among participants including graduate and undergraduate students.

  9. Waste management research abstracts no. 14

    International Nuclear Information System (INIS)

    1983-04-01

    The present 14th issue is the second of the new series of Waste Management Research Abstracts, which are reappearing after a three-year suspension. The new series appears in a substantially innovated form. Although the objective of the publication is the same as before, namely to collect and disseminate information on research in progress in the field of nuclear waste management, the format for presentation of the information is a new data sheet in a standardized form, access to which will be made possible by different indexes. The 408 research data sheets contained in this issue have been collected during recent months, ending 15 January 1983, and reflect research currently in progress. They were sent by the Governments of twenty-five Member States, by the International Atomic Energy Agency, and by the Commission of the European Communities. Though the information contained in this publication covers a wide range of subjects in various countries, the WMRA should not be interpreted as providing a complete survey of on-going research in IAEA Member States

  10. Plans should abstractly describe intended behavior

    Energy Technology Data Exchange (ETDEWEB)

    Pfleger, K.; Hayes-Roth, B. [Stanford Univ., CA (United States)

    1996-12-31

    Planning is the process of formulating a potential course of action. How courses of action (plans) produced by a planning module are represented and how they are used by execution-oriented modules of a complex agent to influence or dictate behavior are critical architectural issues. In contrast to the traditional model of plans as executable programs that dictate precise behaviors, we claim that autonomous agents inhabiting dynamic, unpredictable environments can make better use of plans that only abstractly describe their intended behavior. Such plans only influence or constrain behavior, rather than dictating it. This idea has been discussed in a variety of contexts, but it is seldom incorporated into working complex agents. Experiments involving instantiations of our Adaptive Intelligent Systems architecture in a variety of domains have demonstrated the generality and usefulness of the approach, even with our currently simple plan representation and mechanisms for plan following. The behavioral benefits include (1) robust improvisation of goal-directed behavior in response to dynamic situations, (2) ready exploitation of dynamically acquired knowledge or behavioral capabilities, and (3) adaptation based on dynamic aspects of coordinating diverse behaviors to achieve multiple goals. In addition to these run-time advantages, the approach has useful implications for the design and configuration of agents. Indeed, the core ideas of the approach are natural extensions of fundamental ideas in software engineering.

  11. DOE NABIR PI Workshop: Abstracts 2002

    Energy Technology Data Exchange (ETDEWEB)

    Hawkes (Editor), Dan

    2002-01-09

    The mission of the NABIR program is to provide the fundamental science that will serve as the basis for the development of cost-effective bioremediation and long-term stewardship of radionuclides and metals in the subsurface at DOE sites. The focus of the program is on strategies leading to long-term immobilization of contaminants in place to reduce the risk to humans and the environment. Contaminants of special interest are uranium, technetium, plutonium, chromium, and mercury. The focus of the NABIR program is on the bioremediation of these contaminants in the subsurface below the root zone, including both vadose and saturated zones. The program is implemented through four interrelated scientific research elements (Biogeochemistry, Biomolecular Science and Engineering, Biotransformation, and Community Dynamics/Microbial Ecology); and through an element called Bioremediation and its Societal Implications and Concerns (BASIC), which addresses societal issues and potential concerns of stakeholders. The material presented at this year's workshop focuses on approximately 60 research projects funded in FY 2000-2002 by DOE's Office of Biological and Environmental Research (BER). Abstracts of NABIR research projects are provided in this book.

  12. Abstract numerical discrimination learning in rats.

    Science.gov (United States)

    Taniuchi, Tohru; Sugihara, Junko; Wakashima, Mariko; Kamijo, Makiko

    2016-06-01

    In this study, we examined rats' discrimination learning of the numerical ordering positions of objects. In Experiments 1 and 2, five out of seven rats successfully learned to respond to the third of six identical objects in a row and showed reliable transfer of this discrimination to novel stimuli after being trained with three different training stimuli. In Experiment 3, the three rats from Experiment 2 continued to be trained to respond to the third object in an object array, which included an odd object that needed to be excluded when identifying the target third object. All three rats acquired this selective-counting task of specific stimuli, and two rats showed reliable transfer of this selective-counting performance to test sets of novel stimuli. In Experiment 4, the three rats from Experiment 3 quickly learned to respond to the third stimulus in object rows consisting of either six identical or six different objects. These results offer strong evidence for abstract numerical discrimination learning in rats.

  13. DOE NABIR PI Workshop: Abstracts 2002

    International Nuclear Information System (INIS)

    Hawkes, Dan

    2002-01-01

    The mission of the NABIR program is to provide the fundamental science that will serve as the basis for the development of cost-effective bioremediation and long-term stewardship of radionuclides and metals in the subsurface at DOE sites. The focus of the program is on strategies leading to long-term immobilization of contaminants in place to reduce the risk to humans and the environment. Contaminants of special interest are uranium, technetium, plutonium, chromium, and mercury. The focus of the NABIR program is on the bioremediation of these contaminants in the subsurface below the root zone, including both vadose and saturated zones. The program is implemented through four interrelated scientific research elements (Biogeochemistry, Biomolecular Science and Engineering, Biotransformation, and Community Dynamics/Microbial Ecology); and through an element called Bioremediation and its Societal Implications and Concerns (BASIC), which addresses societal issues and potential concerns of stakeholders. The material presented at this year's workshop focuses on approximately 60 research projects funded in FY 2000-2002 by DOE's Office of Biological and Environmental Research (BER). Abstracts of NABIR research projects are provided in this book

  14. DOE-NABIR PI Workshop: Abstracts 2003

    Energy Technology Data Exchange (ETDEWEB)

    Various

    2003-01-28

    The mission of the NABIR program is to provide the fundamental science that will serve as the basis for the development of cost-effective bioremediation and long-term stewardship of radionuclides and metals in the subsurface at DOE sites. The focus of the program is on strategies leading to long-term immobilization of contaminants in situ to reduce the risk to humans and the environment. Contaminants of special interest are uranium, technetium, plutonium, chromium, and mercury. The focus of the NABIR program is on the bioremediation of these contaminants in the subsurface below the root zone, including both vadose and saturated zones. The program consists of four interrelated Science Elements (Biotransformation, Community Dynamics/Microbial Ecology, Biomolecular Science and Engineering, and Biogeochemistry). The program also has a cross-cutting Assessment Element that supports development of innovative approaches and technologies to support the science elements. An element called Bioremediation and its Societal Implications and Concerns (BASIC) addresses potential societal issues of implementing NABIR scientific findings. The material presented at this year's workshop focuses on approximately 60 research projects funded in FY 2000-2003 by the Environmental Remediation Sciences Division in DOE's Office of Biological and Environmental Research (BER) in the Office of Science. Abstracts of NABIR research projects are provided in this book.

  15. In defense of abstract conceptual representations.

    Science.gov (United States)

    Binder, Jeffrey R

    2016-08-01

    An extensive program of research in the past 2 decades has focused on the role of modal sensory, motor, and affective brain systems in storing and retrieving concept knowledge. This focus has led in some circles to an underestimation of the need for more abstract, supramodal conceptual representations in semantic cognition. Evidence for supramodal processing comes from neuroimaging work documenting a large, well-defined cortical network that responds to meaningful stimuli regardless of modal content. The nodes in this network correspond to high-level "convergence zones" that receive broadly crossmodal input and presumably process crossmodal conjunctions. It is proposed that highly conjunctive representations are needed for several critical functions, including capturing conceptual similarity structure, enabling thematic associative relationships independent of conceptual similarity, and providing efficient "chunking" of concept representations for a range of higher order tasks that require concepts to be configured as situations. These hypothesized functions account for a wide range of neuroimaging results showing modulation of the supramodal convergence zone network by associative strength, lexicality, familiarity, imageability, frequency, and semantic compositionality. The evidence supports a hierarchical model of knowledge representation in which modal systems provide a mechanism for concept acquisition and serve to ground individual concepts in external reality, whereas broadly conjunctive, supramodal representations play an equally important role in concept association and situation knowledge.

  16. Types: A data abstraction package in FORTRAN

    International Nuclear Information System (INIS)

    Youssef, S.

    1990-01-01

    TYPES is a collection of Fortran programs which allow the creation and manipulation of abstract ''data objects'' without the need for a preprocessor. Each data object is assigned a ''type'' as it is created which implies participation in a set of characteristic operations. Available types include scalars, logicals, ordered sets, stacks, queues, sequences, trees, arrays, character strings, block text, histograms, virtual and allocatable memories. A data object may contain integers, reals, or other data objects in any combination. In addition to the type specific operations, a set of universal utilities allows for copying input/output to disk, naming, editing, displaying, user input, interactive creation, tests for equality of contents or structure, machine to machine translation or source code creation for and data object. TYPES is available on VAX/VMS, SUN 3, SPARC, DEC/Ultrix, Silicon Graphics 4D and Cray/Unicos machines. The capabilities of the package are discussed together with characteristic applications and experience in writing the GVerify package

  17. Abstracting application deployment on Cloud infrastructures

    Science.gov (United States)

    Aiftimiei, D. C.; Fattibene, E.; Gargana, R.; Panella, M.; Salomoni, D.

    2017-10-01

    Deploying a complex application on a Cloud-based infrastructure can be a challenging task. In this contribution we present an approach for Cloud-based deployment of applications and its present or future implementation in the framework of several projects, such as “!CHAOS: a cloud of controls” [1], a project funded by MIUR (Italian Ministry of Research and Education) to create a Cloud-based deployment of a control system and data acquisition framework, “INDIGO-DataCloud” [2], an EC H2020 project targeting among other things high-level deployment of applications on hybrid Clouds, and “Open City Platform”[3], an Italian project aiming to provide open Cloud solutions for Italian Public Administrations. We considered to use an orchestration service to hide the complex deployment of the application components, and to build an abstraction layer on top of the orchestration one. Through Heat [4] orchestration service, we prototyped a dynamic, on-demand, scalable platform of software components, based on OpenStack infrastructures. On top of the orchestration service we developed a prototype of a web interface exploiting the Heat APIs. The user can start an instance of the application without having knowledge about the underlying Cloud infrastructure and services. Moreover, the platform instance can be customized by choosing parameters related to the application such as the size of a File System or the number of instances of a NoSQL DB cluster. As soon as the desired platform is running, the web interface offers the possibility to scale some infrastructure components. In this contribution we describe the solution design and implementation, based on the application requirements, the details of the development of both the Heat templates and of the web interface, together with possible exploitation strategies of this work in Cloud data centers.

  18. Radiation protection day - Book of abstracts

    International Nuclear Information System (INIS)

    2000-06-01

    This document brings together the abstracts of all presentations given at the Radiation protection day organised in May 2000 by the French association for radiation protection techniques and sciences (ATSR) on the topic of the new European and French radiation protection regulations and their conditions of application in hospitals. Content: 1 - Presentation of the Office of Protection against Ionizing Radiations (O.P.R.I.), status of texts and evolution, practical implementation of operational dosimetry (Alain Valero, O.P.R.I.); 2 - Presentation of the Radiation Protection Service of the Army (S.P.R.A.) and its role in French army's hospitals (Jean-Baptiste Fleutot, S.P.R.A.); 3 - 96/29 European directive and water quality - transposition in French law (Daniel Robeau, I.P.S.N. Fontenay-Aux-Roses); 4 - Presentation of an automatized active dosimetry system (Michel Deron, G.E.M. System); 5 - Euratom 97/43 Directive from June 30, 1997 - assessment of the existing framework for patients protection in medical environment (Pierre Muglioni, APAVE Nord Ouest); 6 - Specificities of the ionising radiations risk in medical environment - presentation of a ionising radiations risk assessment grid (Marie-Christine Soula, Labour regional direction Ile de France); 7 - Low dose effects (B. Le Guen, E.D.F. G.D.F.); 8 - Operational dosimetry in the medical domain - the Saphydose dosemeter (Frederico Felix - Saphymo); 9 - Positrons and radiation protection (Luc Cinotti - C.E.R.M.E.P.); 10 - Workplace studies in medical environment - areas and personnel classification (Jean-Claude Houy, Sandrine Laugle, Eugene Marquis Cancer Centre Rennes); 11 - Experience feedback after 4 years of active dosimetry in a nuclear medicine service (Albert Lisbona, Centre Rene Gauducheau Nantes/Saint-Herblain); 12 - Operational dosimetry as it is performed today in CNRS laboratories (Helene Dossier - C.N.R.S. Orsay); 13 - Radiation protection in submarine naval forces (Pierre Laroche, Army's health service

  19. DOCUMENT REPRESENTATION FOR CLUSTERING OF SCIENTIFIC ABSTRACTS

    Directory of Open Access Journals (Sweden)

    S. V. Popova

    2014-01-01

    Full Text Available The key issue of the present paper is clustering of narrow-domain short texts, such as scientific abstracts. The work is based on the observations made when improving the performance of key phrase extraction algorithm. An extended stop-words list was used that was built automatically for the purposes of key phrase extraction and gave the possibility for a considerable quality enhancement of the phrases extracted from scientific publications. A description of the stop- words list creation procedure is given. The main objective is to investigate the possibilities to increase the performance and/or speed of clustering by the above-mentioned list of stop-words as well as information about lexeme parts of speech. In the latter case a vocabulary is applied for the document representation, which contains not all the words that occurred in the collection, but only nouns and adjectives or their sequences encountered in the documents. Two base clustering algorithms are applied: k-means and hierarchical clustering (average agglomerative method. The results show that the use of an extended stop-words list and adjective-noun document representation makes it possible to improve the performance and speed of k-means clustering. In a similar case for average agglomerative method a decline in performance quality may be observed. It is shown that the use of adjective-noun sequences for document representation lowers the clustering quality for both algorithms and can be justified only when a considerable reduction of feature space dimensionality is necessary.

  20. Clad Degradation- Summary and Abstraction for LA

    International Nuclear Information System (INIS)

    D. Stahl

    2004-01-01

    The purpose of this model report is to develop the summary cladding degradation abstraction that will be used in the Total System Performance Assessment for the License Application (TSPA-LA). Most civilian commercial nuclear fuel is encased in Zircaloy cladding. The model addressed in this report is intended to describe the postulated condition of commercial Zircaloy-clad fuel as a function of postclosure time after it is placed in the repository. Earlier total system performance assessments analyzed the waste form as exposed UO 2 , which was available for degradation at the intrinsic dissolution rate. Water in the waste package quickly became saturated with many of the radionuclides, limiting their release rate. In the total system performance assessments for the Viability Assessment and the Site Recommendation, cladding was analyzed as part of the waste form, limiting the amount of fuel available at any time for degradation. The current model is divided into two stages. The first considers predisposal rod failures (most of which occur during reactor operation and associated activities) and postdisposal mechanical failure (from static loading of rocks) as mechanisms for perforating the cladding. Other fuel failure mechanisms including those caused by handling or transportation have been screened out (excluded) or are treated elsewhere. All stainless-steel-clad fuel, which makes up a small percentage of the overall amount of fuel to be stored, is modeled as failed upon placement in the waste packages. The second stage of the degradation model is the splitting of the cladding from the reaction of water or moist air and UO 2 . The splitting has been observed to be rapid in comparison to the total system performance assessment time steps and is modeled to be instantaneous. After the cladding splits, the rind buildup inside the cladding widens the split, increasing the diffusion area from the fuel rind to the waste package interior. This model report summarizes the