Predicting duff and woody fuel consumed by prescribed fire in the Northern Rocky Mountains
James K. Brown; Michael A. Marsden; Kevin C. Ryan; Elizabeth D. Reinhardt
1985-01-01
Relationships for predicting duff reduction, mineral soil exposure, and consumption of downed woody fuel were determined to assist in planning prescribed fires. Independent variables included lower and entire duff moisture contents, loadings of downed woody fuels, duff depth, National Fire-Danger Rating System 1,000-hour moisture content, and Canadian Duff Moisture...
Spatial interpolation and simulation of post-burn duff thickness after prescribed fire
Peter R. Robichaud; S. M. Miller
1999-01-01
Prescribed fire is used as a site treatment after timber harvesting. These fires result in spatial patterns with some portions consuming all of the forest floor material (duff) and others consuming little. Prior to the burn, spatial sampling of duff thickness and duff water content can be used to generate geostatistical spatial simulations of these characteristics....
Concurrent software system design supported by SARA at the age of one
Energy Technology Data Exchange (ETDEWEB)
Campos, I.M.; Estrin, G.
A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.
Duff reaction on phenols: Characterization of non steam volatile products
Digital Repository Service at National Institute of Oceanography (India)
Wahidullah, S.; DeSouza, L.; Bhattacharya, J.
New products having structures 1 and 2 have been characterized in the Duff reaction thymol arid carvacrol. These products have been identified as 2.6'-dithymylmethane 1 and 5.5' -dicarvacryl methane 2 respectively on the basis of spectral data...
2012 SARA Students Technical Report
International Nuclear Information System (INIS)
Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet
2012-01-01
The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of
2012 SARA Students Technical Report
Energy Technology Data Exchange (ETDEWEB)
Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory
2012-07-30
The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the
Mixed Conifer Forest Duff Consumption during Prescribed Fires: Tree Crown Impacts
Hille, M.G.; Stephens, S.L.
2005-01-01
Fire suppression has produced large forest floor fuel loads in many coniferous forests in western North America. This study describes spatial patterns of duff consumption in a mixed-conifer forest in the north-central Sierra Nevada, California. Overstory crown coverage was correlated to spatial
Does raking basal duff affect tree growth rates or mortality?
Erin Noonan-Wright; Sharon M. Hood; Danny R. Cluck
2010-01-01
Mortality and reduced growth rates due to raking accumulated basal duff were evaluated for old, large-diameter ponderosa and Jeffrey pine trees on the Lassen National Forest, California. No fire treatments were included to isolate the effect of raking from fire. Trees were monitored annually for 5 years after the raking treatment for mortality and then cored to measure...
Heat Pipe Powered Stirling Conversion for the Demonstration Using Flattop Fission (DUFF) Test
Gibson, Marc A.; Briggs, Maxwell H.; Sanzi, James L.; Brace, Michael H.
2013-01-01
Design concepts for small Fission Power Systems (FPS) have shown that heat pipe cooled reactors provide a passive, redundant, and lower mass option to transfer heat from the fuel to the power conversion system, as opposed to pumped loop designs typically associated with larger FPS. Although many systems have been conceptually designed and a few making it to electrically heated testing, none have been coupled to a real nuclear reactor. A demonstration test named DUFF Demonstration Using Flattop Fission, was planned by the Los Alamos National Lab (LANL) to use an existing criticality experiment named Flattop to provide the nuclear heat source. A team from the NASA Glenn Research Center designed, built, and tested a heat pipe and power conversion system to couple to Flattop with the end goal of making electrical power. This paper will focus on the design and testing performed in preparation for the DUFF test.
International Nuclear Information System (INIS)
Belmont, J.L.; Fruneau, M.; Martin, P.
1989-05-01
SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration
Interpreting the SARA and RCRA training requirements
International Nuclear Information System (INIS)
Moreland, W.M.; Wells, S.M.
1987-01-01
The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements
Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.
O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J
2008-04-01
Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.
System Analysis and Risk Assessment system (SARA) Version 4.0
International Nuclear Information System (INIS)
Sattison, M.B.; Russell, K.D.; Skinner, N.L.
1992-01-01
This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis
International Nuclear Information System (INIS)
Schroer, Bert; FU-Berlin
2012-02-01
Using recent results of advanced quantum field theory, we confute some of M. Duff's claims about string theory which he wrote as an invited paper to the project 'Forty Years Of String Theory: Reflecting on the Foundations' (author)
Forest Fire Smoldering Emissions from Ponderosa Pine Duff in Central Washington
Baker, S. P.; Lincoln, E.; Page, W.; Richardson, M.
2017-12-01
Forest fire smoldering combustion is a significant contribution to pollution and carbon emissions. Smoldering combustion produces the majority of carbon monoxide (CO), methane (CH4), volatile organic compounds (VOC), and fine particulate matter (PM2.5) emitted by forest fires when it occurs. The emission factor for PM2.5 and many VOCs are correlated with the modified combustion efficiency (MCE), which is the ratio of CO2 emitted, to the sum of emitted CO2 and CO. MCE is a measure of the relative ratio of flaming and smoldering combustion, but its relationship to the physical fire process is poorly studied. We measured carbon emission rates and individual emission factors for CO, CO2, CH4, and VOC's from smoldering combustion on Ponderosa pine /Douglas-Fir forest sites in central Washington. The emission factor results are linked with concurrent thermal measurements made at various depths in the duff and surface IR camera imagery. The MCE value ranged from .80 to .91 and are correlated with emission factors for 24 carbon compounds. Other data collected were fuel moistures and duff temperatures at depth increments. This goal of this research is the creation of a database to better predict the impacts of air pollution resulting from burns leading to smoldering combustion.
The relationship between SARA fractions and crude oil stability
Directory of Open Access Journals (Sweden)
Siavash Ashoori
2017-03-01
Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.
Layering of life (Sara novel of Peter Sarić
Directory of Open Access Journals (Sweden)
Kostić Dragomir J.
2015-01-01
Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safeguard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.
Wood, M. A.; Oswalt, T. D.; SARA Collaboration
2000-12-01
We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.
Gene : CBRC-SARA-01-1996 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL
Directory of Open Access Journals (Sweden)
Jessica N Snowden
Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.
Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi
Directory of Open Access Journals (Sweden)
M. Sidi Ritau'din
2017-06-01
Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.
Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)
DEFF Research Database (Denmark)
Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong
2014-01-01
at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...
ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN
Directory of Open Access Journals (Sweden)
Sulistyastuti Sutomo
2015-01-01
Full Text Available Not only does art have self-fullfillment, but it also has axiological benefits both socially, culturally, religiously, and economiclally. So does Sara Douda dance. Sara Douda aesthetics is first contained in its whole dance movements. In addition, it can also be found in the whole dance equipments. Moreover, this dance aesthetics may also be contained in the verbal symbols in the speech forms prior to the dance performance. However, both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and religious values in the Loli community about their honoring their ancestors, having social harmony, and highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance. Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda
System Analysis and Risk Assessment System (SARA), Version 4.0
International Nuclear Information System (INIS)
Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.
1992-02-01
This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs
Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural
Directory of Open Access Journals (Sweden)
Tiara Kharisma
2017-12-01
Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.
Michael G. Harrington
2012-01-01
Western larch is one of the most fire-adapted conifers in western North America. Its historical perpetuation depended upon regular fire disturbances, which creates open stand conditions and mineral seedbeds. A stand of 200- to 500-year-old larch in western Montana with deep duff mounds resulting from an unusually long 150-year fire-free period was mechanically thinned...
System Analysis and Risk Assessment (SARA) system
International Nuclear Information System (INIS)
Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.
1986-01-01
Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable
Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning
Thomas, S. M.; Su, Y. C.; Hummel, P. R.
2016-12-01
Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance
SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS
International Nuclear Information System (INIS)
Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.
2015-01-01
SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index
Directory of Open Access Journals (Sweden)
Mohammad Supriyadi
2015-12-01
Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.
NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...
Directory of Open Access Journals (Sweden)
X. Y. Jiang
2014-08-01
Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.
NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...
Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion
Energy Technology Data Exchange (ETDEWEB)
Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS
2009-07-01
Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench
Calculations for the design and modification of the 2 cyclotrons of S.A.R.A
International Nuclear Information System (INIS)
Albrand, P.S.; Belmont, J.L.; Ripouteau, F.
1983-09-01
S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron
Zhao, Bryan M; Hoffmann, F Michael
2006-09-01
Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.
NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...
Wood, M. A.
2003-12-01
The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.
SarA is a negative regulator of Staphylococcus epidermidis biofilm formation
DEFF Research Database (Denmark)
Martin, Christer; Heinze, C.; Busch, M.
2012-01-01
Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...
NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...
Directory of Open Access Journals (Sweden)
Jorge A. Orrego-Ruiz
2014-06-01
Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...
The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)
Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.
2017-01-01
We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.
Directory of Open Access Journals (Sweden)
Fredy Alberto Reyes
2012-06-01
Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p
Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy
2011-09-01
The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.
Directory of Open Access Journals (Sweden)
P. Balamurugan
2017-07-01
Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.
Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows
DEFF Research Database (Denmark)
Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.
2015-01-01
BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...
Transferring generic SARA/OSHA training to US Department of Energy facilities
International Nuclear Information System (INIS)
White, A.; McKinley, T.
1989-01-01
The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs
NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...
SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization
Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.
2018-05-01
Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.
NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w
DEFF Research Database (Denmark)
Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette
2017-01-01
The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...
International Nuclear Information System (INIS)
Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan
2013-01-01
Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques
Directory of Open Access Journals (Sweden)
Grit Grigoleit
2011-03-01
Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.
Layering of life (Sara novel of Peter Sarić)
Kostić, Dragomir J.
2015-01-01
Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...
NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
Directory of Open Access Journals (Sweden)
Tirshem Kumar Kaushik
2015-05-01
Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.
Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010
Beaulé, Sophie
2014-01-01
With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...
Directory of Open Access Journals (Sweden)
Abdullah K. Shehabat
2016-09-01
Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.
Digital Repository Service at National Institute of Oceanography (India)
Panampunnayil, S.U.
on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...
A simple blowdown code for SUPER-SARA loop conditions
International Nuclear Information System (INIS)
Fritz, G.
1981-01-01
The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section
NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic
Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility
International Nuclear Information System (INIS)
Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.
1995-01-01
Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs
International Nuclear Information System (INIS)
Sattison, M.B.; Russell, K.D.; Skinner, N.L.
1994-07-01
The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities
NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens
NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed
Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow
Fletcher, Jack M.; Morris, Robin D.
2014-01-01
Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…
Directory of Open Access Journals (Sweden)
Iserhard, C. A.
2010-01-01
Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.
Directory of Open Access Journals (Sweden)
John M Morrison
2012-03-01
Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.
Venkataraman, Rohini; Yusuf, Kamran
2017-01-01
Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.
Severe accident recriticality analyses (SARA)
Energy Technology Data Exchange (ETDEWEB)
Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H
2001-11-01
Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated
Severe accident recriticality analyses (SARA)
International Nuclear Information System (INIS)
Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.
2001-01-01
Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady
Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow
Fletcher, Jack M.; Morris, Robin D.
2014-01-01
Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...
Goldrick-Rab, Sara; Kelly, Andrew P.
2016-01-01
In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…
Severe Accident Recriticality Analyses (SARA)
Energy Technology Data Exchange (ETDEWEB)
Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)
1999-11-01
Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding
Severe Accident Recriticality Analyses (SARA)
International Nuclear Information System (INIS)
Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.
1999-11-01
Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding
Sara, a patient with borderline personality structure: A "crisis" management
Directory of Open Access Journals (Sweden)
Paola Marinelli
2015-05-01
Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma.
Worthen, Helena Harlow
2012-01-01
The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…
International Nuclear Information System (INIS)
El Naschie, M.S.
2009-01-01
The Witten-Duff five Branes in 11 dimensions model which leads to N = 528 states is reviewed. A complimentary model leading to N = 496 of E 8 E 8 exceptional Lie symmetry group is established along identical ideas. Subsequently both models are combined into a general one which includes the zero-form missing in the original five Branes model. Finally a highly instructive connection to vertical bar E 12 vertical bar = 685 Lie symmetry group which encompasses E 11 as well as the number of distinct knots for given crossing numbers is established. It is concluded that it is easier to transfinitely extend the five Branes model than to add additional roots of exceptional Lie groups in order to find the exact answer.
Directory of Open Access Journals (Sweden)
Diego O Andrey
Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.
Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia
Directory of Open Access Journals (Sweden)
Tjitske F. Lawerman
2017-12-01
Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced
International Nuclear Information System (INIS)
Bouldjedri, A.
1992-06-01
This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements
SAPHIRE technical reference manual: IRRAS/SARA Version 4.0
International Nuclear Information System (INIS)
Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.
1993-01-01
This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix
Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.
2018-04-01
The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.
Escribiendo el silencio: la contemplación poética de Sara Pujol
Directory of Open Access Journals (Sweden)
Gala, Candelas
2005-06-01
Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.
Os suínos da raça Bísara – oportunidades e desafios
Carvalho, Marieta
2015-01-01
A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...
Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility
International Nuclear Information System (INIS)
Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.
1994-11-01
The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)
Godwin, Allison; Potvin, Geoff
2017-01-01
This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…
Reading Sara Pujol Russell’s Poetry of Contemplation and Connection
Directory of Open Access Journals (Sweden)
Anita M. Hart
2012-06-01
Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.
Abdullah K. Shehabat
2016-01-01
This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...
DEFF Research Database (Denmark)
Christner, Martin; Heinze, Constanze; Busch, Michael
2012-01-01
to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...
TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training
Energy Technology Data Exchange (ETDEWEB)
1989-03-01
This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.
Social humanoid robot SARA: development of the wrist mechanism
Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.
2018-01-01
This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.
The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters
International Nuclear Information System (INIS)
Iazzourene, F.
1982-01-01
The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr
Instructional materials for SARA/OSHA training. Volume 1, General site working training
Energy Technology Data Exchange (ETDEWEB)
Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)
1988-04-01
This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.
Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts
Directory of Open Access Journals (Sweden)
Arina LUNGU-CIRSTEA
2011-03-01
Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff
Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer
Directory of Open Access Journals (Sweden)
Helena López
2013-07-01
Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.
A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta
Carvalho, Marieta
2014-01-01
A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...
Análise SWOT global da exploração dos suínos da raça Bísara
Carvalho, Marieta
2015-01-01
A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...
REPRESENTASI ANTI DISKRIMINASI PADA FILM KARTUN 3D ZOOTOPIA (KAJIAN SEMIOTIKA ROLAND BARTHES
Directory of Open Access Journals (Sweden)
Ali Muqoddas
2016-12-01
Full Text Available Isu diskriminasi SARA seperti tiada habisnya terjadi di dunia ini, begitu juga di Indonesia. Hal ini mengakibatkan tema-tema tentang SARA menjadi sensitif ketika dibahas atau pun difilmkan. Hal ini mengakibatkan jarang ditemui film yang mengangkat tentang SARA. Lain halnya dengan Walt Disney. Walt Disney baru-baru ini merilis film kartun 3D yang mengangkat tema anti diskriminasi SARA yang berjudul Zootopia. Film ini menjadi menarik karena isu diskriminasi SARA yang diangkat dibalut dengan konsep yang kreatif hingga sensivitas isu SARA tersebut menjadi berkurang. Representasi anti diskriminasi SARA pada film Zootopia ini selanjutnya dikaji dengan metode semiotika Roland Barthes dengan pendekatan deskriptif kualitatif. Berdasarkan dari analisis, dapat disimpulkan bahwa film Zootopia memuat pesan ideologi tentang anti diskriminasi SARA bahwa kedudukan manusia dimata manusia yang lain pada hakikatnya adalah sama. Setiap manusia berhak dan wajib memperlakukan dan diperlakukan secara bijak tanpa memperdulikan background asal manusia itu sendiri. Penghargaan pada setiap individu tidak didasarkan pada faktor keturunan, ras, suku ataupun agama, namun didasarkan pada prestasi dari individu itu sendiri. Kata Kunci: diskriminasi SARA, Zootopia, Roland Barthes Abstract The issue of racial discrimination as an endless happen in this world, so also in Indonesia. This resulted in the themes of SARA be sensitive when discussed or filmed. This resulted in a rare film that raised about SARA. Another case with Walt Disney. Walt Disney recently released 3D animated film that mengangat theme of anti-discrimination SARA entitled Zootopia. This film is interesting because racial discrimination issues raised wrapped with a creative concept to the sensitivity of the racial issues be reduced. SARA anti-discrimination representation on film Zootopia is further studied with Roland Barthes semiotic methods with qualitative descriptive approach. Based on the analysis, it can
La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli
Directory of Open Access Journals (Sweden)
Umberto Fortis
2014-04-01
Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.
Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests
International Nuclear Information System (INIS)
Eifler, W.; Shepherd, I.M.
1983-01-01
Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix
Ecology and Conservation of Acacia senegal in the Rangelands ...
African Journals Online (AJOL)
Ecology and Conservation of Acacia senegal in the Rangelands ofLuwero and Nakasongola Districts. Jacob Godfrey Agea, Joseph Obua, Sara Namirembe, Mukadasi Buyinza, Daniel Waiswa. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL ...
Agroforestry potential of Acacia senegal in the rangelands of luwero ...
African Journals Online (AJOL)
Agroforestry potential of Acacia senegal in the rangelands of luwero and Nakasongola districts. Jacob Godfrey Agea, Joseph Obua, Sara Namirembe, Mukadasi Buyinza, Daniel Waiswa. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.
International Nuclear Information System (INIS)
Ollivier, T.
1986-01-01
In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr
Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena
2018-01-15
The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.
Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973
Directory of Open Access Journals (Sweden)
Guillermina Feudal
2017-12-01
Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.
From Abstract Art to Abstracted Artists
Directory of Open Access Journals (Sweden)
Romi Mikulinsky
2016-11-01
Full Text Available What lineage connects early abstract films and machine-generated YouTube videos? Hans Richter’s famous piece Rhythmus 21 is considered to be the first abstract film in the experimental tradition. The Webdriver Torso YouTube channel is composed of hundreds of thousands of machine-generated test patterns designed to check frequency signals on YouTube. This article discusses geometric abstraction vis-à-vis new vision, conceptual art and algorithmic art. It argues that the Webdriver Torso is an artistic marvel indicative of a form we call mathematical abstraction, which is art performed by computers and, quite possibly, for computers.
Directory of Open Access Journals (Sweden)
Hans Christian Hagedorn
2011-01-01
Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.
African Journals Online (AJOL)
... hemorrhage mimicking a pneumopathy: a rare complication of dual antiplatelet therapy for ST elevation myocardial infarction, Abstract PDF. Sara Oualim, Charafeddine Ait Elharda, Dounia Benzeroual, Mustapha El Hattaoui. Vol 12, No 1 (2012), Pulmonary epidermoid carcinoma in a patient with acromegaly: a rare entity ...
Lejbak, Lisa; Vrbancic, Mirna; Crossley, Margaret
2009-01-01
This study extends Duff and Hampson's [Duff, S., & Hampson, E. (2001). A sex difference on a novel spatial working memory task in humans. "Brain and Cognition, 47," 470-493] finding of a sex-related difference in favor of females for an object location memory task. Twenty female and 20 male undergraduate students performed both manual and…
Grounding abstractness: Abstract concepts and the activation of the mouth
Directory of Open Access Journals (Sweden)
Anna M Borghi
2016-10-01
Full Text Available One key issue for theories of cognition is how abstract concepts, such as freedom, are represented. According to the WAT (Words As social Tools proposal, abstract concepts activate both sensorimotor and linguistic/social information, and their acquisition modality involves the linguistic experience more than the acquisition of concrete concepts. We report an experiment in which participants were presented with abstract and concrete definitions followed by concrete and abstract target-words. When the definition and the word matched, participants were required to press a key, either with the hand or with the mouth. Response times and accuracy were recorded. As predicted, we found that abstract definitions and abstract words yielded slower responses and more errors compared to concrete definitions and concrete words. More crucially, there was an interaction between the target-words and the effector used to respond (hand, mouth. While responses with the mouth were overall slower, the advantage of the hand over the mouth responses was more marked with concrete than with abstract concepts. The results are in keeping with grounded and embodied theories of cognition and support the WAT proposal, according to which abstract concepts evoke linguistic-social information, hence activate the mouth. The mechanisms underlying the mouth activation with abstract concepts (re-enactment of acquisition experience, or re-explanation of the word meaning, possibly through inner talk are discussed. To our knowledge this is the first behavioral study demonstrating with real words that the advantage of the hand over the mouth is more marked with concrete than with abstract concepts, likely because of the activation of linguistic information with abstract concepts.
International Nuclear Information System (INIS)
1975-01-01
Abstracts of 25 papers presented at the congress are given. The abstracts cover various topics including radiotherapy, radiopharmaceuticals, radioimmunoassay, health physics, radiation protection and nuclear medicine
2018 Congress Podium Abstracts
2018-02-21
Each abstract has been indexed according to first author. Abstracts appear as they were submitted and have not undergone editing or the Oncology Nursing Forum’s review process. Only abstracts that will be presented appear here. For Congress scheduling information, visit congress.ons.org or check the Congress guide. Data published in abstracts presented at the ONS 43rd Annual Congress are embargoed until the conclusion of the presentation. Coverage and/or distribution of an abstract, poster, or any of its supplemental material to or by the news media, any commercial entity, or individuals, including the authors of said abstract, is strictly prohibited until the embargo is lifted. Promotion of general topics and speakers is encouraged within these guidelines.
2018 Congress Poster Abstracts
2018-02-21
Each abstract has been indexed according to the first author. Abstracts appear as they were submitted and have not undergone editing or the Oncology Nursing Forum’s review process. Only abstracts that will be presented appear here. Poster numbers are subject to change. For updated poster numbers, visit congress.ons.org or check the Congress guide. Data published in abstracts presented at the ONS 43rd Annual Congress are embargoed until the conclusion of the presentation. Coverage and/or distribution of an abstract, poster, or any of its supplemental material to or by the news media, any commercial entity, or individuals, including the authors of said abstract, is strictly prohibited until the embargo is lifted. Promotion of general topics and speakers is encouraged within these guidelines.
Chamberlain, Heather; Samec, Ronald G.; Caton, Daniel Bruce; Van Hamme, Walter
2018-01-01
PY Aqr (GSC 05191-00853) is a solar Type (T ~ 5750K) eclipsing binary. It was observed in July to October, 2017 at Cerro Tololo in remote mode with the 0.6-m SARA South reflector. Two times of minimum light were calculated from our present observations, a primary and a secondary eclipse:HJD Min I = 2457951.7762±0.0006 HJD Min II = 2458019.5295±00.0003. Both weighted as 1.0.In addition, four timings were determined from online data given in IBVS 5600 and five observations at minima were determined from archived All Sky Automated Survey Data:HJD Min I = 2452908.3165, 2452912.33612 HJD Min II = 2452877.5621, 2452913.34465. All weighted as 0.5.ASAS Observations at minima: 2452094.688, 2453478.882, 2453266.576, 2452093.685 and 54729.600. Each weighted as 0.10The following linear and quadratic ephemerides were determined from all available times of minimum light:JD Hel Min I=2452951.7443±0.0008d + 0.402093441±0.000000099 X E {1} JD Hel Min I=2452951.7439±0.0007d + 0.4020912±0.0000007 X E +0.00000000018 ± 0.00000000006 X E2 {2}A BVRI Bessell filtered simultaneous Wilson-Devinney Program (W-D) solution reveals that the system has a mass ratio of ~0.34 and a component temperature difference of only ~40 K. One low luminosity (Tfact ~ 0.94, ~66 degree radius) large cool region of spots was iterated on the primary component in the WD Synthetic Light Curve computations. It appears in the Southern Hemisphere (colatitude 155 degrees). The Roche Lobe fill-out of the binary is ~17%. The inclination is ~86 degrees. An eclipse duration of ~10 minutes was determined for the primary eclipse and the light curve solution. Additional and more detailed information is given in this report.
Energy Technology Data Exchange (ETDEWEB)
1975-01-01
Abstracts of the papers given at the conference are presented. The abstracts are arranged under sessions entitled:Theoretical Physics; Nuclear Physics; Solid State Physics; Spectroscopy; Physics Education; SANCGASS; Astronomy; Plasma Physics; Physics in Industry; Applied and General Physics.
International Nuclear Information System (INIS)
1975-01-01
Abstracts of the papers given at the conference are presented. The abstracts are arranged under sessions entitled:Theoretical Physics; Nuclear Physics; Solid State Physics; Spectroscopy; Physics Education; SANCGASS; Astronomy; Plasma Physics; Physics in Industry; Applied and General Physics
International Nuclear Information System (INIS)
1976-01-01
Abstracts of the papers given at the conference are presented. The abstracts are arranged under sessions entitled: Theoretical Physics; Nuclear Physics; Solid State Physics; Spectroscopy; Plasma Physics; Solar-Terrestrial Physics; Astrophysics and Astronomy; Radioastronomy; General Physics; Applied Physics; Industrial Physics
Introduction to abstract algebra
Nicholson, W Keith
2012-01-01
Praise for the Third Edition ". . . an expository masterpiece of the highest didactic value that has gained additional attractivity through the various improvements . . ."-Zentralblatt MATH The Fourth Edition of Introduction to Abstract Algebra continues to provide an accessible approach to the basic structures of abstract algebra: groups, rings, and fields. The book's unique presentation helps readers advance to abstract theory by presenting concrete examples of induction, number theory, integers modulo n, and permutations before the abstract structures are defined. Readers can immediately be
International Nuclear Information System (INIS)
Aparo, M.; Dionisi, M.; Vicini, C.; Zeppa, P.; Frazzoli, F.V.; Remetti, R.; Portale, C.
1989-01-01
Nuclear Material Accountability, supported by Containment and Surveillance measures, is a foundamental means for an effective International Safeguard implemention in nuclear plants. Accountability is based on the verification that difference between a material quantity entering a given material balance and the quantity leaving that area in a given period of time, correspond and the amount of material actually present at the moment of the inspection. In the recent years International Safeguards appealing to the needs of timeliness in detecting diversion and concealing activities, devoted ReD efforts on a new Dynamic Accountability procedures (NRTMA) with particular concern with reprocessing plants. The present paper, which is the result of a research activity carried out in the frame of the Italian Support Programme to IAEA for Safeguards implementation, deals with a feasibility study of a NRTMA system to be applied to the EUREX pilot reprocessing plant. Such a feasibility study was performed by developing a computer program based on simulated plant generated data
Abstracting Concepts and Methods.
Borko, Harold; Bernier, Charles L.
This text provides a complete discussion of abstracts--their history, production, organization, publication--and of indexing. Instructions for abstracting are outlined, and standards and criteria for abstracting are stated. Management, automation, and personnel are discussed in terms of possible economies that can be derived from the introduction…
Biogeochemical prospecting for uranium with conifers: results from the Midnite mine area, Washington
International Nuclear Information System (INIS)
Nash, J.T.; Ward, F.N.
1977-01-01
The ash of needles, cones, and duff from Ponderosa pine (Pinus ponderosa Laws) growing near uranium deposits of the Midnite mine, Stevens County, Wash., contain as much as 200 ppM uranium. Needle samples containing more than 10 ppM uranium define zones that correlate well with known uranium deposits or dumps. Dispersion is as much as 300 m but generally is less. Background is about 1 ppM. Tree roots are judged to be sampling ore, low-grade uranium halo, or ground water to a depth of about 15 m. Uptake of uranium by Douglas fir (Pseudotsuga menziesii (Mirb.) Franco) needles appears to be about the same as by Ponderosa pine needles. Cones and duff are generally enriched in uranium relative to needles. Needles, cones, and duff are recommended as easily collected, uncomplicated sample media for geochemical surveys. Samples can be analyzed by standard methods and total cost per sample kept to about $6
Completeness of Lyapunov Abstraction
Directory of Open Access Journals (Sweden)
Rafael Wisniewski
2013-08-01
Full Text Available In this work, we continue our study on discrete abstractions of dynamical systems. To this end, we use a family of partitioning functions to generate an abstraction. The intersection of sub-level sets of the partitioning functions defines cells, which are regarded as discrete objects. The union of cells makes up the state space of the dynamical systems. Our construction gives rise to a combinatorial object - a timed automaton. We examine sound and complete abstractions. An abstraction is said to be sound when the flow of the time automata covers the flow lines of the dynamical systems. If the dynamics of the dynamical system and the time automaton are equivalent, the abstraction is complete. The commonly accepted paradigm for partitioning functions is that they ought to be transversal to the studied vector field. We show that there is no complete partitioning with transversal functions, even for particular dynamical systems whose critical sets are isolated critical points. Therefore, we allow the directional derivative along the vector field to be non-positive in this work. This considerably complicates the abstraction technique. For understanding dynamical systems, it is vital to study stable and unstable manifolds and their intersections. These objects appear naturally in this work. Indeed, we show that for an abstraction to be complete, the set of critical points of an abstraction function shall contain either the stable or unstable manifold of the dynamical system.
Garrett, Paul B
2007-01-01
Designed for an advanced undergraduate- or graduate-level course, Abstract Algebra provides an example-oriented, less heavily symbolic approach to abstract algebra. The text emphasizes specifics such as basic number theory, polynomials, finite fields, as well as linear and multilinear algebra. This classroom-tested, how-to manual takes a more narrative approach than the stiff formalism of many other textbooks, presenting coherent storylines to convey crucial ideas in a student-friendly, accessible manner. An unusual feature of the text is the systematic characterization of objects by universal
Abstracts and abstracting a genre and set of skills for the twenty-first century
Koltay, Tibor
2010-01-01
Despite their changing role, abstracts remain useful in the digital world. Highly beneficial to information professionals and researchers who work and publish in different fields, this book summarizes the most important and up-to-date theory of abstracting, as well as giving advice and examples for the practice of writing different kinds of abstracts. The book discusses the length, the functions and basic structure of abstracts, outlining a new approach to informative and indicative abstracts. The abstractors' personality, their linguistic and non-linguistic knowledge and skills are also discu
DEFF Research Database (Denmark)
Brock-Nannestad, Taus; Schürmann, Carsten
2012-01-01
indefinitely, finding neither a proof nor a disproof of a given subgoal. In this paper we characterize a family of truth-preserving abstractions from intuitionistic first-order logic to the monadic fragment of classical first-order logic. Because they are truthful, these abstractions can be used to disprove...
Institute of Scientific and Technical Information of China (English)
2011-01-01
The Western Theories of War Ethics and Contemporary Controversies Li Xiaodong U Ruijing (4) [ Abstract] In the field of international relations, war ethics is a concept with distinct westem ideological color. Due to factors of history and reality, the in
International Nuclear Information System (INIS)
Dorado Delgado, Jennifer; Burbano Criollo, Juan Carlos; Molina Tabares, Jose Manuel; Carvajal Escobar, Yesid; Aristizabal, Hector Fabio
2006-01-01
In this study, space and time variability of monthly and annual rainfall was analyzed for the downstream influence zone of a Colombian supply-regulation reservoir, Sara-Brut, located on the Cauca valley department. Monthly precipitation data from 18 gauge stations and for a 29-year record (1975-2003) were used. These data were processed by means of time series completion, consistency analyses and sample statistics computations. Theoretical probabilistic distribution models such as Gumbel, normal, lognormal and wake by, and other empirical distributions such as Weibull and Landwehr were applied in order to fit the historical precipitation data set. The fit standard error (FSE) was used to test the goodness of fit of the theoretical distribution models and to choose the best of this probabilistic function. The wake by approach showed the best goodness of fit in 89% of the total gauges taken into account. Time variability was analyzed by means of wake by estimated values of monthly and annual precipitation associated with return periods of 1,052, 1,25, 2, 10, 20 and 50 years. Precipitation space variability is presents by means of ArcGis v8.3 and using krigging as interpolation method. In general terms the results obtained from this study show significant distribution variability in precipitation over the whole area, and particularity, the formation of dry and humid nucleus over the northeastern strip and microclimates at the southwestern and central zone of the study area were observed, depending on the season of year. The mentioned distribution pattern is likely caused by the influence of pacific wind streams, which come from the Andean western mountain range. It is expected that the results from this work be helpful for future planning and hydrologic project design
Alter, David; Grenache, David G; Bosler, David S; Karcher, Raymond E; Nichols, James; Rajadhyaksha, Aparna; Camelo-Piragua, Sandra; Rauch, Carol; Huddleston, Brent J; Frank, Elizabeth L; Sluss, Patrick M; Lewandrowski, Kent; Eichhorn, John H; Hall, Janet E; Rahman, Saud S; McPherson, Richard A; Kiechle, Frederick L; Hammett-Stabler, Catherine; Pierce, Kristin A; Kloehn, Erica A; Thomas, Patricia A; Walts, Ann E; Madan, Rashna; Schlesinger, Kathie; Nawgiri, Ranjana; Bhutani, Manoop; Kanber, Yonca; Abati, Andrea; Atkins, Kristen A; Farrar, Robert; Gopez, Evelyn Valencerina; Jhala, Darshana; Griffin, Sonya; Jhala, Khushboo; Jhala, Nirag; Bentz, Joel S; Emerson, Lyska; Chadwick, Barbara E; Barroeta, Julieta E; Baloch, Zubair W; Collins, Brian T; Middleton, Owen L; Davis, Gregory G; Haden-Pinneri, Kathryn; Chu, Albert Y; Keylock, Joren B; Ramoso, Robert; Thoene, Cynthia A; Stewart, Donna; Pierce, Arand; Barry, Michelle; Aljinovic, Nika; Gardner, David L; Barry, Michelle; Shields, Lisa B E; Arnold, Jack; Stewart, Donna; Martin, Erica L; Rakow, Rex J; Paddock, Christopher; Zaki, Sherif R; Prahlow, Joseph A; Stewart, Donna; Shields, Lisa B E; Rolf, Cristin M; Falzon, Andrew L; Hudacki, Rachel; Mazzella, Fermina M; Bethel, Melissa; Zarrin-Khameh, Neda; Gresik, M Vicky; Gill, Ryan; Karlon, William; Etzell, Joan; Deftos, Michael; Karlon, William J; Etzell, Joan E; Wang, Endi; Lu, Chuanyi M; Manion, Elizabeth; Rosenthal, Nancy; Wang, Endi; Lu, Chuanyi M; Tang, Patrick; Petric, Martin; Schade, Andrew E; Hall, Geraldine S; Oethinger, Margret; Hall, Geraldine; Picton, Avis R; Hoang, Linda; Imperial, Miguel Ranoa; Kibsey, Pamela; Waites, Ken; Duffy, Lynn; Hall, Geraldine S; Salangsang, Jo-Anne M; Bravo, Lulette Tricia C; Oethinger, Margaret D; Veras, Emanuela; Silva, Elvia; Vicens, Jimena; Silva, Elvio; Keylock, Joren; Hempel, James; Rushing, Elizabeth; Posligua, Lorena E; Deavers, Michael T; Nash, Jason W; Basturk, Olca; Perle, Mary Ann; Greco, Alba; Lee, Peng; Maru, Dipen; Weydert, Jamie Allen; Stevens, Todd M; Brownlee, Noel A; Kemper, April E; Williams, H James; Oliverio, Brock J; Al-Agha, Osama M; Eskue, Kyle L; Newlands, Shawn D; Eltorky, Mahmoud A; Puri, Puja K; Royer, Michael C; Rush, Walter L; Tavora, Fabio; Galvin, Jeffrey R; Franks, Teri J; Carter, James Elliot; Kahn, Andrea Graciela; Lozada Muñoz, Luis R; Houghton, Dan; Land, Kevin J; Nester, Theresa; Gildea, Jacob; Lefkowitz, Jerry; Lacount, Rachel A; Thompson, Hannis W; Refaai, Majed A; Quillen, Karen; Lopez, Ana Ortega; Goldfinger, Dennis; Muram, Talia; Thompson, Hannis
2009-02-01
The following abstracts are compiled from Check Sample exercises published in 2008. These peer-reviewed case studies assist laboratory professionals with continuing medical education and are developed in the areas of clinical chemistry, cytopathology, forensic pathology, hematology, microbiology, surgical pathology, and transfusion medicine. Abstracts for all exercises published in the program will appear annually in AJCP.
Owre, Sam; Shankar, Natarajan
1997-01-01
PVS (Prototype Verification System) is a general-purpose environment for developing specifications and proofs. This document deals primarily with the abstract datatype mechanism in PVS which generates theories containing axioms and definitions for a class of recursive datatypes. The concepts underlying the abstract datatype mechanism are illustrated using ordered binary trees as an example. Binary trees are described by a PVS abstract datatype that is parametric in its value type. The type of ordered binary trees is then presented as a subtype of binary trees where the ordering relation is also taken as a parameter. We define the operations of inserting an element into, and searching for an element in an ordered binary tree; the bulk of the report is devoted to PVS proofs of some useful properties of these operations. These proofs illustrate various approaches to proving properties of abstract datatype operations. They also describe the built-in capabilities of the PVS proof checker for simplifying abstract datatype expressions.
Charlton, Bruce G
2008-11-01
Perhaps the earliest authoritative measurement of a social class gradient in IQ, with a stratification of occupations among the parents of children with different IQs, is seen in two fascinating papers published in 1923 and 1929 in the British Journal of Psychology. The authors were GH Thomson and JF Duff (both of whom were later knighted) and the papers' main findings were confirmed by later researchers. Results of an intelligence test administered to 13419 children aged 11-12 were analyzed according to parent's occupation. The average children's IQ at extremes of social class among their parents included clergymen-121, teachers-116 and bankers and managers-112 at the upper end; while at the lower end there were 'cripples and invalids'-94, cattlemen-93, hawkers and chimneysweeps-91, and the 'insane, criminal'-88. More than 100 specific categories of parental occupations were then combined into 13 social classes, with their children's average IQ as follows: Professional-112; Managers-110; Higher Commercial-109; Army, Navy, Police, Postmen-106; Shopkeeping-105; Engineers [ie. apprenticed craftsmen, such as mining engineers]-103; Foremen-103; Building trades-102; Metal workers, shipbuilders-101; Miscellaneous industrial workers-101; Miners and quarrymen-98; Agriculture-98; Labourers-96. A follow-up study compared an 'intelligent' group (IQ 136 plus) with a matched IQ 95-105 'control' group. IQ testing at age 11-12 was predictive of teacher's reports of higher levels of intelligence and health at age 16; and better performance in official examinations. The occupations of fathers, grandfathers and uncles were consistent with occupation being indicative of 'an inherited quality' (i.e. IQ) and there was regression from parents to grandparents and uncles among the 'intelligent' but not among controls. Other findings included a wider variance in intelligence among boys than girls, and descriptions of the predictive value of IQ in estimating future education, examinations
Path integral formulation of the Hodge duality on the brane
International Nuclear Information System (INIS)
Hahn, Sang-Ok; Kiem, Youngjai; Kim, Yoonbai; Oh, Phillial
2001-01-01
In the warped compactification with a single Randall-Sundrum brane, a puzzling claim has been made that scalar fields can be bound to the brane but their Hodge dual higher-rank antisymmetric tensors cannot. By explicitly requiring the Hodge duality, a prescription to resolve this puzzle was recently proposed by Duff and Liu. In this Brief Report, we implement the Hodge duality via the path integral formulation in the presence of the background gravity fields of warped compactifications. It is shown that the prescription of Duff and Liu can be naturally understood within this framework
Robot-assisted laparoscopic myomectomy: current status
Arian,Sara; Munoz,Jessian; Kim,Suejin; Falcone,Tommaso
2017-01-01
Sara E Arian, Jessian L Munoz, Suejin Kim, Tommaso Falcone Department of Obstetrics, Gynecology, and Women’s Health Institute, Cleveland Clinic, Cleveland, OH, USA Abstract: Robotic-assisted surgery has seen a rapid development and integration in the field of gynecology. Since the approval of the use of robot for gynecological surgery and considering its several advantages over conventional laparoscopy, it has been widely incorporated especially in the field of reproductive surgery....
Gortais, Bernard
2003-07-29
In a given social context, artistic creation comprises a set of processes, which relate to the activity of the artist and the activity of the spectator. Through these processes we see and understand that the world is vaster than it is said to be. Artistic processes are mediated experiences that open up the world. A successful work of art expresses a reality beyond actual reality: it suggests an unknown world using the means and the signs of the known world. Artistic practices incorporate the means of creation developed by science and technology and change forms as they change. Artists and the public follow different processes of abstraction at different levels, in the definition of the means of creation, of representation and of perception of a work of art. This paper examines how the processes of abstraction are used within the framework of the visual arts and abstract painting, which appeared during a period of growing importance for the processes of abstraction in science and technology, at the beginning of the twentieth century. The development of digital platforms and new man-machine interfaces allow multimedia creations. This is performed under the constraint of phases of multidisciplinary conceptualization using generic representation languages, which tend to abolish traditional frontiers between the arts: visual arts, drama, dance and music.
DEFF Research Database (Denmark)
Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong
2014-01-01
in the field are often not detected. Thus, other and better markers of SARA are needed. The purpose of this research was to study the feces microbiome during SARA and assess the possibilities of using feces microbial markers as indicators of SARA. Methods: Six lactating, rumen cannulated, Danish Holstein cows...... were used in a blocked design study including two blocks. In the first block, two cows received control diet and two cows received SARA-challenge diet. In the second block, former control cows received SARA diet while two new cows received control diet. Cows received a total mixed ration (TMR; 24......% concentrate) for four weeks before the trial. SARA was induced by gradual substitution of 40% of TMR with grain pellets (50:50 wheat:barley) over 3 days. Full SARA diet was fed for four days. Rumen pH was measured continuously by indwelling probes (eCow). Feces samples were taken at 9 am and 9 pm on last day...
Completeness of Lyapunov Abstraction
DEFF Research Database (Denmark)
Wisniewski, Rafal; Sloth, Christoffer
2013-01-01
the vector field, which allows the generation of a complete abstraction. To compute the functions that define the subdivision of the state space in an algorithm, we formulate a sum of squares optimization problem. This optimization problem finds the best subdivisioning functions, with respect to the ability......This paper addresses the generation of complete abstractions of polynomial dynamical systems by timed automata. For the proposed abstraction, the state space is divided into cells by sublevel sets of functions. We identify a relation between these functions and their directional derivatives along...
Metaphor: Bridging embodiment to abstraction.
Jamrozik, Anja; McQuire, Marguerite; Cardillo, Eileen R; Chatterjee, Anjan
2016-08-01
Embodied cognition accounts posit that concepts are grounded in our sensory and motor systems. An important challenge for these accounts is explaining how abstract concepts, which do not directly call upon sensory or motor information, can be informed by experience. We propose that metaphor is one important vehicle guiding the development and use of abstract concepts. Metaphors allow us to draw on concrete, familiar domains to acquire and reason about abstract concepts. Additionally, repeated metaphoric use drawing on particular aspects of concrete experience can result in the development of new abstract representations. These abstractions, which are derived from embodied experience but lack much of the sensorimotor information associated with it, can then be flexibly applied to understand new situations.
Technical abstracts: Mechanical engineering, 1990
International Nuclear Information System (INIS)
Broesius, J.Y.
1991-01-01
This document is a compilation of the published, unclassified abstracts produced by mechanical engineers at Lawrence Livermore National Laboratory (LLNL) during the calendar year 1990. Many abstracts summarize work completed and published in report form. These are UCRL-JC series documents, which include the full text of articles to be published in journals and of papers to be presented at meetings, and UCID reports, which are informal documents. Not all UCIDs contain abstracts: short summaries were generated when abstracts were not included. Technical Abstracts also provides descriptions of those documents assigned to the UCRL-MI (miscellaneous) category. These are generally viewgraphs or photographs presented at meetings. An author index is provided at the back of this volume for cross referencing
The triconnected abstraction of process models
Polyvyanyy, Artem; Smirnov, Sergey; Weske, Mathias
2009-01-01
Contents: Artem Polyvanny, Sergey Smirnow, and Mathias Weske The Triconnected Abstraction of Process Models 1 Introduction 2 Business Process Model Abstraction 3 Preliminaries 4 Triconnected Decomposition 4.1 Basic Approach for Process Component Discovery 4.2 SPQR-Tree Decomposition 4.3 SPQR-Tree Fragments in the Context of Process Models 5 Triconnected Abstraction 5.1 Abstraction Rules 5.2 Abstraction Algorithm 6 Related Work and Conclusions
A Modal-Logic Based Graph Abstraction
Bauer, J.; Boneva, I.B.; Kurban, M.E.; Rensink, Arend; Ehrig, H; Heckel, R.; Rozenberg, G.; Taentzer, G.
2008-01-01
Infinite or very large state spaces often prohibit the successful verification of graph transformation systems. Abstract graph transformation is an approach that tackles this problem by abstracting graphs to abstract graphs of bounded size and by lifting application of productions to abstract
Seismic Consequence Abstraction
International Nuclear Information System (INIS)
Gross, M.
2004-01-01
The primary purpose of this model report is to develop abstractions for the response of engineered barrier system (EBS) components to seismic hazards at a geologic repository at Yucca Mountain, Nevada, and to define the methodology for using these abstractions in a seismic scenario class for the Total System Performance Assessment - License Application (TSPA-LA). A secondary purpose of this model report is to provide information for criticality studies related to seismic hazards. The seismic hazards addressed herein are vibratory ground motion, fault displacement, and rockfall due to ground motion. The EBS components are the drip shield, the waste package, and the fuel cladding. The requirements for development of the abstractions and the associated algorithms for the seismic scenario class are defined in ''Technical Work Plan For: Regulatory Integration Modeling of Drift Degradation, Waste Package and Drip Shield Vibratory Motion and Seismic Consequences'' (BSC 2004 [DIRS 171520]). The development of these abstractions will provide a more complete representation of flow into and transport from the EBS under disruptive events. The results from this development will also address portions of integrated subissue ENG2, Mechanical Disruption of Engineered Barriers, including the acceptance criteria for this subissue defined in Section 2.2.1.3.2.3 of the ''Yucca Mountain Review Plan, Final Report'' (NRC 2003 [DIRS 163274])
Seismic Consequence Abstraction
Energy Technology Data Exchange (ETDEWEB)
M. Gross
2004-10-25
The primary purpose of this model report is to develop abstractions for the response of engineered barrier system (EBS) components to seismic hazards at a geologic repository at Yucca Mountain, Nevada, and to define the methodology for using these abstractions in a seismic scenario class for the Total System Performance Assessment - License Application (TSPA-LA). A secondary purpose of this model report is to provide information for criticality studies related to seismic hazards. The seismic hazards addressed herein are vibratory ground motion, fault displacement, and rockfall due to ground motion. The EBS components are the drip shield, the waste package, and the fuel cladding. The requirements for development of the abstractions and the associated algorithms for the seismic scenario class are defined in ''Technical Work Plan For: Regulatory Integration Modeling of Drift Degradation, Waste Package and Drip Shield Vibratory Motion and Seismic Consequences'' (BSC 2004 [DIRS 171520]). The development of these abstractions will provide a more complete representation of flow into and transport from the EBS under disruptive events. The results from this development will also address portions of integrated subissue ENG2, Mechanical Disruption of Engineered Barriers, including the acceptance criteria for this subissue defined in Section 2.2.1.3.2.3 of the ''Yucca Mountain Review Plan, Final Report'' (NRC 2003 [DIRS 163274]).
Modal abstractions of concurrent behavior
DEFF Research Database (Denmark)
Nielson, Flemming; Nanz, Sebastian; Nielson, Hanne Riis
2011-01-01
We present an effective algorithm for the automatic construction of finite modal transition systems as abstractions of potentially infinite concurrent processes. Modal transition systems are recognized as valuable abstractions for model checking because they allow for the validation as well...... as refutation of safety and liveness properties. However, the algorithmic construction of finite abstractions from potentially infinite concurrent processes is a missing link that prevents their more widespread usage for model checking of concurrent systems. Our algorithm is a worklist algorithm using concepts...... from abstract interpretation and operating upon mappings from sets to intervals in order to express simultaneous over- and underapprox-imations of the multisets of process actions available in a particular state. We obtain a finite abstraction that is 3-valued in both states and transitions...
The deleuzian abstract machines
DEFF Research Database (Denmark)
Werner Petersen, Erik
2005-01-01
To most people the concept of abstract machines is connected to the name of Alan Turing and the development of the modern computer. The Turing machine is universal, axiomatic and symbolic (E.g. operating on symbols). Inspired by Foucault, Deleuze and Guattari extended the concept of abstract...
Typesafe Abstractions for Tensor Operations
Chen, Tongfei
2017-01-01
We propose a typesafe abstraction to tensors (i.e. multidimensional arrays) exploiting the type-level programming capabilities of Scala through heterogeneous lists (HList), and showcase typesafe abstractions of common tensor operations and various neural layers such as convolution or recurrent neural networks. This abstraction could lay the foundation of future typesafe deep learning frameworks that runs on Scala/JVM.
International Nuclear Information System (INIS)
Leigh, C.
2000-01-01
The purpose of the inventory abstraction as directed by the development plan (CRWMS M and O 1999b) is to: (1) Interpret the results of a series of relative dose calculations (CRWMS M and O 1999c, 1999d). (2) Recommend, including a basis thereof, a set of radionuclides that should be modeled in the Total System Performance Assessment in Support of the Site Recommendation (TSPA-SR) and the Total System Performance Assessment in Support of the Final Environmental Impact Statement (TSPA-FEIS). (3) Provide initial radionuclide inventories for the TSPA-SR and TSPA-FEIS models. (4) Answer the U.S. Nuclear Regulatory Commission (NRC)'s Issue Resolution Status Report ''Key Technical Issue: Container Life and Source Term'' (CLST IRSR) (NRC 1999) key technical issue (KTI): ''The rate at which radionuclides in SNF [Spent Nuclear Fuel] are released from the EBS [Engineered Barrier System] through the oxidation and dissolution of spent fuel'' (Subissue 3). The scope of the radionuclide screening analysis encompasses the period from 100 years to 10,000 years after the potential repository at Yucca Mountain is sealed for scenarios involving the breach of a waste package and subsequent degradation of the waste form as required for the TSPA-SR calculations. By extending the time period considered to one million years after repository closure, recommendations are made for the TSPA-FEIS. The waste forms included in the inventory abstraction are Commercial Spent Nuclear Fuel (CSNF), DOE Spent Nuclear Fuel (DSNF), High-Level Waste (HLW), naval Spent Nuclear Fuel (SNF), and U.S. Department of Energy (DOE) plutonium waste. The intended use of this analysis is in TSPA-SR and TSPA-FEIS. Based on the recommendations made here, models for release, transport, and possibly exposure will be developed for the isotopes that would be the highest contributors to the dose given a release to the accessible environment. The inventory abstraction is important in assessing system performance because
Nuclear medicine. Abstracts; Nuklearmedizin 2000. Abstracts
Energy Technology Data Exchange (ETDEWEB)
Anon.
2000-07-01
This issue of the journal contains the abstracts of the 183 conference papers as well as 266 posters presented at the conference. Subject fields covered are: Neurology, psychology, oncology, pediatrics, radiopharmacy, endocrinology, EDP, measuring equipment and methods, radiological protection, cardiology, and therapy. (orig./CB) [German] Die vorliegende Zeitschrift enthaelt die Kurzfassungen der 183 auf der Tagung gehaltenen Vortraege sowie der 226 praesentierten Poster, die sich mit den folgenden Themen befassten: Neurologie, Psychiatrie, Onkologie, Paediatrie, Radiopharmazie, Endokrinologie, EDV, Messtechnik, Strahlenschutz, Kardiologie sowie Therapie. (MG)
Mechanical Engineering Department technical abstracts
International Nuclear Information System (INIS)
Denney, R.M.
1982-01-01
The Mechanical Engineering Department publishes listings of technical abstracts twice a year to inform readers of the broad range of technical activities in the Department, and to promote an exchange of ideas. Details of the work covered by an abstract may be obtained by contacting the author(s). Overall information about current activities of each of the Department's seven divisions precedes the technical abstracts
Constraint-Based Abstract Semantics for Temporal Logic
DEFF Research Database (Denmark)
Banda, Gourinath; Gallagher, John Patrick
2010-01-01
Abstract interpretation provides a practical approach to verifying properties of infinite-state systems. We apply the framework of abstract interpretation to derive an abstract semantic function for the modal mu-calculus, which is the basis for abstract model checking. The abstract semantic funct...
EBS Radionuclide Transport Abstraction
International Nuclear Information System (INIS)
Schreiner, R.
2001-01-01
The purpose of this work is to develop the Engineered Barrier System (EBS) radionuclide transport abstraction model, as directed by a written development plan (CRWMS M and O 1999a). This abstraction is the conceptual model that will be used to determine the rate of release of radionuclides from the EBS to the unsaturated zone (UZ) in the total system performance assessment-license application (TSPA-LA). In particular, this model will be used to quantify the time-dependent radionuclide releases from a failed waste package (WP) and their subsequent transport through the EBS to the emplacement drift wall/UZ interface. The development of this conceptual model will allow Performance Assessment Operations (PAO) and its Engineered Barrier Performance Department to provide a more detailed and complete EBS flow and transport abstraction. The results from this conceptual model will allow PA0 to address portions of the key technical issues (KTIs) presented in three NRC Issue Resolution Status Reports (IRSRs): (1) the Evolution of the Near-Field Environment (ENFE), Revision 2 (NRC 1999a), (2) the Container Life and Source Term (CLST), Revision 2 (NRC 1999b), and (3) the Thermal Effects on Flow (TEF), Revision 1 (NRC 1998). The conceptual model for flow and transport in the EBS will be referred to as the ''EBS RT Abstraction'' in this analysis/modeling report (AMR). The scope of this abstraction and report is limited to flow and transport processes. More specifically, this AMR does not discuss elements of the TSPA-SR and TSPA-LA that relate to the EBS but are discussed in other AMRs. These elements include corrosion processes, radionuclide solubility limits, waste form dissolution rates and concentrations of colloidal particles that are generally represented as boundary conditions or input parameters for the EBS RT Abstraction. In effect, this AMR provides the algorithms for transporting radionuclides using the flow geometry and radionuclide concentrations determined by other
African Journals Online (AJOL)
Abstract. Simple learning tools to improve clinical laboratory practical skills training. B Taye, BSc, MPH. Addis Ababa University, College of Health Sciences, Addis Ababa, ... concerns about the competence of medical laboratory science graduates. ... standardised practical learning guides and assessment checklists would.
Water Pollution Abstracts. Volume 43, Number 4, Abstracts 645-849.
WATER POLLUTION, *ABSTRACTS, PURIFICATION, WASTES(INDUSTRIAL), CONTROL, SEWAGE, WATER SUPPLIES, PUBLIC HEALTH, PETROLEUM PRODUCTS, DEGRADATION, DAMS...ESTUARIES, PLANKTON, PHOTOSYNTHESIS, VIRUSES, SEA WATER , MICROBIOLOGY, UNITED KINGDOM.
International Nuclear Information System (INIS)
Ragan, G.
2001-01-01
The purpose of the inventory abstraction, which has been prepared in accordance with a technical work plan (CRWMS M andO 2000e for/ICN--02 of the present analysis, and BSC 2001e for ICN 03 of the present analysis), is to: (1) Interpret the results of a series of relative dose calculations (CRWMS M andO 2000c, 2000f). (2) Recommend, including a basis thereof, a set of radionuclides that should be modeled in the Total System Performance Assessment in Support of the Site Recommendation (TSPA-SR) and the Total System Performance Assessment in Support of the Final Environmental Impact Statement (TSPA-FEIS). (3) Provide initial radionuclide inventories for the TSPA-SR and TSPA-FEIS models. (4) Answer the U.S. Nuclear Regulatory Commission (NRC)'s Issue Resolution Status Report ''Key Technical Issue: Container Life and Source Term'' (CLST IRSR) key technical issue (KTI): ''The rate at which radionuclides in SNF [spent nuclear fuel] are released from the EBS [engineered barrier system] through the oxidation and dissolution of spent fuel'' (NRC 1999, Subissue 3). The scope of the radionuclide screening analysis encompasses the period from 100 years to 10,000 years after the potential repository at Yucca Mountain is sealed for scenarios involving the breach of a waste package and subsequent degradation of the waste form as required for the TSPA-SR calculations. By extending the time period considered to one million years after repository closure, recommendations are made for the TSPA-FEIS. The waste forms included in the inventory abstraction are Commercial Spent Nuclear Fuel (CSNF), DOE Spent Nuclear Fuel (DSNF), High-Level Waste (HLW), naval Spent Nuclear Fuel (SNF), and U.S. Department of Energy (DOE) plutonium waste. The intended use of this analysis is in TSPA-SR and TSPA-FEIS. Based on the recommendations made here, models for release, transport, and possibly exposure will be developed for the isotopes that would be the highest contributors to the dose given a release
Novak, Gordon S., Jr.
GLISP is a high-level computer language (based on Lisp and including Lisp as a sublanguage) which is compiled into Lisp. GLISP programs are compiled relative to a knowledge base of object descriptions, a form of abstract datatypes. A primary goal of the use of abstract datatypes in GLISP is to allow program code to be written in terms of objects,…
Knowledge acquisition for temporal abstraction.
Stein, A; Musen, M A; Shahar, Y
1996-01-01
Temporal abstraction is the task of detecting relevant patterns in data over time. The knowledge-based temporal-abstraction method uses knowledge about a clinical domain's contexts, external events, and parameters to create meaningful interval-based abstractions from raw time-stamped clinical data. In this paper, we describe the acquisition and maintenance of domain-specific temporal-abstraction knowledge. Using the PROTEGE-II framework, we have designed a graphical tool for acquiring temporal knowledge directly from expert physicians, maintaining the knowledge in a sharable form, and converting the knowledge into a suitable format for use by an appropriate problem-solving method. In initial tests, the tool offered significant gains in our ability to rapidly acquire temporal knowledge and to use that knowledge to perform automated temporal reasoning.
Nuclear code abstracts (1975 edition)
International Nuclear Information System (INIS)
Akanuma, Makoto; Hirakawa, Takashi
1976-02-01
Nuclear Code Abstracts is compiled in the Nuclear Code Committee to exchange information of the nuclear code developments among members of the committee. Enlarging the collection, the present one includes nuclear code abstracts obtained in 1975 through liaison officers of the organizations in Japan participating in the Nuclear Energy Agency's Computer Program Library at Ispra, Italy. The classification of nuclear codes and the format of code abstracts are the same as those in the library. (auth.)
Abstract Interpretation and Attribute Gramars
DEFF Research Database (Denmark)
Rosendahl, Mads
The objective of this thesis is to explore the connections between abstract interpretation and attribute grammars as frameworks in program analysis. Abstract interpretation is a semantics-based program analysis method. A large class of data flow analysis problems can be expressed as non-standard ...... is presented in the thesis. Methods from abstract interpretation can also be used in correctness proofs of attribute grammars. This proof technique introduces a new class of attribute grammars based on domain theory. This method is illustrated with examples....
Directory of Open Access Journals (Sweden)
Liana Ermakova
2018-05-01
Full Text Available An abstract is not only a mirror of the full article; it also aims to draw attention to the most important information of the document it summarizes. Many studies have compared abstracts with full texts for their informativeness. In contrast to previous studies, we propose to investigate this relation based not only on the amount of information given by the abstract but also on its importance. The main objective of this paper is to introduce a new metric called GEM to measure the “generosity” or representativeness of an abstract. Schematically speaking, a generous abstract should have the best possible score of similarity for the sections important to the reader. Based on a questionnaire gathering information from 630 researchers, we were able to weight sections according to their importance. In our approach, seven sections were first automatically detected in the full text. The accuracy of this classification into sections was above 80% compared with a dataset of documents where sentences were assigned to sections by experts. Second, each section was weighted according to the questionnaire results. The GEM score was then calculated as a sum of weights of sections in the full text corresponding to sentences in the abstract normalized over the total sum of weights of sections in the full text. The correlation between GEM score and the mean of the scores assigned by annotators was higher than the correlation between scores from different experts. As a case study, the GEM score was calculated for 36,237 articles in environmental sciences (1930–2013 retrieved from the French ISTEX database. The main result was that GEM score has increased over time. Moreover, this trend depends on subject area and publisher. No correlation was found between GEM score and citation rate or open access status of articles. We conclude that abstracts are more generous in recent publications and cannot be considered as mere teasers. This research should be pursued
Efficient abstraction selection in reinforcement learning
Seijen, H. van; Whiteson, S.; Kester, L.
2013-01-01
This paper introduces a novel approach for abstraction selection in reinforcement learning problems modelled as factored Markov decision processes (MDPs), for which a state is described via a set of state components. In abstraction selection, an agent must choose an abstraction from a set of
Indico CONFERENCE: Define the Call for Abstracts
CERN. Geneva; Ferreira, Pedro
2017-01-01
In this tutorial, you will learn how to define and open a call for abstracts. When defining a call for abstracts, you will be able to define settings related to the type of questions asked during a review of an abstract, select the users who will review the abstracts, decide when to open the call for abstracts, and more.
Introduction to abstract algebra, solutions manual
Nicholson, W Keith
2012-01-01
Praise for the Third Edition ". . . an expository masterpiece of the highest didactic value that has gained additional attractivity through the various improvements . . ."-Zentralblatt MATH The Fourth Edition of Introduction to Abstract Algebra continues to provide an accessible approach to the basic structures of abstract algebra: groups, rings, and fields. The book's unique presentation helps readers advance to abstract theory by presenting concrete examples of induction, number theory, integers modulo n, and permutations before the abstract structures are defined. Readers can immediately be
Abstracts of contributed papers
Energy Technology Data Exchange (ETDEWEB)
1994-08-01
This volume contains 571 abstracts of contributed papers to be presented during the Twelfth US National Congress of Applied Mechanics. Abstracts are arranged in the order in which they fall in the program -- the main sessions are listed chronologically in the Table of Contents. The Author Index is in alphabetical order and lists each paper number (matching the schedule in the Final Program) with its corresponding page number in the book.
Energy Technology Data Exchange (ETDEWEB)
Moretti, F; Belardelli, F [Department of Cell Biology and Neurosciences, Istituto Superiore di Sanita, Rome (Italy); Romero, M [Alleanza Contro il Cancro, Rome, (Italy)
2008-07-01
This multidisciplinary international meeting is organized by the Istituto Superiore di Sanita, in collaboration with Alleanza Contro il Cancro (Alliance Against Cancer, the Network of the Italian Comprehensive Cancer Centres) and EATRIS (European Advanced Translational Research Infrastructure in Medicine). The primary goal of the meeting is to provide a scientific forum to discuss the recent progress in translational research. Moreover, a particular focus will be devoted to the identification of needs, obstacles and new opportunities to promote translational research in biomedicine. The scientific programme will cover a broad range of fields including: cancer; neurosciences; rare diseases; cardiovascular diseases and infectious and autoimmune diseases. Furthermore, special attention will be given to the discussion of how comprehensive initiatives for addressing critical regulatory issues for First-In-Man - Phase I clinical studies can potentially improve the efficiency and quality of biomedical and translational research at an international level. [Italian] Questo convegno internazionale multidisciplinare e organizzato dall'Istituto Superiore di Sanita, in collaborazione con Alleanza Contro il Cancro (la rete italiana degli IRCCS oncologici) ed EATRIS (European Advanced Translational Research Infrastructure in Medicine). L'obiettivo principale del convegno e di rappresentare un forum scientifico per lo scambio di informazioni e di opinioni sui nuovi progressi nel campo della ricerca traslazionale. Un interesse particolare sara rivolto inoltre all'identificazione dei bisogni, degli ostacoli e delle nuove opportunita per promuovere la ricerca traslazionale in biomedicina. Il programma scientifico coprira una vasta area di campi di ricerca, tra cui cancro, neuroscienze, malattie rare, malattie cardiovascolari, malattie infettive ed autoimmuni. Particolare attenzione sara rivolta poi al dibattito sul modo in cui iniziative di vasta portata, che riguardano gli aspetti
Advance Organizers: Concret Versus Abstract.
Corkill, Alice J.; And Others
1988-01-01
Two experiments examined the relative effects of concrete and abstract advance organizers on students' memory for subsequent prose. Results of the experiments are discussed in terms of the memorability, familiarity, and visualizability of concrete and abstract verbal materials. (JD)
Automata Learning through Counterexample Guided Abstraction Refinement
DEFF Research Database (Denmark)
Aarts, Fides; Heidarian, Faranak; Kuppens, Harco
2012-01-01
to a small set of abstract events that can be handled by automata learning tools. In this article, we show how such abstractions can be constructed fully automatically for a restricted class of extended finite state machines in which one can test for equality of data parameters, but no operations on data...... are allowed. Our approach uses counterexample-guided abstraction refinement: whenever the current abstraction is too coarse and induces nondeterministic behavior, the abstraction is refined automatically. Using Tomte, a prototype tool implementing our algorithm, we have succeeded to learn – fully......Abstraction is the key when learning behavioral models of realistic systems. Hence, in most practical applications where automata learning is used to construct models of software components, researchers manually define abstractions which, depending on the history, map a large set of concrete events...
Analysis of complex networks using aggressive abstraction.
Energy Technology Data Exchange (ETDEWEB)
Colbaugh, Richard; Glass, Kristin.; Willard, Gerald
2008-10-01
This paper presents a new methodology for analyzing complex networks in which the network of interest is first abstracted to a much simpler (but equivalent) representation, the required analysis is performed using the abstraction, and analytic conclusions are then mapped back to the original network and interpreted there. We begin by identifying a broad and important class of complex networks which admit abstractions that are simultaneously dramatically simplifying and property preserving we call these aggressive abstractions -- and which can therefore be analyzed using the proposed approach. We then introduce and develop two forms of aggressive abstraction: 1.) finite state abstraction, in which dynamical networks with uncountable state spaces are modeled using finite state systems, and 2.) onedimensional abstraction, whereby high dimensional network dynamics are captured in a meaningful way using a single scalar variable. In each case, the property preserving nature of the abstraction process is rigorously established and efficient algorithms are presented for computing the abstraction. The considerable potential of the proposed approach to complex networks analysis is illustrated through case studies involving vulnerability analysis of technological networks and predictive analysis for social processes.
Argonne Code Center: compilation of program abstracts
Energy Technology Data Exchange (ETDEWEB)
Butler, M.K.; DeBruler, M.; Edwards, H.S.
1976-08-01
This publication is the tenth supplement to, and revision of, ANL-7411. It contains additional abstracts and revisions to some earlier abstracts and other pages. Sections of the document are as follows: preface; history and acknowledgements; abstract format; recommended program package contents; program classification guide and thesaurus; and abstract collection. (RWR)
Argonne Code Center: compilation of program abstracts
International Nuclear Information System (INIS)
Butler, M.K.; DeBruler, M.; Edwards, H.S.
1976-08-01
This publication is the tenth supplement to, and revision of, ANL-7411. It contains additional abstracts and revisions to some earlier abstracts and other pages. Sections of the document are as follows: preface; history and acknowledgements; abstract format; recommended program package contents; program classification guide and thesaurus; and abstract collection
DEFF Research Database (Denmark)
Mödersheim, Sebastian Alexander
2010-01-01
The abstraction and over-approximation of protocols and web services by a set of Horn clauses is a very successful method in practice. It has however limitations for protocols and web services that are based on databases of keys, contracts, or even access rights, where revocation is possible, so...... that the set of true facts does not monotonically grow with the transitions. We extend the scope of these over-approximation methods by defining a new way of abstraction that can handle such databases, and we formally prove that the abstraction is sound. We realize a translator from a convenient specification...... language to standard Horn clauses and use the verifier ProVerif and the theorem prover SPASS to solve them. We show by a number of examples that this approach is practically feasible for wide variety of verification problems of security protocols and web services....
DEFF Research Database (Denmark)
Robering, Klaus
2014-01-01
Verbs do often take arguments of quite different types. In an orthodox type-theoretic framework this results in an extreme polysemy of many verbs. In this article, it is shown that this unwanted consequence can be avoided when a theory of "abstract objects" is adopted according to which these obj......Verbs do often take arguments of quite different types. In an orthodox type-theoretic framework this results in an extreme polysemy of many verbs. In this article, it is shown that this unwanted consequence can be avoided when a theory of "abstract objects" is adopted according to which...... these objects represent non-objectual entities in contexts from which they are excluded by type restrictions. Thus these objects are "abstract'' in a functional rather than in an ontological sense: they function as representatives of other entities but they are otherwise quite normal objects. Three examples...
Argonne Code Center: compilation of program abstracts
Energy Technology Data Exchange (ETDEWEB)
Butler, M.K.; DeBruler, M.; Edwards, H.S.; Harrison, C. Jr.; Hughes, C.E.; Jorgensen, R.; Legan, M.; Menozzi, T.; Ranzini, L.; Strecok, A.J.
1977-08-01
This publication is the eleventh supplement to, and revision of, ANL-7411. It contains additional abstracts and revisions to some earlier abstracts and other pages. Sections of the complete document ANL-7411 are as follows: preface, history and acknowledgements, abstract format, recommended program package contents, program classification guide and thesaurus, and the abstract collection. (RWR)
Argonne Code Center: compilation of program abstracts
International Nuclear Information System (INIS)
Butler, M.K.; DeBruler, M.; Edwards, H.S.; Harrison, C. Jr.; Hughes, C.E.; Jorgensen, R.; Legan, M.; Menozzi, T.; Ranzini, L.; Strecok, A.J.
1977-08-01
This publication is the eleventh supplement to, and revision of, ANL-7411. It contains additional abstracts and revisions to some earlier abstracts and other pages. Sections of the complete document ANL-7411 are as follows: preface, history and acknowledgements, abstract format, recommended program package contents, program classification guide and thesaurus, and the abstract collection
Abstract concepts in grounded cognition
Lakens, D.
2010-01-01
When people think about highly abstract concepts, they draw upon concrete experiences to structure their thoughts. For example, black knights in fairytales are evil, and knights in shining armor are good. The sensory experiences black and white are used to represent the abstract concepts of good and
International Nuclear Information System (INIS)
Entsua-Mensah, C.
2004-01-01
This issue of the Ghana Science Abstracts combines in one publication all the country's bibliographic output in science and technology. The objective is to provide a quick reference source to facilitate the work of information professionals, research scientists, lecturers and policy makers. It is meant to give users an idea of the depth and scope and results of the studies and projects carried out. The scope and coverage comprise research outputs, conference proceedings and periodical articles published in Ghana. It does not capture those that were published outside Ghana. Abstracts reported have been grouped under the following subject areas: Agriculture, Biochemistry, Biodiversity conservation, biological sciences, biotechnology, chemistry, dentistry, engineering, environmental management, forestry, information management, mathematics, medicine, physics, nuclear science, pharmacy, renewable energy and science education
Building Safe Concurrency Abstractions
DEFF Research Database (Denmark)
Madsen, Ole Lehrmann
2014-01-01
Concurrent object-oriented programming in Beta is based on semaphores and coroutines and the ability to define high-level concurrency abstractions like monitors, and rendezvous-based communication, and their associated schedulers. The coroutine mechanism of SIMULA has been generalized into the no......Concurrent object-oriented programming in Beta is based on semaphores and coroutines and the ability to define high-level concurrency abstractions like monitors, and rendezvous-based communication, and their associated schedulers. The coroutine mechanism of SIMULA has been generalized...
Epimural indicator phylotypes of transiently-induced subacute ruminal acidosis in dairy cattle
Directory of Open Access Journals (Sweden)
Stefanie Urimare Wetzels
2016-03-01
Full Text Available The impact of a long-term subacute rumen acidosis (SARA on the bovine epimural bacterial microbiome (BEBM and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a one-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA isolation (4 sampling time points per cow: at the baseline before concentrate was fed, after the first SARA challenge, after the challenge break, and after the second SARA challenge. Ruminal pH was continuously monitored. The microbiome was determined using Illumina MiSeq sequencing of the 16S rRNA gene (V345 region. In total 1,215,618 sequences were obtained and clustered into 6,833 operational taxonomic units (OTUs. Campylobacter and Kingella were the most abundant OTUs (16.5% and 7.1%. According to ruminal pH dynamics, the second challenge was more severe than the first challenge. Species diversity estimates and evenness increased during the challenge break compared to all other sampling time points (P<0.05. During both SARA challenges, Kingella- and Azoarcus-OTUs decreased (0.5 and 0.4 fold-change and a dominant Ruminobacter-OTU increased during the challenge break (18.9 fold-change; P<0.05. qPCR confirmed SARA-related shifts. During the challenge break noticeably more OTUs increased compared to other sampling time points. Our results show that the BEBM re-establishes the baseline conditions slower after a SARA challenge than ruminal pH. Key phylotypes that were reduced during both challenges may help to establish a bacterial fingerprint to facilitate understanding effects of SARA conditions on the BEBM and their consequences for the ruminant host.
Epimural Indicator Phylotypes of Transiently-Induced Subacute Ruminal Acidosis in Dairy Cattle.
Wetzels, Stefanie U; Mann, Evelyne; Metzler-Zebeli, Barbara U; Pourazad, Poulad; Qumar, Muhammad; Klevenhusen, Fenja; Pinior, Beate; Wagner, Martin; Zebeli, Qendrim; Schmitz-Esser, Stephan
2016-01-01
The impact of a long-term subacute rumen acidosis (SARA) on the bovine epimural bacterial microbiome (BEBM) and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a 1-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA isolation (4 sampling time points per cow: at the baseline before concentrate was fed, after the first SARA challenge, after the challenge break, and after the second SARA challenge). Ruminal pH was continuously monitored. The microbiome was determined using Illumina MiSeq sequencing of the 16S rRNA gene (V345 region). In total 1,215,618 sequences were obtained and clustered into 6833 operational taxonomic units (OTUs). Campylobacter and Kingella were the most abundant OTUs (16.5 and 7.1%). According to ruminal pH dynamics, the second challenge was more severe than the first challenge. Species diversity estimates and evenness increased during the challenge break compared to all other sampling time points (P < 0.05). During both SARA challenges, Kingella- and Azoarcus-OTUs decreased (0.5 and 0.4 fold-change) and a dominant Ruminobacter-OTU increased during the challenge break (18.9 fold-change; P < 0.05). qPCR confirmed SARA-related shifts. During the challenge break noticeably more OTUs increased compared to other sampling time points. Our results show that the BEBM re-establishes the baseline conditions slower after a SARA challenge than ruminal pH. Key phylotypes that were reduced during both challenges may help to establish a bacterial fingerprint to facilitate understanding effects of SARA conditions on the BEBM and their consequences for the ruminant host.
Paducah Gaseous Diffusion Plant site environmental report for 1988
International Nuclear Information System (INIS)
Rogers, J.G.; Jett, T.G.
1989-05-01
Quantities of nonradiological chemical emissions are not included in this report this year. An addendum that will include the information will be published after the Superfund Amendments Reauthorization Act (SARA) Title III report is issued on July 1, 1989. When the addendum is published, probably in late July, a summary of the SARA Title III 313 report will be included. The SARA report provides the community with the opportunity to lean about estimated quantities of certain toxic chemicals used at a facility that are routinely or accidentally released into the environment. The addendum that will be published after the SARA report will summarize the SARA report and is expected to include some additional ''large quantity'' chemicals used or stored at the facilities that are not required to be reported by SARA Title III but are known to be emitted from the facilities. The addendum will not be all inclusive but will provide emissions information on the major chemical emissions to the air, water, or land from processes at the facilities
International Nuclear Information System (INIS)
Kusari, Souvik; Prabhakaran, Deivasigamani; Lamshoeft, Marc; Spiteller, Michael
2009-01-01
Fluoroquinolones like difloxacin (DIF) and sarafloxacin (SARA) are adsorbed in soil and enter the aquatic environment wherein they are subjected to photolytic degradation. To evaluate the fate of DIF and SARA, their photolysis was performed in water under stimulated natural sunlight conditions. DIF primarily degrades to SARA. On prolonged photodegradation, seven photoproducts were elucidated by HR-LC-MS/MS, three of which were entirely novel. The residual anti-bacterial activities of DIF, SARA and their photoproducts were studied against a group of pathogenic strains. DIF and SARA revealed potency against both Gram-positive and -negative bacteria. The photoproducts also exhibited varying degrees of efficacies against the tested bacteria. Even without isolating the individual photoproducts, their impact on the aquatic environment could be assessed. Therefore, the present results call for prudence in estimating the fate of these compounds in water and in avoiding emergence of resistance in bacteria caused by the photoproducts of DIF and SARA. - Assessment of the residual anti-bacterial efficacies of difloxacin, sarafloxacin and their photoproducts in water, and estimating their impact on the aquatic environment in inducing resistance to microorganisms.
Wulansari, Amalia Ayu; Lukmantoro, Triyono; Hasfi, Nurul
2013-01-01
Representation of Popular Culture in Jokowi-Ahok's Video Parodyson Youtube During Pemilukada DKI Jakarta 2012AbstractPemilukada DKI Jakarta 2012 was marked by the rise of videos that related toGovernor and Vice Governor candidates of DKI Jakarta 2012 on internet mediaYoutube, such as videos which is purposely made for campaign, or videos withSARA (etnic, religion, race and inter-group) issue, that attack one of the pair'scabdidates. The interesting point is videos made by partisipants and vol...
Russo, Emilio; Mumoli,Laura; Palleria,Caterina; Gasparini,Sara; Citraro,Rita; Labate,Angelo; Ferlazzo,Edoardo; Gambardella,Antonio; De Sarro,Giovambattista
2015-01-01
Laura Mumoli,1 Caterina Palleria,2 Sara Gasparini,1 Rita Citraro,2 Angelo Labate,1 Edoardo Ferlazzo,1 Antonio Gambardella,1 Giovambattista De Sarro,2 Emilio Russo2 1Institute of Neurology, 2Institute of Pharmacology, University Magna Græcia, Catanzaro, Italy Abstract: Brivaracetam (BRV), a high-affinity synaptic vesicle protein 2A ligand, reported to be 10–30-fold more potent than levetiracetam (LEV), is highly effective in a wide range of experimental models of focal an...
Hydrogen abstraction reactions by amide electron adducts
International Nuclear Information System (INIS)
Sevilla, M.D.; Sevilla, C.L.; Swarts, S.
1982-01-01
Electron reactions with a number of peptide model compounds (amides and N-acetylamino acids) in aqueous glasses at low temperature have been investigated using ESR spectroscopy. The radicals produced by electron attachment to amides, RC(OD)NDR', are found to act as hydrogen abstracting agents. For example, the propionamide electron adduct is found to abstract from its parent propionamide. Electron adducts of other amides investigated show similar behavior except for acetamide electron adduct which does not abstract from its parent compound, but does abstract from other amides. The tendency toward abstraction for amide electron adducts are compared to electron adducts of several carboxylic acids, ketones, aldehydes and esters. The comparison suggests the hydrogen abstraction tendency of the various deuterated electron adducts (DEAs) to be in the following order: aldehyde DEA > acid DEA = approximately ester DEA > ketone DEA > amide DEA. In basic glasses the hydrogen abstraction ability of the amide electron adducts is maintained until the concentration of base is increased sufficiently to convert the DEA to its anionic form, RC(O - )ND 2 . In this form the hydrogen abstracting ability of the radical is greatly diminished. Similar results were found for the ester and carboxylic acid DEA's tested. (author)
Minimalism in architecture: Abstract conceptualization of architecture
Directory of Open Access Journals (Sweden)
Vasilski Dragana
2015-01-01
Full Text Available Minimalism in architecture contains the idea of the minimum as a leading creative tend to be considered and interpreted in working through phenomena of empathy and abstraction. In the Western culture, the root of this idea is found in empathy of Wilhelm Worringer and abstraction of Kasimir Malevich. In his dissertation, 'Abstraction and Empathy' Worringer presented his thesis on the psychology of style through which he explained the two opposing basic forms: abstraction and empathy. His conclusion on empathy as a psychological basis of observation expression is significant due to the verbal congruence with contemporary minimalist expression. His intuition was enhenced furthermore by figure of Malevich. Abstraction, as an expression of inner unfettered inspiration, has played a crucial role in the development of modern art and architecture of the twentieth century. Abstraction, which is one of the basic methods of learning in psychology (separating relevant from irrelevant features, Carl Jung is used to discover ideas. Minimalism in architecture emphasizes the level of abstraction to which the individual functions are reduced. Different types of abstraction are present: in the form as well as function of the basic elements: walls and windows. The case study is an example of Sou Fujimoto who is unequivocal in its commitment to the autonomy of abstract conceptualization of architecture.
The Complexity of Abstract Machines
Directory of Open Access Journals (Sweden)
Beniamino Accattoli
2017-01-01
Full Text Available The lambda-calculus is a peculiar computational model whose definition does not come with a notion of machine. Unsurprisingly, implementations of the lambda-calculus have been studied for decades. Abstract machines are implementations schema for fixed evaluation strategies that are a compromise between theory and practice: they are concrete enough to provide a notion of machine and abstract enough to avoid the many intricacies of actual implementations. There is an extensive literature about abstract machines for the lambda-calculus, and yet—quite mysteriously—the efficiency of these machines with respect to the strategy that they implement has almost never been studied. This paper provides an unusual introduction to abstract machines, based on the complexity of their overhead with respect to the length of the implemented strategies. It is conceived to be a tutorial, focusing on the case study of implementing the weak head (call-by-name strategy, and yet it is an original re-elaboration of known results. Moreover, some of the observation contained here never appeared in print before.
Abstraction of man-made shapes
Mehra, Ravish; Zhou, Qingnan; Long, Jeremy; Sheffer, Alla; Gooch, Amy Ashurst; Mitra, Niloy J.
2009-01-01
Man-made objects are ubiquitous in the real world and in virtual environments. While such objects can be very detailed, capturing every small feature, they are often identified and characterized by a small set of defining curves. Compact, abstracted shape descriptions based on such curves are often visually more appealing than the original models, which can appear to be visually cluttered. We introduce a novel algorithm for abstracting three-dimensional geometric models using characteristic curves or contours as building blocks for the abstraction. Our method robustly handles models with poor connectivity, including the extreme cases of polygon soups, common in models of man-made objects taken from online repositories. In our algorithm, we use a two-step procedure that first approximates the input model using a manifold, closed envelope surface and then extracts from it a hierarchical abstraction curve network along with suitable normal information. The constructed curve networks form a compact, yet powerful, representation for the input shapes, retaining their key shape characteristics while discarding minor details and irregularities. © 2009 ACM.
International Nuclear Information System (INIS)
1999-01-01
The document is a collection of the scientific meeting abstracts in the fields of nuclear physics, medical sciences, chemistry, agriculture, environment, engineering, different aspects of energy and presents research done in 1999 in these fields
DEFF Research Database (Denmark)
2014-01-01
Verbs do often take arguments of quite different types. In an orthodox type-theoretic framework this results in an extreme polysemy of many verbs. In this article, it is shown that this unwanted consequence can be avoided when a theory of "abstract objects" is adopted according to which...... these objects represent non-objectual entities in contexts from which they are excluded by type restrictions. Thus these objects are "abstract'' in a functional rather than in an ontological sense: they function as representatives of other entities but they are otherwise quite normal objects. Three examples...
Directory of Open Access Journals (Sweden)
Ian J. Saldanha
2016-11-01
Full Text Available Abstract Background Data abstraction, a critical systematic review step, is time-consuming and prone to errors. Current standards for approaches to data abstraction rest on a weak evidence base. We developed the Data Abstraction Assistant (DAA, a novel software application designed to facilitate the abstraction process by allowing users to (1 view study article PDFs juxtaposed to electronic data abstraction forms linked to a data abstraction system, (2 highlight (or “pin” the location of the text in the PDF, and (3 copy relevant text from the PDF into the form. We describe the design of a randomized controlled trial (RCT that compares the relative effectiveness of (A DAA-facilitated single abstraction plus verification by a second person, (B traditional (non-DAA-facilitated single abstraction plus verification by a second person, and (C traditional independent dual abstraction plus adjudication to ascertain the accuracy and efficiency of abstraction. Methods This is an online, randomized, three-arm, crossover trial. We will enroll 24 pairs of abstractors (i.e., sample size is 48 participants, each pair comprising one less and one more experienced abstractor. Pairs will be randomized to abstract data from six articles, two under each of the three approaches. Abstractors will complete pre-tested data abstraction forms using the Systematic Review Data Repository (SRDR, an online data abstraction system. The primary outcomes are (1 proportion of data items abstracted that constitute an error (compared with an answer key and (2 total time taken to complete abstraction (by two abstractors in the pair, including verification and/or adjudication. Discussion The DAA trial uses a practical design to test a novel software application as a tool to help improve the accuracy and efficiency of the data abstraction process during systematic reviews. Findings from the DAA trial will provide much-needed evidence to strengthen current recommendations for data
Abstract Spatial Reasoning as an Autistic Strength
Stevenson, Jennifer L.; Gernsbacher, Morton Ann
2013-01-01
Autistic individuals typically excel on spatial tests that measure abstract reasoning, such as the Block Design subtest on intelligence test batteries and the Raven’s Progressive Matrices nonverbal test of intelligence. Such well-replicated findings suggest that abstract spatial processing is a relative and perhaps absolute strength of autistic individuals. However, previous studies have not systematically varied reasoning level – concrete vs. abstract – and test domain – spatial vs. numerical vs. verbal, which the current study did. Autistic participants (N = 72) and non-autistic participants (N = 72) completed a battery of 12 tests that varied by reasoning level (concrete vs. abstract) and domain (spatial vs. numerical vs. verbal). Autistic participants outperformed non-autistic participants on abstract spatial tests. Non-autistic participants did not outperform autistic participants on any of the three domains (spatial, numerical, and verbal) or at either of the two reasoning levels (concrete and abstract), suggesting similarity in abilities between autistic and non-autistic individuals, with abstract spatial reasoning as an autistic strength. PMID:23533615
The use of sodic monensin and probiotics for controlling subacute ruminal acidosis in sheep
Directory of Open Access Journals (Sweden)
Elizabeth Schwegler
2015-02-01
Full Text Available The aim of this work was to validate a protocol for induction of subacute ruminal acidosis (SARA (Experiment 1 and test the efficiency of probiotic Saccharomyces cerevisiae or monensin to avoid pH ruminal drops in sheep (Experiment 2. In Experiment 1, six ewes were fasted for two days and then fed most with concentrate during four days. Ewes in this protocol had ruminal fluid pH below 6.0 and kept it for 75 consecutive hours. In Experiment 2, 18 sheep were distributed into three groups: Control (CG, n = 6, monensin (MG, n = 6 and probiotic group (PG, n = 6. SARA was induced according Experiment 1. PG had lower pH (5.7 ± 0.1 than CG (6.0 ± 0.1 (P = 0.05, while MG (5.7 ± 0.1 was similar to both during SARA induction. SARA induction reduced ruminal protozoa population (P < 0.05 and increased chloride concentrations in ruminal fluid (P < 0.01. In serum, SARA increased concentrations of phosphorus (P < 0.01, AST (P < 0.01 and GGT (P < 0.01, but reduced LDH (P < 0.01. In conclusion, the protocol used for SARA induction was able to maintain ruminal pH between 5.5-6.0 for more than 48 hours. However, monensin and probiotics supplementation was not effective in preventing changes in ruminal and serum parameters during SARA.
International Nuclear Information System (INIS)
2000-01-01
the document is a collection of the science meeting abstracts in the fields of nuclear physics, medical sciences, chemistry, agriculture, environment, engineering, material sciences different aspects of energy and presents research done in 2000 in these fields
National fuel cell seminar. Program and abstracts. [Abstracts of 40 papers
Energy Technology Data Exchange (ETDEWEB)
None
1977-01-01
Abstracts of 40 papers are presented. Topics include fuel cell systems, phosphoric acid fuel cells, molten carbonate fuel cells, solid fuel and solid electrolyte fuel cells, low temperature fuel cells, and fuel utilization. (WHK)
Construct Abstraction for Automatic Information Abstraction from Digital Images
2006-05-30
objects and features and the names of objects of objects and features. For example, in Figure 15 the parts of the fish could be named the ‘mouth... fish -1 fish -2 fish -3 tennis shoe tennis racquet...of abstraction and generality. For example, an algorithm might usefully find a polygon ( blob ) in an image and calculate numbers such as the
Abstract methods in partial differential equations
Carroll, Robert W
2012-01-01
Detailed, self-contained treatment examines modern abstract methods in partial differential equations, especially abstract evolution equations. Suitable for graduate students with some previous exposure to classical partial differential equations. 1969 edition.
Mechanical Engineering Department technical abstracts
International Nuclear Information System (INIS)
1984-01-01
The Mechanical Engineering Department publishes abstracts twice a year to inform readers of the broad range of technical activities in the Department, and to promote an exchange of ideas. Details of the work covered by an abstract may be obtained by contacting the author(s). General information about the current role and activities of each of the Department's seven divisions precedes the technical abstracts. Further information about a division's work may be obtained from the division leader, whose name is given at the end of each divisional summary. The Department's seven divisions are as follows: Nuclear Test Engineering Division, Nuclear Explosives Engineering Division, Weapons Engineering Division, Energy Systems Engineering Division, Engineering Sciences Division, Magnetic Fusion Engineering Division and Materials Fabrication Division
Interdisciplinary perspectives on abstracts for information retrieval
Directory of Open Access Journals (Sweden)
Soon Keng Chan
2004-10-01
Full Text Available The paper examines the abstract genre from the perspectives of English for Specific Purposes (ESP practitioners and information professionals. It aims to determine specific interdisciplinary interests in the abstract, and to explore areas of collaboration in terms of research and pedagogical practices. A focus group (FG comprising information professionals from the Division of Information Studies, Nanyang Technological University, Singapore, convened for a discussion on the subject of abstracts and abstracting. Two major issues that have significant implications for ESP practices emerged during the discussion. While differences in terms of approach to and objectives of the abstract genre are apparent between information professionals and language professionals, the demands for specific cognitive processes involved in abstracting proved to be similar. This area of similarity provides grounds for awareness raising and collaboration between the two disciplines. While ESP practitioners need to consider adding the dimension of information science to the rhetorical and linguistic scaffolding that they have been providing to novice-writers, information professionals can contribute useful insights about the qualities of abstracts that have the greatest impact in meeting the end-users' needs in information search.
Journal of Engineering Education, 1972
1972-01-01
Includes abstracts of papers presented at the 80th Annual Conference of the American Society for Engineering Education. The broad areas include aerospace, affiliate and associate member council, agricultural engineering, biomedical engineering, continuing engineering studies, chemical engineering, civil engineering, computers, cooperative…
Institute of Scientific and Technical Information of China (English)
2017-01-01
Supplementary Short Board: Orderly Cultivate Housing Leasing Market WANG Guangtao (Former Minister of Ministry of Construction) Abstract: In December 2016, Central Economic Work Conference proposed that to promote the steady and healthy development of the real estate market, it should adhere to the “house is used to live, not used to speculate” position. At present, the development of housing leasing market in China is lagging behind. It is urgent to improve the housing conditions of large cities and promote the urbanization of small and medium-sized cities. Therefore, it is imperative to innovate and supplement the short board to accelerate the development of housing leasing market.
Abstracting audit data for lightweight intrusion detection
Wang, Wei
2010-01-01
High speed of processing massive audit data is crucial for an anomaly Intrusion Detection System (IDS) to achieve real-time performance during the detection. Abstracting audit data is a potential solution to improve the efficiency of data processing. In this work, we propose two strategies of data abstraction in order to build a lightweight detection model. The first strategy is exemplar extraction and the second is attribute abstraction. Two clustering algorithms, Affinity Propagation (AP) as well as traditional k-means, are employed to extract the exemplars, and Principal Component Analysis (PCA) is employed to abstract important attributes (a.k.a. features) from the audit data. Real HTTP traffic data collected in our institute as well as KDD 1999 data are used to validate the two strategies of data abstraction. The extensive test results show that the process of exemplar extraction significantly improves the detection efficiency and has a better detection performance than PCA in data abstraction. © 2010 Springer-Verlag.
75 FR 32684 - Proposed Flood Elevation Determinations
2010-06-09
... feet downstream of Duff Road. West Cane Run (Backwater effects From the confluence None +466 Unincorpor... Building, Leitchfield, KY 42754. Baltimore County, Maryland, and Incorporated Areas Gwynns Falls Just...
DEFF Research Database (Denmark)
Olesen, Henning Salling
2006-01-01
The anniversary of the International Journal of Lifelong Education takes place in the middle of a conceptual landslide from lifelong education to lifelong learning. Contemporary discourses of lifelong learning etc are however abstractions behind which new functions and agendas for adult education...
DEFF Research Database (Denmark)
Sergey, Ilya; Devriese, Dominique; Might, Matthew
2013-01-01
to instrument an analysis with high-level strategies for improving precision and performance, such as abstract garbage collection and widening. While the paper itself runs the development for continuationpassing style, our generic implementation replays it for direct-style lambda-calculus and Featherweight Java...
Abstractions for Fault-Tolerant Distributed System Verification
Pike, Lee S.; Maddalon, Jeffrey M.; Miner, Paul S.; Geser, Alfons
2004-01-01
Four kinds of abstraction for the design and analysis of fault tolerant distributed systems are discussed. These abstractions concern system messages, faults, fault masking voting, and communication. The abstractions are formalized in higher order logic, and are intended to facilitate specifying and verifying such systems in higher order theorem provers.
Abstract Interpretation as a Programming Language
DEFF Research Database (Denmark)
Rosendahl, Mads
2013-01-01
examine different programming styles and ways to represent states. Abstract interpretation is primarily a technique for derivation and specification of program analysis. As with denotational semantics we may also view abstract interpretations as programs and examine the implementation. The main focus...... in this paper is to show that results from higher-order strictness analysis may be used more generally as fixpoint operators for higher-order functions over lattices and thus provide a technique for immediate implementation of a large class of abstract interpretations. Furthermore, it may be seen...
International Nuclear Information System (INIS)
Anon.
2000-01-01
This issue of the journal contains the abstracts of the 183 conference papers as well as 266 posters presented at the conference. Subject fields covered are: Neurology, psychology, oncology, pediatrics, radiopharmacy, endocrinology, EDP, measuring equipment and methods, radiological protection, cardiology, and therapy. (orig./CB) [de
Abstract Machines for Programming Language Implementation
Diehl, Stephan; Hartel, Pieter H.; Sestoft, Peter
We present an extensive, annotated bibliography of the abstract machines designed for each of the main programming paradigms (imperative, object oriented, functional, logic and concurrent). We conclude that whilst a large number of efficient abstract machines have been designed for particular
Writing a Structured Abstract for the Thesis
Hartley, James
2010-01-01
This article presents the author's suggestions on how to improve thesis abstracts. The author describes two books on writing abstracts: (1) "Creating Effective Conference Abstracts and Posters in Biomedicine: 500 tips for Success" (Fraser, Fuller & Hutber, 2009), a compendium of clear advice--a must book to have in one's hand as one prepares a…
The Ecology of Second Language Acquisition and Socialization
DEFF Research Database (Denmark)
Steffensen, Sune Vork; Kramsch, Claire
2017-01-01
Various theories of second language acquisition (SLA) and socialization (SLS) have adopted ecology as a convenient metaphor to promote sociocultural (van Lier 2004) or sociocognitive (Atkinson 2011) approaches to the study of SLA, and socioethnographic approaches (Duff 2011; Duff and Talmy 2011...... such a development is to be welcomed, it also raises serious concerns about the autonomy of the language learner, the collective pressure on individuals to align with the expectations of the community, alternative theories of knowledge and of knowledge acquisition, and the socializing dominance of English around...... the world. This chapter discusses the history of the relationship between acquisition and socialization with regard to foreign/second language learning and use, and the role played by ecological theory in that relationship....
Greijdanus, Hedy; Postmes, Tom; Gordijn, Ernestine H.; van Zomeren, Martijn
2014-01-01
Two experiments investigated when perceivers can construe stereotype-inconsistent information abstractly (i.e., interpret observations as generalizable) and whether stereotype-consistency delimits the positive relation between abstract construal level and stereotyping. Participants (N1=104, N2=83)
Geometry of abstraction in quantum computation
Pavlovic, Dusko; Abramsky, S.; Mislove, M.W.
2012-01-01
Quantum algorithms are sequences of abstract operations, per formed on non-existent computers. They are in obvious need of categorical semantics. We present some steps in this direction, following earlier contribu tions of Abramsky, Goecke and Selinger. In particular, we analyze function abstraction
DEFF Research Database (Denmark)
Fortescue, Michael David
The main thesis of this book is that abstraction, far from being confined to higher formsof cognition, language and logical reasoning, has actually been a major driving forcethroughout the evolution of creatures with brains. It is manifest in emotive as well as rationalthought. Wending its way th...
Transport safety research abstracts. No. 1
International Nuclear Information System (INIS)
1991-07-01
The Transport Safety Research Abstracts is a collection of reports from Member States of the International Atomic Energy Agency, and other international organizations on research in progress or just completed in the area of safe transport of radioactive material. The main aim of TSRA is to draw attention to work that is about to be published, thus enabling interested parties to obtain further information through direct correspondence with the investigators. Information contained in this issue covers work being undertaken in 6 Member States and contracted by 1 international organization; it is hoped with succeeding issues that TSRA will be able to widen this base. TSRA is modelled after other IAEA publications describing work in progress in other programme areas, namely Health Physics Research Abstracts (No. 14 was published in 1989), Waste Management Research Abstracts (No. 20 was published in 1990), and Nuclear Safety Research Abstracts (No. 2 was published in 1990)
Sasha, ja gorda, tshto ja tvoi utshitel! / Boris Tuch
Tuch, Boris, 1946-
2001-01-01
18. mail toimub Vene Draamateatris rahvusvahelist stepipäeva tähistav kontsert. Korraldajaks on Duff-tap studio, mida juhendab Aleksandr Ivashkevitsh. Kontserdil osalevad Barbara Duffy (USA) ja Vladimir Kirsanov (Venemaa)
Abstract Object Creation in Dynamic Logic
I. Grabe (Immo); F.S. de Boer (Frank); W. Ahrendt (Wolfgang); A. Cavalcanti; D.R. Dams
2009-01-01
textabstractIn this paper we give a representation of a weakest precondition calculus for abstract object creation in dynamic logic, the logic underlying the KeY theorem prover. This representation allows to both specify and verify properties of objects at the abstraction level of the
Using fairness to make abstractions work
D. Bosnacki; N. Ioustinova (Natalia); N. Sidorova
2003-01-01
textabstractAbstractions often introduce infinite traces which have no corresponding traces at the concrete level and can lead to the failure of the verification. Refinement does not always help to eliminate those traces. In this paper, we consider a timer abstraction that introduces a cyclic
Ishaq, Suzanne L; AlZahal, Ousama; Walker, Nicola; McBride, Brian
2017-01-01
Sub-acute ruminal acidosis (SARA) is a gastrointestinal functional disorder in livestock characterized by low rumen pH, which reduces rumen function, microbial diversity, host performance, and host immune function. Dietary management is used to prevent SARA, often with yeast supplementation as a pH buffer. Almost nothing is known about the effect of SARA or yeast supplementation on ruminal protozoal and fungal diversity, despite their roles in fiber degradation. Dairy cows were switched from a high-fiber to high-grain diet abruptly to induce SARA, with and without active dry yeast (ADY, Saccharomyces cerevisiae ) supplementation, and sampled from the rumen fluid, solids, and epimural fractions to determine microbial diversity using the protozoal 18S rRNA and the fungal ITS1 genes via Illumina MiSeq sequencing. Diet-induced SARA dramatically increased the number and abundance of rare fungal taxa, even in fluid fractions where total reads were very low, and reduced protozoal diversity. SARA selected for more lactic-acid utilizing taxa, and fewer fiber-degrading taxa. ADY treatment increased fungal richness (OTUs) but not diversity (Inverse Simpson, Shannon), but increased protozoal richness and diversity in some fractions. ADY treatment itself significantly ( P PERMANOVA, P = 0.0001, P = 0.0452, P = 0.0068, Monte Carlo correction, respectively, and location was a significant factor ( P = 0.001, Monte Carlo correction) for protozoa. Diet-induced SARA shifts diversity of rumen fungi and protozoa and selects against fiber-degrading species. Supplementation with ADY mitigated this reduction in protozoa, presumptively by triggering microbial diversity shifts (as seen even in the high-fiber diet) that resulted in pH stabilization. ADY did not recover the initial community structure that was seen in pre-SARA conditions.
Compilation of Theses Abstracts
National Research Council Canada - National Science Library
2005-01-01
This publication contains unclassified/unrestricted abstracts of classified or restricted theses submitted for the degrees of Doctor of Philosophy, Master of Business Administration, Master of Science...
Data Abstraction Mechanisms in Sina/st
Meyrowitz, N.K.; Aksit, Mehmet; Tripathi, Anand
1988-01-01
This paper describes a new data abstraction mechanism in an object-oriented model of computing. The data abstraction mechanism described here has been devised in the context of the design of Sina/st language. In Sina/st no language constructs have been adopted for specifying inheritance or
8th Czechoslovak spectroscopic conference. Abstracts
International Nuclear Information System (INIS)
1988-01-01
Volume 2 of the conference proceedings contains abstracts of 17 invited papers and 119 poster presentations, devoted to molecular spectroscopy. Abstracts of 2 poster presentations were inputted in INIS, one dealing with organic complexes of 99 Tc, the other with electronic spectra of lanthanide ions. (A.K.)
Photochemical hydrogen abstractions as radiationless transitions
International Nuclear Information System (INIS)
Burrows, H.D.; Formosinho, S.J.
1977-01-01
The tunnel-effect theory of radiationless transitions is applied to the quenching of the uranyl ion excited state by aliphatic compounds. The most important mechanism kinetically is suggested to involve chemical quenching via hydrogen abstraction, and rates for these reactions are analysed theoretically. Good agreement between theory and experiment is observed for a number of alcohols and ethers, and the reactions are suggested to possess considerable charge-transfer character. With t-butanol it is suggested that abstraction occurs preferentially from the hydroxylic hydrogen. Theoretical analysis of the rates of hydrogen abstraction from carboxylic acids suggests that the reaction geometry in this case may be different from the reaction with alcohols or ethers. The possibility that excited uranyl ion can abstract a hydrogen atom from water is examined, and theoretical evidence is presented to suggest that this is the main route for deactivation of uranyl ion lowest excited state in water at room temperature. (author)
Mathematical Abstraction: Constructing Concept of Parallel Coordinates
Nurhasanah, F.; Kusumah, Y. S.; Sabandar, J.; Suryadi, D.
2017-09-01
Mathematical abstraction is an important process in teaching and learning mathematics so pre-service mathematics teachers need to understand and experience this process. One of the theoretical-methodological frameworks for studying this process is Abstraction in Context (AiC). Based on this framework, abstraction process comprises of observable epistemic actions, Recognition, Building-With, Construction, and Consolidation called as RBC + C model. This study investigates and analyzes how pre-service mathematics teachers constructed and consolidated concept of Parallel Coordinates in a group discussion. It uses AiC framework for analyzing mathematical abstraction of a group of pre-service teachers consisted of four students in learning Parallel Coordinates concepts. The data were collected through video recording, students’ worksheet, test, and field notes. The result shows that the students’ prior knowledge related to concept of the Cartesian coordinate has significant role in the process of constructing Parallel Coordinates concept as a new knowledge. The consolidation process is influenced by the social interaction between group members. The abstraction process taken place in this group were dominated by empirical abstraction that emphasizes on the aspect of identifying characteristic of manipulated or imagined object during the process of recognizing and building-with.
Engineering Abstractions in Model Checking and Testing
DEFF Research Database (Denmark)
Achenbach, Michael; Ostermann, Klaus
2009-01-01
Abstractions are used in model checking to tackle problems like state space explosion or modeling of IO. The application of these abstractions in real software development processes, however, lacks engineering support. This is one reason why model checking is not widely used in practice yet...... and testing is still state of the art in falsification. We show how user-defined abstractions can be integrated into a Java PathFinder setting with tools like AspectJ or Javassist and discuss implications of remaining weaknesses of these tools. We believe that a principled engineering approach to designing...... and implementing abstractions will improve the applicability of model checking in practice....
2003-01-01
26. apr. tähistas A. Ivashkevitshi stepptantsustuudio Duff-tap studio oma kümnendat tegevusaastat. Sel puhul oli 26. ja 27. apr. Vene Draamateatris Jazz&Tapdance show, kus osalesid stepptantsijad Ameerikast
Abstraction of continuous dynamical systems utilizing lyapunov functions
DEFF Research Database (Denmark)
Sloth, Christoffer; Wisniewski, Rafael
2010-01-01
This paper considers the development of a method for abstracting continuous dynamical systems by timed automata. The method is based on partitioning the state space of dynamical systems with invariant sets, which form cells representing locations of the timed automata. To enable verification...... of the dynamical system based on the abstraction, conditions for obtaining sound, complete, and refinable abstractions are set up. It is proposed to partition the state space utilizing sub-level sets of Lyapunov functions, since they are positive invariant sets. The existence of sound abstractions for Morse......-Smale systems and complete and refinable abstractions for linear systems are shown....
Abstraction Power in Computer Science Education
DEFF Research Database (Denmark)
Bennedsen, Jens Benned; Caspersen, Michael Edelgaard
2006-01-01
The paper is a discussion of the hypothesis that a person’s abstraction power (or ability) has a positive influence on their ability to program.......The paper is a discussion of the hypothesis that a person’s abstraction power (or ability) has a positive influence on their ability to program....
International Nuclear Information System (INIS)
Cessac, B.; Bianchi, E.; Bellon, M.; Fried, H.; Krajewski, T.; Schubert, C.; Barre, J.; Hofmann, R.; Muller, B.; Raffaelli, B.
2014-01-01
The object of this Workshop is to consolidate and publicize new efforts in non perturbative-like Field Theories, relying in Functional Methods, Renormalization Group, and Dyson-Schwinger Equations. A presentation deals with effective vertices and photon-photon scattering in SU(2) Yang-Mills thermodynamics. This document gathers the abstracts of the presentations
International Nuclear Information System (INIS)
2015-01-01
The volume contains the abstracts of the SPR (society for pediatric radiology) 2015 meeting covering the following issues: fetal imaging, muscoskeletal imaging, cardiac imaging, chest imaging, oncologic imaging, tools for process improvement, child abuse, contrast enhanced ultrasound, image gently - update of radiation dose recording/reporting/monitoring - meaningful or useless meaning?, pediatric thoracic imaging, ALARA.
Energy Technology Data Exchange (ETDEWEB)
NONE
2015-04-01
The volume contains the abstracts of the SPR (society for pediatric radiology) 2015 meeting covering the following issues: fetal imaging, muscoskeletal imaging, cardiac imaging, chest imaging, oncologic imaging, tools for process improvement, child abuse, contrast enhanced ultrasound, image gently - update of radiation dose recording/reporting/monitoring - meaningful or useless meaning?, pediatric thoracic imaging, ALARA.
Mathematical games, abstract games
Neto, Joao Pedro
2013-01-01
User-friendly, visually appealing collection offers both new and classic strategic board games. Includes abstract games for two and three players and mathematical games such as Nim and games on graphs.
An abstract machine for module replacement
Walton, Chris; Krl, Dilsun; Gilmore, Stephen
1998-01-01
In this paper we define an abstract machine model for the mλ typed intermediate language. This abstract machine is used to give a formal description of the operation of run-time module replacement from the programming language Dynamic ML. The essential technical device which we employ for module replacement is a modification of two-space copying garbage collection.
User-Extensible Graphics Using Abstract Structure,
1987-08-01
Flex 6 The Algol68 model of the graphical abstract structure 5 The creation of a PictureDefinition 6 The making of a picture from a PictureDefinition 7...data together with the operations that can be performed on that data. i 7! ś I _ § 4, The Alqol68 model of the graphical abstract structure Every
Elements of abstract harmonic analysis
Bachman, George
2013-01-01
Elements of Abstract Harmonic Analysis provides an introduction to the fundamental concepts and basic theorems of abstract harmonic analysis. In order to give a reasonably complete and self-contained introduction to the subject, most of the proofs have been presented in great detail thereby making the development understandable to a very wide audience. Exercises have been supplied at the end of each chapter. Some of these are meant to extend the theory slightly while others should serve to test the reader's understanding of the material presented. The first chapter and part of the second give
Abstraction networks for terminologies: Supporting management of "big knowledge".
Halper, Michael; Gu, Huanying; Perl, Yehoshua; Ochs, Christopher
2015-05-01
Terminologies and terminological systems have assumed important roles in many medical information processing environments, giving rise to the "big knowledge" challenge when terminological content comprises tens of thousands to millions of concepts arranged in a tangled web of relationships. Use and maintenance of knowledge structures on that scale can be daunting. The notion of abstraction network is presented as a means of facilitating the usability, comprehensibility, visualization, and quality assurance of terminologies. An abstraction network overlays a terminology's underlying network structure at a higher level of abstraction. In particular, it provides a more compact view of the terminology's content, avoiding the display of minutiae. General abstraction network characteristics are discussed. Moreover, the notion of meta-abstraction network, existing at an even higher level of abstraction than a typical abstraction network, is described for cases where even the abstraction network itself represents a case of "big knowledge." Various features in the design of abstraction networks are demonstrated in a methodological survey of some existing abstraction networks previously developed and deployed for a variety of terminologies. The applicability of the general abstraction-network framework is shown through use-cases of various terminologies, including the Systematized Nomenclature of Medicine - Clinical Terms (SNOMED CT), the Medical Entities Dictionary (MED), and the Unified Medical Language System (UMLS). Important characteristics of the surveyed abstraction networks are provided, e.g., the magnitude of the respective size reduction referred to as the abstraction ratio. Specific benefits of these alternative terminology-network views, particularly their use in terminology quality assurance, are discussed. Examples of meta-abstraction networks are presented. The "big knowledge" challenge constitutes the use and maintenance of terminological structures that
Frontopolar cortex mediates abstract integration in analogy.
Green, Adam E; Fugelsang, Jonathan A; Kraemer, David J M; Shamosh, Noah A; Dunbar, Kevin N
2006-06-22
Integration of abstractly similar relations during analogical reasoning was investigated using functional magnetic resonance imaging. Activation elicited by an analogical reasoning task that required both complex working memory and integration of abstractly similar relations was compared to activation elicited by a non-analogical task that required complex working memory in the absence of abstract relational integration. A left-sided region of the frontal pole of the brain (BA 9/10) was selectively active for the abstract relational integration component of analogical reasoning. Analogical reasoning also engaged a left-sided network of parieto-frontal regions. Activity in this network during analogical reasoning is hypothesized to reflect categorical alignment of individual component terms that make up analogies. This parieto-frontal network was also engaged by the complex control task, which involved explicit categorization, but not by a simpler control task, which did not involve categorization. We hypothesize that frontopolar cortex mediates abstract relational integration in complex reasoning while parieto-frontal regions mediate working memory processes, including manipulation of terms for the purpose of categorical alignment, that facilitate this integration.
Epimural Indicator Phylotypes of Transiently-Induced Subacute Ruminal Acidosis in Dairy Cattle
Wetzels, Stefanie U.; Mann, Evelyne; Metzler-Zebeli, Barbara U.; Pourazad, Poulad; Qumar, Muhammad; Klevenhusen, Fenja; Pinior, Beate; Wagner, Martin; Zebeli, Qendrim; Schmitz-Esser, Stephan
2016-01-01
The impact of a long-term subacute rumen acidosis (SARA) on the bovine epimural bacterial microbiome (BEBM) and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a 1-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA...
Abstraction in artificial intelligence and complex systems
Saitta, Lorenza
2013-01-01
Abstraction is a fundamental mechanism underlying both human and artificial perception, representation of knowledge, reasoning and learning. This mechanism plays a crucial role in many disciplines, notably Computer Programming, Natural and Artificial Vision, Complex Systems, Artificial Intelligence and Machine Learning, Art, and Cognitive Sciences. This book first provides the reader with an overview of the notions of abstraction proposed in various disciplines by comparing both commonalities and differences. After discussing the characterizing properties of abstraction, a formal model, the K
8th Czechoslovak spectroscopic conference. Abstracts
International Nuclear Information System (INIS)
1988-01-01
Volume 3 of the conference proceedings contains abstracts of 17 invited papers, 101 poster presentations and 7 papers of instrument manufacturers, devoted to special spectroscopic techniques including X-ray microanalysis, X-ray spectral analysis, Moessbauer spectrometry, mass spectrometry, instrumental activation analysis and other instrumental radioanalytical methods, electron spectrometry, and techniques of environmental analysis. Sixty abstracts were inputted in INIS. (A.K.)
Muzõka v nogahh / Jekaterina Rodina
Rodina, Jekaterina
2003-01-01
26. apr. tähistab A. Ivashkevitshi stepptantsustuudio Duff-tap studio oma kümnendat tegevusaastat. Sel puhul on 26. ja 27. apr. Vene Draamateatris Jazz&Tapdance show, kus osalevad ameerika stepptantsijad B. Duffy jt
AfSBT Congress Abstracts: Zimbabwe 2014 | Adewuyi | Africa ...
African Journals Online (AJOL)
AfSBT Congress Abstracts: Zimbabwe 2014. James Ola-Banji Adewuyi. Abstract. No Abstract. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...
Effects of ovariectomy and anabolic steroid implantation on the ...
African Journals Online (AJOL)
Effects of ovariectomy and anabolic steroid implantation on the somatotrophic axis in feedlot heifers. CR Bailey, GC Duff, SR Sanders, SP Cuneo, CP McMurphy, SW Limesand, JA Marchello, DW Schafer, ML Rhoads, DM Hallford ...
Brodvei na gastroljah v Estonii / Anna Litvinjuk
Litvinjuk, Anna
2003-01-01
26. apr. tähistab A. Ivashkevitshi stepptantsustuudio Duff-tap studio oma kümnendat tegevusaastat. Sel puhul on 26. ja 27. apr. Vene Draamateatris Jazz&Tapdance show, kuhu on kutsutud ka B. Duffy Ameerikast jt.
Abstraction of Drift-Scale Coupled Processes
International Nuclear Information System (INIS)
Francis, N.D.; Sassani, D.
2000-01-01
This Analysis/Model Report (AMR) describes an abstraction, for the performance assessment total system model, of the near-field host rock water chemistry and gas-phase composition. It also provides an abstracted process model analysis of potentially important differences in the thermal hydrologic (TH) variables used to describe the performance of a geologic repository obtained from models that include fully coupled reactive transport with thermal hydrology and those that include thermal hydrology alone. Specifically, the motivation of the process-level model comparison between fully coupled thermal-hydrologic-chemical (THC) and thermal-hydrologic-only (TH-only) is to provide the necessary justification as to why the in-drift thermodynamic environment and the near-field host rock percolation flux, the essential TH variables used to describe the performance of a geologic repository, can be obtained using a TH-only model and applied directly into a TSPA abstraction without recourse to a fully coupled reactive transport model. Abstraction as used in the context of this AMR refers to an extraction of essential data or information from the process-level model. The abstraction analysis reproduces and bounds the results of the underlying detailed process-level model. The primary purpose of this AMR is to abstract the results of the fully-coupled, THC model (CRWMS M andO 2000a) for effects on water and gas-phase composition adjacent to the drift wall (in the near-field host rock). It is assumed that drift wall fracture water and gas compositions may enter the emplacement drift before, during, and after the heating period. The heating period includes both the preclosure, in which the repository drifts are ventilated, and the postclosure periods, with backfill and drip shield emplacement at the time of repository closure. Although the preclosure period (50 years) is included in the process models, the postclosure performance assessment starts at the end of this initial period
Writing business research article abstracts: A genre approach
Directory of Open Access Journals (Sweden)
Carmen Piqué-Noguera
2012-10-01
Full Text Available A great deal has been published about oral and written genres in business (e.g., letters, research articles, oral presentations, etc., and less attention has been paid to business research article abstracts as a written genre, as many experts would argue. This research intends to raise rhetorical awareness about the role of abstracts in today’s academic world. To this effect, the abstracts of two official publications of the Association of Business Communication, Journal of Business Communication and Business Communication Quarterly, have been analyzed and compared in terms of structure and content according to models published in the specialized literature. The results show an irregular and inconsistent presentation of abstracts, a good number of them following no set pattern and thus lacking in important information for researchers. These findings suggest, first of all, that abstracts have a specific mission to fulfil and should not be disregarded; and, secondly, that journal guidelines for authors should be more explicit in their instructions on how to write and structure abstracts.
2002 Conference Programme and Book of Abstracts
International Nuclear Information System (INIS)
2002-01-01
The 25th Annual (Silver Jubilee) Conference 2002 Conference Programme and Book of Abstracts gives a brief on the Nigerian Institute of Physics, the Sheda Science and Technology Complex. It carries the Conference programme and carries the abstracts of all the papers presented. The abstracts cover a wide range of subjects including topics in atmospheric physics, education, policy and planning, geophysics, instrumentation, mathematical sciences, theoretical physics, nuclear and health physics, solid state, electronic and health physics. We are grateful to the Nigerian Institute of Physics for this volume
Functional Correspondence between Evaluators and Abstract Machines
DEFF Research Database (Denmark)
Ager, Mads Stig; Biernacki, Dariusz; Danvy, Olivier
2003-01-01
We bridge the gap between functional evaluators and abstract machines for the λ-calculus, using closure conversion, transformation into continuation-passing style, and defunctionalization.We illustrate this approach by deriving Krivine's abstract machine from an ordinary call-by-name evaluator...... and by deriving an ordinary call-by-value evaluator from Felleisen et al.'s CEK machine. The first derivation is strikingly simpler than what can be found in the literature. The second one is new. Together, they show that Krivine's abstract machine and the CEK machine correspond to the call-by-name and call...
Abstracting audit data for lightweight intrusion detection
Wang, Wei; Zhang, Xiangliang; Pitsilis, Georgios
2010-01-01
are used to validate the two strategies of data abstraction. The extensive test results show that the process of exemplar extraction significantly improves the detection efficiency and has a better detection performance than PCA in data abstraction. © 2010
International beta-dosimetry symposium. Program and abstracts
International Nuclear Information System (INIS)
1983-02-01
Abstracts of the presentations at the symposium are contained in this volume. Problems associated with beta dosimetry, beta detectors and dosemeters, and current development programs are described. Each abstract has been indexed separately for inclusion in the Energy Data Base
Proceedings of the ASIS Annual Meeting, 1994
1994-01-01
Includes abstracts of 18 special interest group (SIG) sessions. Highlights include natural language processing, information science and terminology science, classification, knowledge-intensive information systems, information value and ownership issues, economics and theories of information science, information retrieval interfaces, fuzzy thinking…
Converting One Type-Based Abstract Domain to Another
DEFF Research Database (Denmark)
Gallagher, John Patrick; Puebla, German; Albert, Elvira
2006-01-01
The specific problem that motivates this paper is how to obtain abstract descriptions of the meanings of imported predicates (such as built-ins) that can be used when analysing a module of a logic program with respect to some abstract domain. We assume that abstract descriptions of the imported....... We develop a method which has been applied in order to generate call and success patterns from the Ciaopp assertions for built-ins, for any given regular type-based domain. In the paper we present the method as an instance of the more general problem of mapping elements of one abstract domain...
EBS Radionuclide Transport Abstraction
International Nuclear Information System (INIS)
J.D. Schreiber
2005-01-01
The purpose of this report is to develop and analyze the engineered barrier system (EBS) radionuclide transport abstraction model, consistent with Level I and Level II model validation, as identified in ''Technical Work Plan for: Near-Field Environment and Transport: Engineered Barrier System: Radionuclide Transport Abstraction Model Report Integration'' (BSC 2005 [DIRS 173617]). The EBS radionuclide transport abstraction (or EBS RT Abstraction) is the conceptual model used in the total system performance assessment for the license application (TSPA-LA) to determine the rate of radionuclide releases from the EBS to the unsaturated zone (UZ). The EBS RT Abstraction conceptual model consists of two main components: a flow model and a transport model. Both models are developed mathematically from first principles in order to show explicitly what assumptions, simplifications, and approximations are incorporated into the models used in the TSPA-LA. The flow model defines the pathways for water flow in the EBS and specifies how the flow rate is computed in each pathway. Input to this model includes the seepage flux into a drift. The seepage flux is potentially split by the drip shield, with some (or all) of the flux being diverted by the drip shield and some passing through breaches in the drip shield that might result from corrosion or seismic damage. The flux through drip shield breaches is potentially split by the waste package, with some (or all) of the flux being diverted by the waste package and some passing through waste package breaches that might result from corrosion or seismic damage. Neither the drip shield nor the waste package survives an igneous intrusion, so the flux splitting submodel is not used in the igneous scenario class. The flow model is validated in an independent model validation technical review. The drip shield and waste package flux splitting algorithms are developed and validated using experimental data. The transport model considers
EBS Radionuclide Transport Abstraction
Energy Technology Data Exchange (ETDEWEB)
J.D. Schreiber
2005-08-25
The purpose of this report is to develop and analyze the engineered barrier system (EBS) radionuclide transport abstraction model, consistent with Level I and Level II model validation, as identified in ''Technical Work Plan for: Near-Field Environment and Transport: Engineered Barrier System: Radionuclide Transport Abstraction Model Report Integration'' (BSC 2005 [DIRS 173617]). The EBS radionuclide transport abstraction (or EBS RT Abstraction) is the conceptual model used in the total system performance assessment for the license application (TSPA-LA) to determine the rate of radionuclide releases from the EBS to the unsaturated zone (UZ). The EBS RT Abstraction conceptual model consists of two main components: a flow model and a transport model. Both models are developed mathematically from first principles in order to show explicitly what assumptions, simplifications, and approximations are incorporated into the models used in the TSPA-LA. The flow model defines the pathways for water flow in the EBS and specifies how the flow rate is computed in each pathway. Input to this model includes the seepage flux into a drift. The seepage flux is potentially split by the drip shield, with some (or all) of the flux being diverted by the drip shield and some passing through breaches in the drip shield that might result from corrosion or seismic damage. The flux through drip shield breaches is potentially split by the waste package, with some (or all) of the flux being diverted by the waste package and some passing through waste package breaches that might result from corrosion or seismic damage. Neither the drip shield nor the waste package survives an igneous intrusion, so the flux splitting submodel is not used in the igneous scenario class. The flow model is validated in an independent model validation technical review. The drip shield and waste package flux splitting algorithms are developed and validated using experimental data. The transport
EBS Radionuclide Transport Abstraction
Energy Technology Data Exchange (ETDEWEB)
J. Prouty
2006-07-14
The purpose of this report is to develop and analyze the engineered barrier system (EBS) radionuclide transport abstraction model, consistent with Level I and Level II model validation, as identified in Technical Work Plan for: Near-Field Environment and Transport: Engineered Barrier System: Radionuclide Transport Abstraction Model Report Integration (BSC 2005 [DIRS 173617]). The EBS radionuclide transport abstraction (or EBS RT Abstraction) is the conceptual model used in the total system performance assessment (TSPA) to determine the rate of radionuclide releases from the EBS to the unsaturated zone (UZ). The EBS RT Abstraction conceptual model consists of two main components: a flow model and a transport model. Both models are developed mathematically from first principles in order to show explicitly what assumptions, simplifications, and approximations are incorporated into the models used in the TSPA. The flow model defines the pathways for water flow in the EBS and specifies how the flow rate is computed in each pathway. Input to this model includes the seepage flux into a drift. The seepage flux is potentially split by the drip shield, with some (or all) of the flux being diverted by the drip shield and some passing through breaches in the drip shield that might result from corrosion or seismic damage. The flux through drip shield breaches is potentially split by the waste package, with some (or all) of the flux being diverted by the waste package and some passing through waste package breaches that might result from corrosion or seismic damage. Neither the drip shield nor the waste package survives an igneous intrusion, so the flux splitting submodel is not used in the igneous scenario class. The flow model is validated in an independent model validation technical review. The drip shield and waste package flux splitting algorithms are developed and validated using experimental data. The transport model considers advective transport and diffusive transport
EBS Radionuclide Transport Abstraction
International Nuclear Information System (INIS)
J. Prouty
2006-01-01
The purpose of this report is to develop and analyze the engineered barrier system (EBS) radionuclide transport abstraction model, consistent with Level I and Level II model validation, as identified in Technical Work Plan for: Near-Field Environment and Transport: Engineered Barrier System: Radionuclide Transport Abstraction Model Report Integration (BSC 2005 [DIRS 173617]). The EBS radionuclide transport abstraction (or EBS RT Abstraction) is the conceptual model used in the total system performance assessment (TSPA) to determine the rate of radionuclide releases from the EBS to the unsaturated zone (UZ). The EBS RT Abstraction conceptual model consists of two main components: a flow model and a transport model. Both models are developed mathematically from first principles in order to show explicitly what assumptions, simplifications, and approximations are incorporated into the models used in the TSPA. The flow model defines the pathways for water flow in the EBS and specifies how the flow rate is computed in each pathway. Input to this model includes the seepage flux into a drift. The seepage flux is potentially split by the drip shield, with some (or all) of the flux being diverted by the drip shield and some passing through breaches in the drip shield that might result from corrosion or seismic damage. The flux through drip shield breaches is potentially split by the waste package, with some (or all) of the flux being diverted by the waste package and some passing through waste package breaches that might result from corrosion or seismic damage. Neither the drip shield nor the waste package survives an igneous intrusion, so the flux splitting submodel is not used in the igneous scenario class. The flow model is validated in an independent model validation technical review. The drip shield and waste package flux splitting algorithms are developed and validated using experimental data. The transport model considers advective transport and diffusive transport
Content Abstract Classification Using Naive Bayes
Latif, Syukriyanto; Suwardoyo, Untung; Aldrin Wihelmus Sanadi, Edwin
2018-03-01
This study aims to classify abstract content based on the use of the highest number of words in an abstract content of the English language journals. This research uses a system of text mining technology that extracts text data to search information from a set of documents. Abstract content of 120 data downloaded at www.computer.org. Data grouping consists of three categories: DM (Data Mining), ITS (Intelligent Transport System) and MM (Multimedia). Systems built using naive bayes algorithms to classify abstract journals and feature selection processes using term weighting to give weight to each word. Dimensional reduction techniques to reduce the dimensions of word counts rarely appear in each document based on dimensional reduction test parameters of 10% -90% of 5.344 words. The performance of the classification system is tested by using the Confusion Matrix based on comparative test data and test data. The results showed that the best classification results were obtained during the 75% training data test and 25% test data from the total data. Accuracy rates for categories of DM, ITS and MM were 100%, 100%, 86%. respectively with dimension reduction parameters of 30% and the value of learning rate between 0.1-0.5.
DEFF Research Database (Denmark)
Nygaard, Mikkel; Winskel, Glynn
2003-01-01
A fully abstract denotational semantics for the higher-order process language HOPLA is presented. It characterises contextual and logical equivalence, the latter linking up with simulation. The semantics is a clean, domain-theoretic description of processes as downwards-closed sets of computation...
Energy Technology Data Exchange (ETDEWEB)
NONE
2017-06-15
The volume includes abstracts of the Annual DEGRO Meeting 2017 covering lectures and poster sessions with the following issues: lymphoma, biology, physics, radioimmunotherapy, sarcomas and rare tumors, prostate carcinoma, lung tumors, benign lesions and new media, mamma carcinoma, gastrointestinal tumors, quality of life, care science and quality assurance, high-technology methods and palliative situation, head-and-neck tumors, brain tumors, central nervous system metastases, guidelines, radiation sensitivity, radiotherapy, radioimmunotherapy.
Collected abstracts on particle beam diagnostic systems
International Nuclear Information System (INIS)
Hickok, R.L.
1979-01-01
This report contains a compilation of abstracts on work related to particle beam diagnostics for high temperature plasmas. The abstracts were gathered in early 1978 and represent the status of the various programs as of that date. It is not suggested that this is a comprehensive list of all the work that is going on in the development of particle beam diagnostics, but it does provide a representative view of the work in this field. For example, no abstracts were received from the U.S.S.R. even though they have considerable activity in particle beam diagnostics
Argument structure and the representation of abstract semantics.
Directory of Open Access Journals (Sweden)
Javier Rodríguez-Ferreiro
Full Text Available According to the dual coding theory, differences in the ease of retrieval between concrete and abstract words are related to the exclusive dependence of abstract semantics on linguistic information. Argument structure can be considered a measure of the complexity of the linguistic contexts that accompany a verb. If the retrieval of abstract verbs relies more on the linguistic codes they are associated to, we could expect a larger effect of argument structure for the processing of abstract verbs. In this study, sets of length- and frequency-matched verbs including 40 intransitive verbs, 40 transitive verbs taking simple complements, and 40 transitive verbs taking sentential complements were presented in separate lexical and grammatical decision tasks. Half of the verbs were concrete and half were abstract. Similar results were obtained in the two tasks, with significant effects of imageability and transitivity. However, the interaction between these two variables was not significant. These results conflict with hypotheses assuming a stronger reliance of abstract semantics on linguistic codes. In contrast, our data are in line with theories that link the ease of retrieval with availability and robustness of semantic information.
Argument structure and the representation of abstract semantics.
Rodríguez-Ferreiro, Javier; Andreu, Llorenç; Sanz-Torrent, Mònica
2014-01-01
According to the dual coding theory, differences in the ease of retrieval between concrete and abstract words are related to the exclusive dependence of abstract semantics on linguistic information. Argument structure can be considered a measure of the complexity of the linguistic contexts that accompany a verb. If the retrieval of abstract verbs relies more on the linguistic codes they are associated to, we could expect a larger effect of argument structure for the processing of abstract verbs. In this study, sets of length- and frequency-matched verbs including 40 intransitive verbs, 40 transitive verbs taking simple complements, and 40 transitive verbs taking sentential complements were presented in separate lexical and grammatical decision tasks. Half of the verbs were concrete and half were abstract. Similar results were obtained in the two tasks, with significant effects of imageability and transitivity. However, the interaction between these two variables was not significant. These results conflict with hypotheses assuming a stronger reliance of abstract semantics on linguistic codes. In contrast, our data are in line with theories that link the ease of retrieval with availability and robustness of semantic information.
DENOTATIVE ORIGINS OF ABSTRACT IMAGES IN LINGUISTIC EXPERIMENT
Directory of Open Access Journals (Sweden)
Elina, E.
2017-03-01
Full Text Available The article discusses the refusal from denotation (the subject, as the basic principle of abstract images, and semiotic problems arising in connection with this principle: how to solve the contradiction between the pointlessness and iconic nature of the image? Is it correct in the absence of denotation to recognize abstract representation of a single-level entity? The solution is proposed to decide these questions with the help of a psycholinguistic experiment in which the verbal interpretation of abstract images made by both experienced and “naive” audience-recipients demonstrates the objectivity of perception of denotative “traces” and the presence of denotative invariant in an abstract form.
Composing Interfering Abstract Protocols
2016-04-01
Tecnologia , Universidade Nova de Lisboa, Caparica, Portugal. This document is a companion technical report of the paper, “Composing Interfering Abstract...a Ciência e Tecnologia (Portuguese Foundation for Science and Technology) through the Carnegie Mellon Portugal Program under grant SFRH / BD / 33765
Abstracting massive data for lightweight intrusion detection in computer networks
Wang, Wei; Liu, Jiqiang; Pitsilis, Georgios; Zhang, Xiangliang
2016-01-01
detection. Data abstraction refers to abstract or extract the most relevant information from the massive dataset. In this work, we propose three strategies of data abstraction, namely, exemplar extraction, attribute selection and attribute abstraction. We
Earth Sciences Division collected abstracts: 1980
Energy Technology Data Exchange (ETDEWEB)
Henry, A.L.; Hornady, B.F. (eds.)
1981-10-15
This report is a compilation of abstracts of papers, reports, and talks presented during 1980 at national and international meetings by members of the Earth Sciences Division, Lawrence Livermore National Laboratory. The arrangement is alphabetical (by author). For a given report, a bibliographic reference appears under the name of each coauthor, but the abstract itself is given only under the name of the first author (indicated in capital letters) or the first Earth Sciences Division author.
Earth Sciences Division collected abstracts: 1980
International Nuclear Information System (INIS)
Henry, A.L.; Hornady, B.F.
1981-01-01
This report is a compilation of abstracts of papers, reports, and talks presented during 1980 at national and international meetings by members of the Earth Sciences Division, Lawrence Livermore National Laboratory. The arrangement is alphabetical (by author). For a given report, a bibliographic reference appears under the name of each coauthor, but the abstract itself is given only under the name of the first author (indicated in capital letters) or the first Earth Sciences Division author
Annotating abstract pronominal anaphora in the DAD project
DEFF Research Database (Denmark)
Navarretta, Costanza; Olsen, Sussi Anni
2008-01-01
n this paper we present an extension of the MATE/GNOME annotation scheme for anaphora (Poesio 2004) which accounts for abstract anaphora in Danish and Italian. By abstract anaphora it is here meant pronouns whose linguistic antecedents are verbal phrases, clauses and discourse segments. The exten......n this paper we present an extension of the MATE/GNOME annotation scheme for anaphora (Poesio 2004) which accounts for abstract anaphora in Danish and Italian. By abstract anaphora it is here meant pronouns whose linguistic antecedents are verbal phrases, clauses and discourse segments....... The extended scheme, which we call the DAD annotation scheme, allows to annotate information about abstract anaphora which is important to investigate their use, see Webber (1988), Gundel et al. (2003), Navarretta (2004) and which can influence their automatic treatment. Intercoder agreement scores obtained...... by applying the DAD annotation scheme on texts and dialogues in the two languages are given and show that th information proposed in the scheme can be recognised in a reliable way....
Subsequent publication of oral and maxillofacial surgery meeting abstracts.
Rodriguez, Joseph L; Laskin, Daniel M
2012-05-01
Previous studies in various medical specialties have shown that fewer than 50% of abstracts presented at meetings are subsequently published. The purpose of the present study was to determine the publication rate of abstracts presented at the annual meetings of the American Association of Oral and Maxillofacial Surgeons. The titles and authors of the abstracts from all oral abstract session presentations and posters by American contributors were collected from the Final Programs of the American Association of Oral and Maxillofacial Surgeons annual meetings for 2006 to 2009. A PubMed search for published articles through December 2010 was then performed using the authors' names, abstract titles, and key words. A total of 311 abstract presentations were done at the 4 annual meetings. Of these, only 85 (24%) were subsequently published. No difference was found between abstracts from oral or poster presentations. Most of the articles were published in the Journal of Oral and Maxillofacial Surgery. Because of deficiencies that can occur in abstracts and the need to disseminate the information they contain, it is important to take the appropriate measures to ensure that full articles are subsequently published. Copyright © 2012 American Association of Oral and Maxillofacial Surgeons. Published by Elsevier Inc. All rights reserved.
Preparing and presenting effective abstracts and posters in psychiatry.
Singh, Manpreet K
2014-12-01
Presenting an abstract and a poster gives scientists from all fields, including psychiatry, an important opportunity to introduce their research to others. Researchers and mental health professionals at all levels of career development can use several media resources to assist them with the technical aspects of preparing an abstract or a poster. This article will focus on major principles associated with preparing and presenting an abstract and a poster at a scientific meeting. A literature search using NIH PubMed was conducted to identify peer and nonpeer-reviewed articles that provide methods for effective abstract and poster presentation for the period of 1966 to June 2014. First, the author reviews the purpose and relative importance of abstracts and posters in academic settings. Next, the author describes the qualities of an effective abstract and poster and common pitfalls that may occur. Finally, the author presents a systematic approach to preparing and presenting an abstract and a poster in a scientific setting. Several sources consistently suggest that readability, organization, and succinctness are qualities that make an effective and successful abstract and poster. Mental health professionals in all stages of their career development may benefit from following these guidelines in presenting their scientific work.
Preparing and presenting effective abstracts and posters in psychiatry
Singh, Manpreet K.
2014-01-01
Presenting an abstract and a poster gives scientists from all fields, including psychiatry, an important opportunity to introduce their research to others. Researchers and mental health professionals at all levels of career development can use several media resources to assist them with the technical aspects of preparing an abstract or a poster. This article will focus on major principles associated with preparing and presenting an abstract and a poster at a scientific meeting. A literature search using NIH PubMed was conducted to identify peer and non-peer-reviewed articles that provide methods for effective abstract and poster presentation for the period of 1966 to June 2014. First, we review the purpose and relative importance of abstracts and posters in academic settings. Next, we describe the qualities of an effective abstract and poster and common pitfalls that may occur. Finally, we present a systematic approach to preparing and presenting an abstract and a poster in a scientific setting. Several sources consistently suggest that readability, organization, and succinctness are qualities that make an effective and successful abstract and poster. Mental health professionals in all stages of their career development may benefit from following these guidelines in presenting their scientific work. PMID:25085499
Energy Technology Data Exchange (ETDEWEB)
NONE
2014-05-15
The proceedings of the SPR 2014 meeting include abstracts on the following topics: Body imaging techniques: practical advice for clinic work; thoracic imaging: focus on the lungs; gastrointestinal imaging: focus on the pancreas and bowel; genitourinary imaging: focus on gonadal radiology; muscoskeletal imaging; focus on oncology; child abuse and nor child abuse: focus on radiography; impact of NMR and CT imaging on management of CHD; education and communication: art and practice in pediatric radiology.
International Nuclear Information System (INIS)
2014-01-01
The proceedings of the SPR 2014 meeting include abstracts on the following topics: Body imaging techniques: practical advice for clinic work; thoracic imaging: focus on the lungs; gastrointestinal imaging: focus on the pancreas and bowel; genitourinary imaging: focus on gonadal radiology; muscoskeletal imaging; focus on oncology; child abuse and nor child abuse: focus on radiography; impact of NMR and CT imaging on management of CHD; education and communication: art and practice in pediatric radiology.
International Nuclear Information System (INIS)
Bianchi, E.; Bender, C.; Culetu, H.; Fried, H.; Grossmann, A.; Hofmann, R.; Le Bellac, M.; Martinetti, P.; Muller, B.; Patras, F.; Raffaeli, B.; Vitting Andersen, J.
2013-01-01
The object of this workshop is to consolidate and publicize new efforts in non-perturbative field theories. This year the presentations deal with quantum gravity, non-commutative geometry, fat-tailed wave-functions, strongly coupled field theories, space-times two time-like dimensions, and multiplicative renormalization. A presentation is dedicated to the construction of a nucleon-nucleon potential from an analytical, non-perturbative gauge invariant QCD. This document gathers the abstracts of the presentations
Impredicative concurrent abstract predicates
DEFF Research Database (Denmark)
Svendsen, Kasper; Birkedal, Lars
2014-01-01
We present impredicative concurrent abstract predicates { iCAP { a program logic for modular reasoning about concurrent, higher- order, reentrant, imperative code. Building on earlier work, iCAP uses protocols to reason about shared mutable state. A key novel feature of iCAP is the ability to dene...
DEFF Research Database (Denmark)
Tarby, Sara; Cermak, Daniel
2016-01-01
Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016.......Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016....
Assume-Guarantee Abstraction Refinement Meets Hybrid Systems
Bogomolov, Sergiy; Frehse, Goran; Greitschus, Marius; Grosu, Radu; Pasareanu, Corina S.; Podelski, Andreas; Strump, Thomas
2014-01-01
Compositional verification techniques in the assume- guarantee style have been successfully applied to transition systems to efficiently reduce the search space by leveraging the compositional nature of the systems under consideration. We adapt these techniques to the domain of hybrid systems with affine dynamics. To build assumptions we introduce an abstraction based on location merging. We integrate the assume-guarantee style analysis with automatic abstraction refinement. We have implemented our approach in the symbolic hybrid model checker SpaceEx. The evaluation shows its practical potential. To the best of our knowledge, this is the first work combining assume-guarantee reasoning with automatic abstraction-refinement in the context of hybrid automata.
Bounded Rationality of Generalized Abstract Fuzzy Economies
Directory of Open Access Journals (Sweden)
Lei Wang
2014-01-01
Full Text Available By using a nonlinear scalarization technique, the bounded rationality model M for generalized abstract fuzzy economies in finite continuous spaces is established. Furthermore, by using the model M, some new theorems for structural stability and robustness to (λ,ϵ-equilibria of generalized abstract fuzzy economies are proved.
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-06-15
The book includes the abstracts of all contributions presented during ESGAR (European Society of Gastrointestinal and Abdominal Radiology) 2007. The contributions of the symposium and the scientific sessions cover the following topics: abdominal MRI; interactive liver diagnosis; rectal cancer; liver metastases; pancreas: technical advances, lesion characterisation and staging; hepatic interventions; upper GI tract: multimodality evaluation; Crohn's disease evaluation; focal liver lesions: multimodality evaluation; CTC-computer aided diagnosis; bile ducts: imaging and intervention; GI tract: imaging and intervention; small bowel and appendix: cross-sectional imaging; CT and MR colonography; trauma and acute abdominal conditions: imaging and intervention; vascular and diffuse liver disease; liver contrast enhanced US. The second part covers the abstract of 248 presentations.
Abstract processing and observer vantage perspective in dysphoria.
Hart-Smith, Ly; Moulds, Michelle L
2018-05-07
processing and observer vantage perspective have been associated with negative consequences in depression. We investigated the relationship between mode of processing and vantage perspective bidirectionally in high and low dysphoric individuals, using abstract and concrete descriptions of experimenter-provided everyday actions. When vantage perspective was manipulated and processing mode was measured (Study 1a), participants who adopted a field perspective did not differ from those who adopted an observer perspective in their preference for abstract descriptions, irrespective of dysphoria status. When processing mode was manipulated and vantage perspective was measured (Study 1b), participants provided with abstract descriptions had a greater tendency to adopt an observer perspective than those provided with concrete descriptions, irrespective of dysphoria status. These results were replicated in larger online samples (Studies 2a and 2b). Together, they indicate a unidirectional causal relationship, whereby processing mode causally influences vantage perspective, in contrast to the bidirectional relationship previously reported in an unselected sample (Libby, Shaeffer, & Eibach, 2009). Further, these findings demonstrate that abstract processing increases the likelihood of adopting an observer perspective, and support targeting abstract processing in the treatment of depression to address the negative consequences associated with both abstract processing and recalling/imagining events from an observer perspective. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
Controlling groundwater over abstraction
Naber, Al Majd; Molle, Francois
2017-01-01
The control of groundwater over abstraction is a vexing problem worldwide. Jordan is one of the countries facing severe water scarcity which has implemented a wide range of measures and policies over the past 20 years. While the gap between formal legal and policy frameworks and local practices on
Circularity and Lambda Abstraction
DEFF Research Database (Denmark)
Danvy, Olivier; Thiemann, Peter; Zerny, Ian
2013-01-01
unknowns from what is done to them, which we lambda-abstract with functions. The circular unknowns then become dead variables, which we eliminate. The result is a strict circu- lar program a la Pettorossi. This transformation is reversible: given a strict circular program a la Pettorossi, we introduce...
Abstract Interpretation as a Programming Language
Directory of Open Access Journals (Sweden)
Mads Rosendahl
2013-09-01
Full Text Available In David Schmidt's PhD work he explored the use of denotational semantics as a programming language. It was part of an effort to not only treat formal semantics as specifications but also as interpreters and input to compiler generators. The semantics itself can be seen as a program and one may examine different programming styles and ways to represent states. Abstract interpretation is primarily a technique for derivation and specification of program analysis. As with denotational semantics we may also view abstract interpretations as programs and examine the implementation. The main focus in this paper is to show that results from higher-order strictness analysis may be used more generally as fixpoint operators for higher-order functions over lattices and thus provide a technique for immediate implementation of a large class of abstract interpretations. Furthermore, it may be seen as a programming paradigm and be used to write programs in a circular style.
In-Package Chemistry Abstraction
Energy Technology Data Exchange (ETDEWEB)
P.S. Domski
2003-07-21
The work associated with the development of this model report was performed in accordance with the requirements established in ''Technical Work Plan for Waste Form Degradation Modeling, Testing, and Analyses in Support of SR and LA'' (BSC 2002a). The in-package chemistry model and in-package chemistry model abstraction are developed to predict the bulk chemistry inside of a failed waste package and to provide simplified expressions of that chemistry. The purpose of this work is to provide the abstraction model to the Performance Assessment Project and the Waste Form Department for development of geochemical models of the waste package interior. The scope of this model report is to describe the development and validation of the in-package chemistry model and in-package chemistry model abstraction. The in-package chemistry model will consider chemical interactions of water with the waste package materials and the waste form for commercial spent nuclear fuel (CSNF) and codisposed high-level waste glass (HLWG) and N Reactor spent fuel (CDNR). The in-package chemistry model includes two sub-models, the first a water vapor condensation (WVC) model, where water enters a waste package as vapor and forms a film on the waste package components with subsequent film reactions with the waste package materials and waste form--this is a no-flow model, the reacted fluids do not exit the waste package via advection. The second sub-model of the in-package chemistry model is the seepage dripping model (SDM), where water, water that may have seeped into the repository from the surrounding rock, enters a failed waste package and reacts with the waste package components and waste form, and then exits the waste package with no accumulation of reacted water in the waste package. Both of the submodels of the in-package chemistry model are film models in contrast to past in-package chemistry models where all of the waste package pore space was filled with water. The
In-Package Chemistry Abstraction
International Nuclear Information System (INIS)
P.S. Domski
2003-01-01
The work associated with the development of this model report was performed in accordance with the requirements established in ''Technical Work Plan for Waste Form Degradation Modeling, Testing, and Analyses in Support of SR and LA'' (BSC 2002a). The in-package chemistry model and in-package chemistry model abstraction are developed to predict the bulk chemistry inside of a failed waste package and to provide simplified expressions of that chemistry. The purpose of this work is to provide the abstraction model to the Performance Assessment Project and the Waste Form Department for development of geochemical models of the waste package interior. The scope of this model report is to describe the development and validation of the in-package chemistry model and in-package chemistry model abstraction. The in-package chemistry model will consider chemical interactions of water with the waste package materials and the waste form for commercial spent nuclear fuel (CSNF) and codisposed high-level waste glass (HLWG) and N Reactor spent fuel (CDNR). The in-package chemistry model includes two sub-models, the first a water vapor condensation (WVC) model, where water enters a waste package as vapor and forms a film on the waste package components with subsequent film reactions with the waste package materials and waste form--this is a no-flow model, the reacted fluids do not exit the waste package via advection. The second sub-model of the in-package chemistry model is the seepage dripping model (SDM), where water, water that may have seeped into the repository from the surrounding rock, enters a failed waste package and reacts with the waste package components and waste form, and then exits the waste package with no accumulation of reacted water in the waste package. Both of the submodels of the in-package chemistry model are film models in contrast to past in-package chemistry models where all of the waste package pore space was filled with water. The current in
Hõbemägi, Priit, 1957-
2006-01-01
Uutest heliplaatidest Aimla, Arder, Agan, Mälgand "Mu süda, ärka üles", Cane 141 "Moon Pool", Slide-Fifty "The Way Ahead", Ozzy "Under Cover", "The Chronicles of Narnia", Johnny Panic "The Violent Dazzling", Hilary Duff "Most Wanted"
Embodied cognition, abstract concepts, and body manipulation
Directory of Open Access Journals (Sweden)
Katinka eDijkstra
2014-08-01
Full Text Available Current approaches on cognition hold that concrete concepts are grounded in concrete experiences. There is no consensus, however, as to whether this is equally true for abstract concepts. In this review we discuss how the body might be involved in understanding abstract concepts through metaphor activation. Substantial research has been conducted on the activation of common orientational metaphors with bodily manipulations, such as ‘power is up’ and ‘more is up’ representations. We will focus on the political metaphor that has a more complex association between the concept and the concrete domain. However, the outcomes of studies on this political metaphor have not always been consistent, possibly because the experimental manipulation was not implicit enough. The inclusion of new technological devices in this area of research, such as the Wii Balance Board, seems promising in order to assess the groundedness of abstract conceptual spatial metaphors in an implicit manner. This may aid further research to effectively demonstrate the interrelatedness between the body and more abstract representations.
Abstract algebra for physicists
International Nuclear Information System (INIS)
Zeman, J.
1975-06-01
Certain recent models of composite hadrons involve concepts and theorems from abstract algebra which are unfamiliar to most theoretical physicists. The algebraic apparatus needed for an understanding of these models is summarized here. Particular emphasis is given to algebraic structures which are not assumed to be associative. (2 figures) (auth)
Abstract: Notes from the Field: Establishing Baseline Data for ...
African Journals Online (AJOL)
Abstract: Notes from the Field: Establishing Baseline Data for Pressure Ulcers in a Rwandan Intensive Care Unit. Gedeon Mutabazi, Jessie Silver. Abstract. Abstract. Background Pressure ulcers are a common iatrogenic medical problem. Pressure ulcers increase the morbidity and mortality of hospitalized patients as well as ...
Abstract spatial concept priming dynamically influences real-world actions
Directory of Open Access Journals (Sweden)
Sarah M Tower-Richardi
2012-09-01
Full Text Available Experienced regularities in our perceptions and actions play important roles in grounding abstract concepts such as social status, time, and emotion. Might we similarly ground abstract spatial concepts in more experienced-based domains? The present experiment explores this possibility by implicitly priming abstract spatial terms (north, south, east, west and then measuring participants’ hand movement trajectories while they respond to a body-referenced spatial target (up, down, left, right in a verbal (Exp. 1 or spatial (Exp. 2 format. Results from two experiments demonstrate temporally-dynamic and prime-biased movement trajectories when the primes are incongruent with the targets (e.g., north – left, west – up. That is, priming abstract coordinate directions influences subsequent actions in response to concrete target directions. These findings provide the first evidence that abstract concepts of world-centered coordinate axes are implicitly understood in the context of concrete body-referenced axes; critically, this abstract-concrete relationship manifests in motor movements, and may have implications for spatial memory organization.
Object-oriented programming with gradual abstraction
DEFF Research Database (Denmark)
Nørmark, Kurt; Thomsen, Lone Leth; Thomsen, Bent
2013-01-01
We describe an experimental object-oriented programming language, ASL2, that supports program development by means of a series of abstraction steps. The language allows immediate object construction, and it is possible to use the constructed objects for concrete problem solving tasks. Classes...... restrictive. As a central mechanism, weakly classified objects are allowed to borrow methods from each other. ASL2 supports class generalization, as a counterpart to class specialization and inheritance in mainstream object-oriented programming languages. The final abstraction step discussed in this paper...
Selected Translated Abstracts of Chinese-Language Climate Change Publications
Energy Technology Data Exchange (ETDEWEB)
Cushman, R.M.; Burtis, M.D.
1999-05-01
This report contains English-translated abstracts of important Chinese-language literature concerning global climate change for the years 1995-1998. This body of literature includes the topics of adaptation, ancient climate change, climate variation, the East Asia monsoon, historical climate change, impacts, modeling, and radiation and trace-gas emissions. In addition to the biological citations and abstracts translated into English, this report presents the original citations and abstracts in Chinese. Author and title indexes are included to assist the reader in locating abstracts of particular interest.
Le Grice, Malcolm
A theoretical and historical account of the main preoccupations of makers of abstract films is presented in this book. The book's scope includes discussion of nonrepresentational forms as well as examination of experiments in the manipulation of time in films. The ten chapters discuss the following topics: art and cinematography, the first…
Sentence retrieval for abstracts of randomized controlled trials
Directory of Open Access Journals (Sweden)
Chung Grace Y
2009-02-01
Full Text Available Abstract Background The practice of evidence-based medicine (EBM requires clinicians to integrate their expertise with the latest scientific research. But this is becoming increasingly difficult with the growing numbers of published articles. There is a clear need for better tools to improve clinician's ability to search the primary literature. Randomized clinical trials (RCTs are the most reliable source of evidence documenting the efficacy of treatment options. This paper describes the retrieval of key sentences from abstracts of RCTs as a step towards helping users find relevant facts about the experimental design of clinical studies. Method Using Conditional Random Fields (CRFs, a popular and successful method for natural language processing problems, sentences referring to Intervention, Participants and Outcome Measures are automatically categorized. This is done by extending a previous approach for labeling sentences in an abstract for general categories associated with scientific argumentation or rhetorical roles: Aim, Method, Results and Conclusion. Methods are tested on several corpora of RCT abstracts. First structured abstracts with headings specifically indicating Intervention, Participant and Outcome Measures are used. Also a manually annotated corpus of structured and unstructured abstracts is prepared for testing a classifier that identifies sentences belonging to each category. Results Using CRFs, sentences can be labeled for the four rhetorical roles with F-scores from 0.93–0.98. This outperforms the use of Support Vector Machines. Furthermore, sentences can be automatically labeled for Intervention, Participant and Outcome Measures, in unstructured and structured abstracts where the section headings do not specifically indicate these three topics. F-scores of up to 0.83 and 0.84 are obtained for Intervention and Outcome Measure sentences. Conclusion Results indicate that some of the methodological elements of RCTs are
Directory of Open Access Journals (Sweden)
Suzanne L. Ishaq
2017-10-01
Full Text Available Sub-acute ruminal acidosis (SARA is a gastrointestinal functional disorder in livestock characterized by low rumen pH, which reduces rumen function, microbial diversity, host performance, and host immune function. Dietary management is used to prevent SARA, often with yeast supplementation as a pH buffer. Almost nothing is known about the effect of SARA or yeast supplementation on ruminal protozoal and fungal diversity, despite their roles in fiber degradation. Dairy cows were switched from a high-fiber to high-grain diet abruptly to induce SARA, with and without active dry yeast (ADY, Saccharomyces cerevisiae supplementation, and sampled from the rumen fluid, solids, and epimural fractions to determine microbial diversity using the protozoal 18S rRNA and the fungal ITS1 genes via Illumina MiSeq sequencing. Diet-induced SARA dramatically increased the number and abundance of rare fungal taxa, even in fluid fractions where total reads were very low, and reduced protozoal diversity. SARA selected for more lactic-acid utilizing taxa, and fewer fiber-degrading taxa. ADY treatment increased fungal richness (OTUs but not diversity (Inverse Simpson, Shannon, but increased protozoal richness and diversity in some fractions. ADY treatment itself significantly (P < 0.05 affected the abundance of numerous fungal genera as seen in the high-fiber diet: Lewia, Neocallimastix, and Phoma were increased, while Alternaria, Candida Orpinomyces, and Piromyces spp. were decreased. Likewise, for protozoa, ADY itself increased Isotricha intestinalis but decreased Entodinium furca spp. Multivariate analyses showed diet type was most significant in driving diversity, followed by yeast treatment, for AMOVA, ANOSIM, and weighted UniFrac. Diet, ADY, and location were all significant factors for fungi (PERMANOVA, P = 0.0001, P = 0.0452, P = 0.0068, Monte Carlo correction, respectively, and location was a significant factor (P = 0.001, Monte Carlo correction for protozoa
DEFF Research Database (Denmark)
Haarder, Jon Helt
2008-01-01
Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner......Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner...
Abstraction carrying code and resource-awareness
Hermenegildo, Manuel V.; Albert Albiol, Elvira; López García, Pedro; Puebla Sánchez, Alvaro Germán
2005-01-01
Proof-Carrying Code (PCC) is a general approach to mobile code safety in which the code supplier augments the program with a certifícate (or proof). The intended benefit is that the program consumer can locally validate the certifícate w.r.t. the "untrusted" program by means of a certifícate checker—a process which should be much simpler, eíñcient, and automatic than generating the original proof. Abstraction Carrying Code (ACC) is an enabling technology for PCC in which an abstract mod...
A Brief Introduction to Chinese Biological Abstracts
Institute of Scientific and Technical Information of China (English)
无
2005-01-01
Chinese Biological Abstracts (CBA), a state-level indexing and abstracting journal published monthly, is jointly sponsored by the Library of the Chinese Academy of Sciences, the Shanghai Institutes for Biological Sciences as well as the Biological Information Network of the Chinese Academy of Sciences, published and distributed by the Shanghai Institutes for Biological Sciences, and approved by the State Scientific and Technological Commission.
Abstracts – eine facettenreiche Textsorte der Wissenschaft
Directory of Open Access Journals (Sweden)
Ines Busch-Lauer
2012-01-01
Full Text Available Der Beitrag beschreibt die Relevanz der informationsverdichtenden Textsorte Abstract in der Wissenschaftskommunikation. Im Mittelpunkt stehen die Definition, die Klassifikation und die Struktur sowie ausgewählte Merkmale dieser Textsorte.Im ersten Teil des Beitrags werden die unterschiedlichen Arten von Abstracts anhand von Textbeispielen aus der Linguistik, der Medizin und den Technikwissenschaften expliziert. Im zweiten Teil untersucht der Beitrag anhand von Abstracts, die von deutschen Studierenden der Technik- und Ingenieurwissenschaften im Rahmen ihrer fachbezogenen Englischausbildung verfasst wurden, inwieweit die textsortenimmanenten Merkmale auch von Lernenden in der Textproduktion in der Fremdsprache umgesetzt wurden. Mit dieser qualitativ beschreibenden Untersuchung trägt die Studie zur kontrastiven Fachtextsortenbeschreibung und andererseits als Praxisbericht zur Vermittlung von Textsorten im fachbezogenen Fremdsprachenunterricht an Hochschulen bei.
05421 Abstracts Collection - Data Always and Everywhere
DEFF Research Database (Denmark)
Alonso, G.; Jensen, Christian Søndergaard; Mitschang, B.
2006-01-01
From 16.10.05 to 21.10.05, the Dagstuhl Seminar 05421, Data Always and Everywhere - Management of Mobile, Ubiquitous, Pervasive, and Sensor Data, was held in the International Conference and Research Center, Schloss Dagstuhl. During the seminar, all participants were given the opportunity...... to present their current research, and ongoing activities and open problems were discussed. This document is a collection of the abstracts of the presentations given during the seminar. Some abstracts offer links to extended abstracts, full papers, and other supporting documents. A separate companion...... document summarizes the seminar. The authors wish to acknowledge Victor Teixeira de Almeida, who served as collector for the seminar and thus played a key role in collecting materials from the seminar participants...
A "how-to" guide in preparing abstracts and poster presentations.
Boullata, Joseph I; Mancuso, Carissa E
2007-12-01
The preparation of an abstract or poster to share information from a project or case report with colleagues is a professional goal for many nutrition support practitioners. This paper provides an approach to help practitioners prepare an abstract for submission and subsequently a poster for presentation at a meeting. A nutrition support question that required collecting and evaluating information, or a unique patient case or case series, can serve as the focus of an abstract and subsequent poster. The professional meeting selected should be appropriate for the abstract topic, and the authors should closely adhere to the organization's abstract submission guidelines. The well-prepared abstract will then serve as the outline for the poster content; the visual aspect of the poster is also important to effectively communicate the information to colleagues at the meeting. Adequate time is required to prepare both the abstract and the poster in order to fittingly reflect the value of the information. Efforts in preparing the abstract will be worthwhile once the abstract has been accepted by reviewers for a poster session at the meeting. Likewise, the effort in preparing the poster in advance allows the presenter to enjoy the poster session and discuss the project with colleagues.
The Continuing Search for Variability Among Cool White Dwarfs
Schaefer, J. J.; Oswalt, T. D.; Johnston, K. B.; Rudkin, M.; Heinz, T.
2002-12-01
The Continuing Search for Variability Among Cool White Dwarfs Justin J. Schaefer University of Wyoming Department of Physics and Astronomy P.O. Box 3905 Laramie, Wyoming 82071 USA (schaefju@uwyo.edu) Terry D. Oswalt, Kyle Johnston, Merissa Rudkin, Tamalyn Heinz Florida Institute of Technology and the SARA Observatory Department of Physics & Space Sciences 150 West University Boulevard Melbourne, Florida 32901 USA (oswalt@luyten.astro.fit.edu, kyjohnst@fit.edu, mrudkin@astro.fit.edu, theinz@fit.edu) ABSTRACT We present BVRI photometry of eleven binaries with white dwarf (WD) components. The observations were obtained at the SARA 0.9-meter telescope on Kitt Peak during the summer of 2002. Standard system (B-V), (V-R) and (R-I) color indices of four white dwarfs were determined. This data will be used to estimate the WD cooling ages in wide WD+dM binaries, as part of our ongoing research program to determine the chromospheric activity-age relation for M dwarf stars. Time-series differential photometry was also collected for eight cool white dwarfs as part of a program to explore the variability in the low luminosity, low temperature regime of the WD cooling track. We failed to detect any variability greater than ~0.04 magnitudes in these stars. Several nights of differential photometry data were collected on the DAO WD + K dwarf short-period variable HS1136+6646. From the light variations we determined a likely orbital period of 0.825 +/-0.009 days. Strong evidence is presented for two other possible periods within this light curve, possibly indicative of rotational modulation by the WD component. We gratefully acknowledge support from the National Science Foundation, which funds the SARA Research Experiences for Undergraduates program via grant AST-0097616 to Florida Tech. One of us (TDO) also acknowledges partial support for this work from NASA (subcontract Y701296) and the NSF (AST 0206115).
Reasoning abstractly about resources
Clement, B.; Barrett, A.
2001-01-01
r describes a way to schedule high level activities before distributing them across multiple rovers in order to coordinate the resultant use of shared resources regardless of how each rover decides how to perform its activities. We present an algorithm for summarizing the metric resource requirements of an abstract activity based n the resource usages of its potential refinements.
Energy Technology Data Exchange (ETDEWEB)
NONE
2017-05-15
The conference proceedings SPR 2017 include abstracts on the following issues: gastrointestinal radiography - inflammatory bowel diseases, cardiovascular CTA, general muscoskeletal radiology, muscoskeletal congenital development diseases, general pediatric radiology - chest, muscoskeletal imaging - marrow and infectious disorders, state-of-the-art body MR imaging, practical pediatric sonography, quality and professionalism, CT imaging in congenital heart diseases, radiographic courses, body MT techniques, contrast enhanced ultrasound, machine learning, forensic imaging, the radiation dos conundrum - reconciling imaging, imagining and managing, the practice of radiology, interventional radiology, neuroradiology, PET/MR.
Model and information abstraction for description-driven systems
International Nuclear Information System (INIS)
Estrella, F.; McClatchey, R.; Kovacs, Z.; Goff, J.-M.L.
2001-01-01
A crucial factor in the creation of adaptable systems dealing with changing requirements is the suitability of the underlying technology in allowing the evolution of the system. A reflective system utilizes an open architecture where implicit system aspects are reified to become explicit first-class (meta-data) objects. These implicit system aspects are often fundamental structures which are inaccessible and immutable, and their reification as meta-data objects can serve as the basis for changes and extensions to the system, making it self-describing. To address the evolvability issue, the author proposes a reflective architecture based on two orthogonal abstractions-model abstraction and information abstraction. In this architecture the modeling abstractions allow for the separation of the description meta-data from the system aspects they represent so that they can be managed and versioned independently, asynchronously and explicitly
Orthopaedic Section Poster Presentations (Abstracts OPO1-OPO300).
2018-01-01
These abstracts are presented here as prepared by the authors. The accuracy and content of each abstract remain the responsibility of the authors. In the identification number above each abstract, OPO designates an Orthopaedic Section poster presentation. J Orthop Sports Phys Ther 2018;48(1):A67-A202. doi:10.2519/jospt.2018.48.1.A67.
Land Application of Sewage Effluents and Sludges: Selected Abstracts.
Environmental Protection Agency, Washington, DC. Office of Research and Development.
This report contains 568 selected abstracts concerned with the land application of sewage effluents and sludges. The abstracts are arranged in chronological groupings of ten-year periods from the l940's to the mid-l970's. The report also includes an author index and a subject matter index to facilitate reference to specific abstracts or narrower…
Is searching full text more effective than searching abstracts?
Directory of Open Access Journals (Sweden)
Lin Jimmy
2009-02-01
Full Text Available Abstract Background With the growing availability of full-text articles online, scientists and other consumers of the life sciences literature now have the ability to go beyond searching bibliographic records (title, abstract, metadata to directly access full-text content. Motivated by this emerging trend, I posed the following question: is searching full text more effective than searching abstracts? This question is answered by comparing text retrieval algorithms on MEDLINE® abstracts, full-text articles, and spans (paragraphs within full-text articles using data from the TREC 2007 genomics track evaluation. Two retrieval models are examined: bm25 and the ranking algorithm implemented in the open-source Lucene search engine. Results Experiments show that treating an entire article as an indexing unit does not consistently yield higher effectiveness compared to abstract-only search. However, retrieval based on spans, or paragraphs-sized segments of full-text articles, consistently outperforms abstract-only search. Results suggest that highest overall effectiveness may be achieved by combining evidence from spans and full articles. Conclusion Users searching full text are more likely to find relevant articles than searching only abstracts. This finding affirms the value of full text collections for text retrieval and provides a starting point for future work in exploring algorithms that take advantage of rapidly-growing digital archives. Experimental results also highlight the need to develop distributed text retrieval algorithms, since full-text articles are significantly longer than abstracts and may require the computational resources of multiple machines in a cluster. The MapReduce programming model provides a convenient framework for organizing such computations.
Advanced light source: Compendium of user abstracts 1993-1996
International Nuclear Information System (INIS)
1997-04-01
This compendium contains abstracts written by users summarizing research completed or in progress from 1993-1996, ALS technical reports describing ongoing efforts related to improvement in machine operations and research and development projects, and information on ALS beamlines planned through 1998. Two tables of contents organize the user abstracts by beamline and by area of research, and an author index makes abstracts accessible by author and by principal investigator. Technical details for each beamline including whom to contact for additional information can be found in the beamline information section. Separate abstracts have been indexed into the database for contributions to this compendium
2012-03-01
authorities. METHODS FOR CLEANING UP: Contain spillage and then collect with non-combustible absorbent material, (e.g. sand, soil , diatomaceous earth...SARA 311/312 Hazards: Fire Hazard, Acute Health Hazard, and Chronic Health Hazard CERCLA SECTION 103 and SARA SECTION 304 (RELEASE TO THE ENVIROMENT
A Functional Correspondence Between Evaluators and Abstract Machines
DEFF Research Database (Denmark)
Ager, Mads Sig; Biernacki, Dariusz; Danvy, Olivier
2003-01-01
We bridge the gap between functional evaluators and abstract machines for the λ-calculus, using closure conversion, transformation into continuation-passing style, and defunctionalization.We illustrate this approach by deriving Krivine's abstract machine from an ordinary call-by-name evaluator an...
International Nuclear Information System (INIS)
Wilson, Michael L.
2001-01-01
Drift seepage refers to flow of liquid water into repository emplacement drifts, where it can potentially contribute to degradation of the engineered systems and release and transport of radionuclides within the drifts. Because of these important effects, seepage into emplacement drifts is listed as a ''principal factor for the postclosure safety case'' in the screening criteria for grading of data in Attachment 1 of AP-3.15Q, Rev. 2, ''Managing Technical Product Inputs''. Abstraction refers to distillation of the essential components of a process model into a form suitable for use in total-system performance assessment (TSPA). Thus, the purpose of this analysis/model is to put the information generated by the seepage process modeling in a form appropriate for use in the TSPA for the Site Recommendation. This report also supports the Unsaturated-Zone Flow and Transport Process Model Report. The scope of the work is discussed below. This analysis/model is governed by the ''Technical Work Plan for Unsaturated Zone Flow and Transport Process Model Report'' (CRWMS MandO 2000a). Details of this activity are in Addendum A of the technical work plan. The original Work Direction and Planning Document is included as Attachment 7 of Addendum A. Note that the Work Direction and Planning Document contains tasks identified for both Performance Assessment Operations (PAO) and Natural Environment Program Operations (NEPO). Only the PAO tasks are documented here. The planning for the NEPO activities is now in Addendum D of the same technical work plan and the work is documented in a separate report (CRWMS MandO 2000b). The Project has been reorganized since the document was written. The responsible organizations in the new structure are the Performance Assessment Department and the Unsaturated Zone Department, respectively. The work plan for the seepage abstraction calls for determining an appropriate abstraction methodology, determining uncertainties in seepage, and providing
Earth Sciences Division collected abstracts: 1979
International Nuclear Information System (INIS)
Henry, A.L.; Schwartz, L.L.
1980-01-01
This report is a compilation of abstracts of papers, internal reports, and talks presented during 1979 at national and international meetings by members of the Earth Sciences Division, Lawrence Livermore Laboratory. The arrangement is alphabetical (by author). For a given report, a bibliographic reference appears under the name of each coauthor, but the abstract iself is given only under the name of the first author or the first Earth Sciences Division author. A topical index at the end of the report provides useful cross references, while indicating major areas of research interest in the Earth Sciences Division
Pacifier Overuse and Conceptual Relations of Abstract and Emotional Concepts.
Barca, Laura; Mazzuca, Claudia; Borghi, Anna M
2017-01-01
This study explores the impact of the extensive use of an oral device since infancy (pacifier) on the acquisition of concrete, abstract, and emotional concepts. While recent evidence showed a negative relation between pacifier use and children's emotional competence (Niedenthal et al., 2012), the possible interaction between use of pacifier and processing of emotional and abstract language has not been investigated. According to recent theories, while all concepts are grounded in sensorimotor experience, abstract concepts activate linguistic and social information more than concrete ones. Specifically, the Words As Social Tools (WAT) proposal predicts that the simulation of their meaning leads to an activation of the mouth (Borghi and Binkofski, 2014; Borghi and Zarcone, 2016). Since the pacifier affects facial mimicry forcing mouth muscles into a static position, we hypothesize its possible interference on acquisition/consolidation of abstract emotional and abstract not-emotional concepts, which are mainly conveyed during social and linguistic interactions, than of concrete concepts. Fifty-nine first grade children, with a history of different frequency of pacifier use, provided oral definitions of the meaning of abstract not-emotional, abstract emotional, and concrete words. Main effect of concept type emerged, with higher accuracy in defining concrete and abstract emotional concepts with respect to abstract not-emotional concepts, independently from pacifier use. Accuracy in definitions was not influenced by the use of pacifier, but correspondence and hierarchical clustering analyses suggest that the use of pacifier differently modulates the conceptual relations elicited by abstract emotional and abstract not-emotional. While the majority of the children produced a similar pattern of conceptual relations, analyses on the few (6) children who overused the pacifier (for more than 3 years) showed that they tend to distinguish less clearly between concrete and
Pacifier Overuse and Conceptual Relations of Abstract and Emotional Concepts
Directory of Open Access Journals (Sweden)
Laura Barca
2017-12-01
Full Text Available This study explores the impact of the extensive use of an oral device since infancy (pacifier on the acquisition of concrete, abstract, and emotional concepts. While recent evidence showed a negative relation between pacifier use and children's emotional competence (Niedenthal et al., 2012, the possible interaction between use of pacifier and processing of emotional and abstract language has not been investigated. According to recent theories, while all concepts are grounded in sensorimotor experience, abstract concepts activate linguistic and social information more than concrete ones. Specifically, the Words As Social Tools (WAT proposal predicts that the simulation of their meaning leads to an activation of the mouth (Borghi and Binkofski, 2014; Borghi and Zarcone, 2016. Since the pacifier affects facial mimicry forcing mouth muscles into a static position, we hypothesize its possible interference on acquisition/consolidation of abstract emotional and abstract not-emotional concepts, which are mainly conveyed during social and linguistic interactions, than of concrete concepts. Fifty-nine first grade children, with a history of different frequency of pacifier use, provided oral definitions of the meaning of abstract not-emotional, abstract emotional, and concrete words. Main effect of concept type emerged, with higher accuracy in defining concrete and abstract emotional concepts with respect to abstract not-emotional concepts, independently from pacifier use. Accuracy in definitions was not influenced by the use of pacifier, but correspondence and hierarchical clustering analyses suggest that the use of pacifier differently modulates the conceptual relations elicited by abstract emotional and abstract not-emotional. While the majority of the children produced a similar pattern of conceptual relations, analyses on the few (6 children who overused the pacifier (for more than 3 years showed that they tend to distinguish less clearly between
International Nuclear Information System (INIS)
Entsua-Mensah, Clement
1994-01-01
Ghana Energy Abstracts 1994 is the first issue of an annual publication of the Energy information Centre. The aim is to combine in one publication the country' s bibliographic output on energy so as to provide a valuable source of reference for policy makers, planners,and researchers. It covers the broad spectrum of energy including; energy conservation, energy resource management, petroleum and renewable energy resources.The documents listed comprise research reports, baseline studies,conference proceedings, periodical articles dissertations and theses. Keywords and author indexes have been provided to facilitate easy reference. (C.E.M)
International Nuclear Information System (INIS)
2015-01-01
The volume includes the abstracts of the ESPR 2015 covering the following topics: PCG (post graduate courses): Radiography; fluoroscopy and general issue; nuclear medicine, interventional radiology and hybrid imaging, pediatric CT, pediatric ultrasound; MRI in childhood. Scientific sessions and task force sessions: International aspects; neuroradiology, neonatal imaging, engineering techniques to simulate injury in child abuse, CT - dose and quality, challenges in the chest, cardiovascular and chest, muscoskeletal, oncology, pediatric uroradiology and abdominal imaging, fetal and postmortem imaging, education and global challenges, neuroradiology - head and neck, gastrointestinal and genitourinary.
Energy Technology Data Exchange (ETDEWEB)
NONE
2015-05-10
The volume includes the abstracts of the ESPR 2015 covering the following topics: PCG (post graduate courses): Radiography; fluoroscopy and general issue; nuclear medicine, interventional radiology and hybrid imaging, pediatric CT, pediatric ultrasound; MRI in childhood. Scientific sessions and task force sessions: International aspects; neuroradiology, neonatal imaging, engineering techniques to simulate injury in child abuse, CT - dose and quality, challenges in the chest, cardiovascular and chest, muscoskeletal, oncology, pediatric uroradiology and abdominal imaging, fetal and postmortem imaging, education and global challenges, neuroradiology - head and neck, gastrointestinal and genitourinary.
Automated Predicate Abstraction for Real-Time Models
Directory of Open Access Journals (Sweden)
Bahareh Badban
2009-11-01
Full Text Available We present a technique designed to automatically compute predicate abstractions for dense real-timed models represented as networks of timed automata. We use the CIPM algorithm in our previous work which computes new invariants for timed automata control locations and prunes the model, to compute a predicate abstraction of the model. We do so by taking information regarding control locations and their newly computed invariants into account.
International Nuclear Information System (INIS)
1987-01-01
The conference proceedings contain 152 abstracts of presented papers relating to various aspects of personnel dosimetry, the dosimetry of the working and living environment, various types of dosemeters and spectrometers, the use of radionuclides in various industrial fields, the migration of radionuclides on Czechoslovak territory after the Chernobyl accident, theoretical studies of some parameters of ionizing radiation detectors, and their calibration. (M.D.)
Brain network response underlying decisions about abstract reinforcers.
Mills-Finnerty, Colleen; Hanson, Catherine; Hanson, Stephen Jose
2014-12-01
Decision making studies typically use tasks that involve concrete action-outcome contingencies, in which subjects do something and get something. No studies have addressed decision making involving abstract reinforcers, where there are no action-outcome contingencies and choices are entirely hypothetical. The present study examines these kinds of choices, as well as whether the same biases that exist for concrete reinforcer decisions, specifically framing effects, also apply during abstract reinforcer decisions. We use both General Linear Model as well as Bayes network connectivity analysis using the Independent Multi-sample Greedy Equivalence Search (IMaGES) algorithm to examine network response underlying choices for abstract reinforcers under positive and negative framing. We find for the first time that abstract reinforcer decisions activate the same network of brain regions as concrete reinforcer decisions, including the striatum, insula, anterior cingulate, and VMPFC, results that are further supported via comparison to a meta-analysis of decision making studies. Positive and negative framing activated different parts of this network, with stronger activation in VMPFC during negative framing and in DLPFC during positive, suggesting different decision making pathways depending on frame. These results were further clarified using connectivity analysis, which revealed stronger connections between anterior cingulate, insula, and accumbens during negative framing compared to positive. Taken together, these results suggest that not only do abstract reinforcer decisions rely on the same brain substrates as concrete reinforcers, but that the response underlying framing effects on abstract reinforcers also resemble those for concrete reinforcers, specifically increased limbic system connectivity during negative frames. Copyright © 2014 Elsevier Inc. All rights reserved.
Abstracts of Research, July 1973 through June 1974.
Ohio State Univ., Columbus. Computer and Information Science Research Center.
Abstracts of research papers in the fields of computer and information science are given; 72 papers are abstracted in the areas of information storage and retrieval, information processing, linguistic analysis, artificial intelligence, mathematical techniques, systems programing, and computer networks. In addition, the Ohio State University…
From abstract to peer-reviewed publication: country matters
DEFF Research Database (Denmark)
Østergaard, Lauge; Fosbøl, Philip L.; Harrington, Robert A.
2014-01-01
Medical conferences are key in the sharing of new scientific findings. However, results reported as conference-abstracts are generally not considered final before publication in a peer-reviewed journal. It is known that approximately 1/3 of the scientific results presented as abstracts at large...
Odors and Air Pollution: A Bibliography with Abstracts.
Environmental Protection Agency, Research Triangle Park, NC. Office of Air Programs.
The annotated bibliography presents a compilation of abstracts which deal with odors as they relate to air pollution. The abstracts are arranged within the following categories: Emission sources; Control methods; Measurement methods; Air quality measurements; Atmospheric interaction; Basic science and technology; Effects-human health;…
The Conversion of Cardiovascular Conference Abstracts to Publications
DEFF Research Database (Denmark)
Fosbøl, Emil L.; Fosbøl, Philip Loldrup; Harrington, Robert A.
2012-01-01
a systematic and automated evaluation of rates, timing, and correlates of publication from scientific abstracts presented at 3 major cardiovascular conferences. Methods and Results—Using an automated computer algorithm, we searched the ISI Web of Science to identify peer-reviewed publications of abstracts......–3, 2.5–5.8) for ESC (P for difference between groups 0.01). Clinical science and population science were less likely to be published compared with basic science. Conclusions—One third of abstracts were translated into publications by 2 years after presentation and less than one half by 5 years after...
Differential emotional processing in concrete and abstract words.
Yao, Bo; Keitel, Anne; Bruce, Gillian; Scott, Graham G; O'Donnell, Patrick J; Sereno, Sara C
2018-02-12
Emotion (positive and negative) words are typically recognized faster than neutral words. Recent research suggests that emotional valence, while often treated as a unitary semantic property, may be differentially represented in concrete and abstract words. Studies that have explicitly examined the interaction of emotion and concreteness, however, have demonstrated inconsistent patterns of results. Moreover, these findings may be limited as certain key lexical variables (e.g., familiarity, age of acquisition) were not taken into account. We investigated the emotion-concreteness interaction in a large-scale, highly controlled lexical decision experiment. A 3 (Emotion: negative, neutral, positive) × 2 (Concreteness: abstract, concrete) design was used, with 45 items per condition and 127 participants. We found a significant interaction between emotion and concreteness. Although positive and negative valenced words were recognized faster than neutral words, this emotion advantage was significantly larger in concrete than in abstract words. We explored potential contributions of participant alexithymia level and item imageability to this interactive pattern. We found that only word imageability significantly modulated the emotion-concreteness interaction. While both concrete and abstract emotion words are advantageously processed relative to comparable neutral words, the mechanisms of this facilitation are paradoxically more dependent on imageability in abstract words. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
Abstracting massive data for lightweight intrusion detection in computer networks
Wang, Wei
2016-10-15
Anomaly intrusion detection in big data environments calls for lightweight models that are able to achieve real-time performance during detection. Abstracting audit data provides a solution to improve the efficiency of data processing in intrusion detection. Data abstraction refers to abstract or extract the most relevant information from the massive dataset. In this work, we propose three strategies of data abstraction, namely, exemplar extraction, attribute selection and attribute abstraction. We first propose an effective method called exemplar extraction to extract representative subsets from the original massive data prior to building the detection models. Two clustering algorithms, Affinity Propagation (AP) and traditional . k-means, are employed to find the exemplars from the audit data. . k-Nearest Neighbor (k-NN), Principal Component Analysis (PCA) and one-class Support Vector Machine (SVM) are used for the detection. We then employ another two strategies, attribute selection and attribute extraction, to abstract audit data for anomaly intrusion detection. Two http streams collected from a real computing environment as well as the KDD\\'99 benchmark data set are used to validate these three strategies of data abstraction. The comprehensive experimental results show that while all the three strategies improve the detection efficiency, the AP-based exemplar extraction achieves the best performance of data abstraction.
2012-06-04
..., development of statistical and assessment applications using standard html and java script, asp.net and Excel... the application procedures should be directed to Erika McDuffe, Program Specialist, NIC Jails Division... stay, average daily population); staffing levels, and; corrections activities and programs. It is not...
Fluidised bed technology – Applications and R&D in Southern Africa
CSIR Research Space (South Africa)
North, BC
2007-06-28
Full Text Available Bed area : 25 m2 Plant purpose : A 10 MW plant for the combustion of duff coal at greater than 98 % burnout to provide hot gases for drying slag. Subsequently also used for organic waste incineration. Project duration : 1988 to 1989 Current...
Experience gained in pilot-scale and bench-scale fluidised beds processing
CSIR Research Space (South Africa)
Hadley, TD
2006-02-01
Full Text Available for clean coal technology thrust COMMISSIONED PLANTS Slagment Hot Gas Generator Client : Slagment Bed area : 25 m2 Plant purpose : A 10 MW plant for the combustion of duff coal at greater than 98% burnout to provide hot gases for the drying...
Quick Reference Guide for IRB submission at Air Command and Staff College
2009-04-01
Description, Validation, and Application. (Ed) Lubar J.F., Haworth Press, New York. 2004; 1-29. Cronbach, L. Test Validation, In: R. Thorndike (ed...Test Validation, In: R. Thorndike (ed.) Educational Measurement. Washington, DC, American Council on Education. 2005; 443-507. Duff, J. The Usefulness
Abstract Algebra for Teachers: An Evaluative Case Study
Hoffman, Andrew Joseph
2017-01-01
This manuscript describes the study of an abstract algebra course for preservice secondary mathematics teachers (PSMTs). Often, courses in abstract algebra have not been viewed as productive, beneficial learning experiences for future teachers, both by researchers and PSMTs themselves. This despite calls for increased content knowledge for…
EIA data index: an abstract journal
International Nuclear Information System (INIS)
1980-12-01
The individual tables, graphs, and formatted data presented in the statistical publications of the Energy Information Administration (EIA) are abstracted and indexed. Included are a complete subject index and a report number listing for all EIA publications as well as complete ordering information for these publications. The abstracts of the tables and graphs are arranged by broad subject categories (e.g., coal, petroleum, natural gas, energy analysis and modeling) with further division occurring by subcategories (e.g., reserves, drilling and production, processing). Included here are those publications and their statistical contents which were released by the EIA from its formation in October 1977 through approximately the first half of 1980. Updates will be on a semiannual basis. The EIA Data Index is a companion volume to the EIA Publications Directory: A User's Guide (DOE/EIA-0149), which provides abstracts and indexes to all EIA publications at the document level. Both of these publications are generated from the Federal Energy Data Index (FEDEX) data base which has been developed by the EIA in cooperation with the Technical Information Center of the US Department of Energy
The abstract representations in speech processing.
Cutler, Anne
2008-11-01
Speech processing by human listeners derives meaning from acoustic input via intermediate steps involving abstract representations of what has been heard. Recent results from several lines of research are here brought together to shed light on the nature and role of these representations. In spoken-word recognition, representations of phonological form and of conceptual content are dissociable. This follows from the independence of patterns of priming for a word's form and its meaning. The nature of the phonological-form representations is determined not only by acoustic-phonetic input but also by other sources of information, including metalinguistic knowledge. This follows from evidence that listeners can store two forms as different without showing any evidence of being able to detect the difference in question when they listen to speech. The lexical representations are in turn separate from prelexical representations, which are also abstract in nature. This follows from evidence that perceptual learning about speaker-specific phoneme realization, induced on the basis of a few words, generalizes across the whole lexicon to inform the recognition of all words containing the same phoneme. The efficiency of human speech processing has its basis in the rapid execution of operations over abstract representations.
Moves Analysis on Abstracts Written by the Students in Academic Writing Class
Directory of Open Access Journals (Sweden)
Ajeng Setyorini
2017-09-01
Full Text Available This paper contains analysis results on abstracts written by students in Academic Writing course. The analysis includes analyses on moves and linguistic features. The analysis aims at finding out how the abstract writing structures of the English Education students are in the Academic Writing course. The abstract analysis also includes the analysis on the use of the linguistic features in the abstracts. The analysis uses a qualitative research approach. There are totally 10 abstracts that are analyzed. These are then called as the data. Data obtained is analyzed using genre analysis approach. Results of analysis on the 10 abstracts showed that some of the abstracts are written using 5 kinds of moves. All of the abstracts are found using Purpose Move and Method Move. Meanwhile, Situation Move is found in 5 abstracts. 8 abstracts are identified using Result Move. Conclusion Move is found in 5 abstracts. The results also show that all of the abstract writers use pronouns ‘the writer’ and ‘the researcher’. The use of personal pronoun ‘she’ is also found in 1 abstract. Hedges used in abstracts written by students in Academic Writing course vary from modal auxiliary verbs, adjectival, adverbial, nominal to Approximates of degree.
Enhancements to the NASA Astrophysics Science Information and Abstract Service
Kurtz, M. J.; Eichhorn, G.; Accomazzi, A.; Grant, C. S.; Murray, S. S.
1995-05-01
The NASA Astrophysics Data System Astrophysics Science Information and Abstract Service, the extension of the ADS Abstract Service continues rapidly to expand in both use and capabilities. Each month the service is used by about 4,000 different people, and returns about 1,000,000 pieces of bibliographic information. Among the recent additions to the system are: 1. Whole Text Access. In addition to the ApJ Letters we now have whole text for the ApJ on-line, soon we will have AJ and Rev. Mexicana. Discussions with other publishers are in progress. 2. Space Instrumentation Database. We now provide a second abstract service, covering papers related to space instruments. This is larger than the astronomy and astrophysics database in terms of total abstracts. 3. Reference Books and Historical Journals. We have begun putting the SAO Annals and the HCO Annals on-line. We have put the Handbook of Space Astronomy and Astrophysics by M.V. Zombeck (Cambridge U.P.) on-line. 4. Author Abstracts. We can now include original abstracts in addition to those we get from the NASA STI Abstracts Database. We have included abstracts for A&A in collaboration with the CDS in Strasbourg, and are collaborating with the AAS and the ASP on others. We invite publishers and editors of journals and conference proceedings to include their original abstracts in our service; send inquiries via e-mail to ads@cfa.harvard.edu. 5. Author Notes. We now accept notes and comments from authors of articles in our database. These are arbitrary html files and may contain pointers to other WWW documents, they are listed along with the abstracts, whole text, and data available in the index listing for every reference. The ASIAS is available at: http://adswww.harvard.edu/
Substorm associated radar auroral surges: a statistical study and possible generation model
Directory of Open Access Journals (Sweden)
B. A. Shand
Full Text Available Substorm-associated radar auroral surges (SARAS are a short lived (15–90 minutes and spatially localised (~5° of latitude perturbation of the plasma convection pattern observed within the auroral E-region. The understanding of such phenomena has important ramifications for the investigation of the larger scale plasma convection and ultimately the coupling of the solar wind, magnetosphere and ionosphere system. A statistical investigation is undertaken of SARAS, observed by the Sweden And Britain Radar Experiment (SABRE, in order to provide a more extensive examination of the local time occurrence and propagation characteristics of the events. The statistical analysis has determined a local time occurrence of observations between 1420 MLT and 2200 MLT with a maximum occurrence centred around 1700 MLT. The propagation velocity of the SARAS feature through the SABRE field of view was found to be predominately L-shell aligned with a velocity centred around 1750 m s–1 and within the range 500 m s–1 and 3500 m s–1. This comprehensive examination of the SARAS provides the opportunity to discuss, qualitatively, a possible generation mechanism for SARAS based on a proposed model for the production of a similar phenomenon referred to as sub-auroral ion drifts (SAIDs. The results of the comparison suggests that SARAS may result from a similar geophysical mechanism to that which produces SAID events, but probably occurs at a different time in the evolution of the event.
Key words. Substorms · Auroral surges · Plasma con-vection · Sub-auroral ion drifts
Dangouloff-Ros, V; Ronot, M; Lagadec, M; Vilgrain, V
2015-05-01
To evaluate the publication rate of scientific abstracts that were presented orally at the 2008, 2009, and 2010 annual meetings of the French Society of Radiology by French radiologists, and to perform a French regional analysis. Orally presented abstracts were identified by examining online abstract books of the 2008, 2009, and 2010 annual meetings of the French Society of Radiology, and cross-checked by reviewing the paper version of abstracts for the same period. Only abstracts from French teams were selected. The administrative region of submission was noted for each abstract and for each region the total population, the number of active radiologists, the number of active members of the French Society of Radiology and the number of academic radiologists were noted. Imaging subspecialties were also noted. 625 abstracts were identified resulting in 268 publications (publication rate: 43%). The median number of presentations and publications per region was 18 (range: 1-255) and 7 (range: 0-101), respectively. The ratio per million inhabitants was 7.5 and 3 respectively. The median number of presentations and publications per 100 active radiologists (respectively members of the FSR) was 7 and 3 (respectively 10 and 4). The median number of presentations and publications per academic radiologist were 2.6, and 1.2, respectively. The regional variations for each indicator were high (40-180%). Three subspecialties had a publication rate of more than 50%: thoracic imaging (58%), abdominal imaging (52%), and genitourinary imaging (51%). The publication rate of orally presented French scientific abstracts was high, with important variations according to the regions of origin and imaging subspecialties. Copyright © 2015 Éditions françaises de radiologie. Published by Elsevier Masson SAS. All rights reserved.
Abstract Cauchy problems three approaches
Melnikova, Irina V
2001-01-01
Although the theory of well-posed Cauchy problems is reasonably understood, ill-posed problems-involved in a numerous mathematical models in physics, engineering, and finance- can be approached in a variety of ways. Historically, there have been three major strategies for dealing with such problems: semigroup, abstract distribution, and regularization methods. Semigroup and distribution methods restore well-posedness, in a modern weak sense. Regularization methods provide approximate solutions to ill-posed problems. Although these approaches were extensively developed over the last decades by many researchers, nowhere could one find a comprehensive treatment of all three approaches.Abstract Cauchy Problems: Three Approaches provides an innovative, self-contained account of these methods and, furthermore, demonstrates and studies some of the profound connections between them. The authors discuss the application of different methods not only to the Cauchy problem that is not well-posed in the classical sense, b...
Is searching full text more effective than searching abstracts?
Lin, Jimmy
2009-02-03
With the growing availability of full-text articles online, scientists and other consumers of the life sciences literature now have the ability to go beyond searching bibliographic records (title, abstract, metadata) to directly access full-text content. Motivated by this emerging trend, I posed the following question: is searching full text more effective than searching abstracts? This question is answered by comparing text retrieval algorithms on MEDLINE abstracts, full-text articles, and spans (paragraphs) within full-text articles using data from the TREC 2007 genomics track evaluation. Two retrieval models are examined: bm25 and the ranking algorithm implemented in the open-source Lucene search engine. Experiments show that treating an entire article as an indexing unit does not consistently yield higher effectiveness compared to abstract-only search. However, retrieval based on spans, or paragraphs-sized segments of full-text articles, consistently outperforms abstract-only search. Results suggest that highest overall effectiveness may be achieved by combining evidence from spans and full articles. Users searching full text are more likely to find relevant articles than searching only abstracts. This finding affirms the value of full text collections for text retrieval and provides a starting point for future work in exploring algorithms that take advantage of rapidly-growing digital archives. Experimental results also highlight the need to develop distributed text retrieval algorithms, since full-text articles are significantly longer than abstracts and may require the computational resources of multiple machines in a cluster. The MapReduce programming model provides a convenient framework for organizing such computations.
Biocards and Level of Abstraction
DEFF Research Database (Denmark)
Lenau, Torben Anker; Keshwani, Sonal; Chakrabarti, Amaresh
2015-01-01
Biocards are formal descriptions of biological phenomena and their underlying functional principles. They are used in bioinspired design to document search results and to communicate the findings for use in the further design process. The present study explored the effect of abstraction level used...
Abstract Interpretation of Mobile Ambients
DEFF Research Database (Denmark)
Hansen, René Rydhof; Jensen, J. G.; Nielson, Flemming
1999-01-01
We demonstrate that abstract interpretation is useful for analysing calculi of computation such as the ambient calculus (which is based on the p-calculus); more importantly, we show that the entire development can be expressed in a constraint-based formalism that is becoming exceedingly popular...
Abstract Interpretation Using Attribute Grammar
DEFF Research Database (Denmark)
Rosendahl, Mads
1990-01-01
This paper deals with the correctness proofs of attribute grammars using methods from abstract interpretation. The technique will be described by defining a live-variable analysis for a small flow-chart language and proving it correct with respect to a continuation style semantics. The proof...
1979-12-01
abscess formation and tissue necrosis, its relationship to periodontal pockets was investigated. Specimens were obtained from maxillary and mandibular...of Organisms and Periodontal Pockets." (Abstract 4853). 10. SIMONSON, Lo Go, LAMDERTS, B. L. and JACROLA, Do R. - "Effects of Dextranases and other...the tip of the periodontal probe rests within epithelium, at or slightly apical to the coronal extent of the junctional epithelium. The purpose of
NPP life management (abstracts)
International Nuclear Information System (INIS)
Litvinskij, L.L.; Barbashev, S.V.
2002-01-01
Abstracts of the papers presented at the International conference of the Ukrainian Nuclear Society 'NPP Life Management'. The following problems are considered: modernization of the NPP; NPP life management; waste and spent nuclear fuel management; decommissioning issues; control systems (including radiation and ecological control systems); information and control systems; legal and regulatory framework. State nuclear regulatory control; PR in nuclear power; training of personnel; economics of nuclear power engineering
A logical correspondence between natural semantics and abstract machines
DEFF Research Database (Denmark)
Simmons, Robert J.; Zerny, Ian
2013-01-01
We present a logical correspondence between natural semantics and abstract machines. This correspondence enables the mechanical and fully-correct construction of an abstract machine from a natural semantics. Our logical correspondence mirrors the Reynolds functional correspondence, but we...... manipulate semantic specifications encoded in a logical framework instead of manipulating functional programs. Natural semantics and abstract machines are instances of substructural operational semantics. As a byproduct, using a substructural logical framework, we bring concurrent and stateful models...
2013-02-21
...-diameter stream diversion tunnel that would be converted to reservoir outlet works after project... afterbay to an outlet structure on a tributary to Sweetheart Creek; and an existing tributary stream... Mitchell, Business Manager, Juneau Hydropower, Inc. P.O. Box 22775, Juneau, AK 99802; email: duff.mitchell...
2013-01-15
...-diameter stream diversion tunnel that would be converted to reservoir outlet works after project... afterbay to an outlet structure on a tributary to Sweetheart Creek; and an existing tributary stream... Mitchell, Business Manager, Juneau Hydropower, Inc. P.O. Box 22775, Juneau, AK 99802; email: duff.mitchell...
2013-10-29
... Hydropower, Inc.; Notice of Subsequent Draft License Application (DLA) and Draft Preliminary Draft... Hydropower, Inc. e. Name of Project: Sweetheart Lake Hydroelectric Project. f. Location: At the confluence of..., Business Manager, Juneau Hydropower, Inc., P.O. Box 22775, Juneau, AK 99802; 907-789-2775, email: duff...
Selected Translated Abstracts of Chinese-Language Climate Change Publications; TOPICAL
International Nuclear Information System (INIS)
Cushman, R.M.; Burtis, M.D.
1999-01-01
This report contains English-translated abstracts of important Chinese-language literature concerning global climate change for the years 1995-1998. This body of literature includes the topics of adaptation, ancient climate change, climate variation, the East Asia monsoon, historical climate change, impacts, modeling, and radiation and trace-gas emissions. In addition to the biological citations and abstracts translated into English, this report presents the original citations and abstracts in Chinese. Author and title indexes are included to assist the reader in locating abstracts of particular interest
Complete Abstractions of Dynamical Systems by Timed Automata
DEFF Research Database (Denmark)
Sloth, Christoffer; Wisniewski, Rafael
2013-01-01
This paper addresses the generation of complete abstractions of polynomial dynamical systems by timed automata. For the proposed abstraction, the state space is divided into cells by sublevel sets of functions. We identify a relation between these functions and their directional derivatives along...... to approximate the dynamical system, in a subset of admissible subdivisioning functions....
Comprehension of concrete and abstract words in semantic dementia
Jefferies, Elizabeth; Patterson, Karalyn; Jones, Roy W.; Lambon Ralph, Matthew A.
2009-01-01
The vast majority of brain-injured patients with semantic impairment have better comprehension of concrete than abstract words. In contrast, several patients with semantic dementia (SD), who show circumscribed atrophy of the anterior temporal lobes bilaterally, have been reported to show reverse imageability effects, i.e., relative preservation of abstract knowledge. Although these reports largely concern individual patients, some researchers have recently proposed that superior comprehension of abstract concepts is a characteristic feature of SD. This would imply that the anterior temporal lobes are particularly crucial for processing sensory aspects of semantic knowledge, which are associated with concrete not abstract concepts. However, functional neuroimaging studies of healthy participants do not unequivocally predict reverse imageability effects in SD because the temporal poles sometimes show greater activation for more abstract concepts. We examined a case-series of eleven SD patients on a synonym judgement test that orthogonally varied the frequency and imageability of the items. All patients had higher success rates for more imageable as well as more frequent words, suggesting that (a) the anterior temporal lobes underpin semantic knowledge for both concrete and abstract concepts, (b) more imageable items – perhaps due to their richer multimodal representations – are typically more robust in the face of global semantic degradation and (c) reverse imageability effects are not a characteristic feature of SD. PMID:19586212
NSF-RANN trace contaminants abstracts
International Nuclear Information System (INIS)
Copenhaver, E.D.; Harnden, D.S.
1976-10-01
Specific areas of interest of the Environmental Aspects of Trace Contaminants Program are organic chemicals of commerce, metals and organometallic compounds, air-borne contaminants, and environmental assay methodology. Fifty-three abstracts of literature on trace contaminants are presented. Author, keyword, and permuted title indexes are included
Ad Oculos. Images, Imagination and Abstract Thinking
Directory of Open Access Journals (Sweden)
Alessandra Cirafici
2018-03-01
Full Text Available The unusual edition of Elements of Euclid released for publishing in 1847 by Oliver Byrne offers the occasion to suggest a few elements for discussion on the uniqueness of the ‘representation’ of geometric-mathematical thinking—and more in general of the abstract thinking—enshrined in its ‘nature of a pure imaginative vision able to connect the intelligible with the tangible’. The purpose is, thus, a reasoning on images and communicative artefacts, that, when articulated, provide different variations of the idea of ‘transcription’ of complex theoretical structures from one language (that of abstract logic to another (that of sensory experience, with a view to facilitate, ease and make more accurate the noetic process. Images able over time to facilitate the understanding of complex and abstract theoretical principles—since able to show them in an extremely concrete way, ad oculos,—and which at some points could reveal the horizons of art interpretation to inscrutable and figurative meaningless formulas.
RNA structure alignment by a unit-vector approach.
Capriotti, Emidio; Marti-Renom, Marc A
2008-08-15
The recent discovery of tiny RNA molecules such as microRNAs and small interfering RNA are transforming the view of RNA as a simple information transfer molecule. Similar to proteins, the native three-dimensional structure of RNA determines its biological activity. Therefore, classifying the current structural space is paramount for functionally annotating RNA molecules. The increasing numbers of RNA structures deposited in the PDB requires more accurate, automatic and benchmarked methods for RNA structure comparison. In this article, we introduce a new algorithm for RNA structure alignment based on a unit-vector approach. The algorithm has been implemented in the SARA program, which results in RNA structure pairwise alignments and their statistical significance. The SARA program has been implemented to be of general applicability even when no secondary structure can be calculated from the RNA structures. A benchmark against the ARTS program using a set of 1275 non-redundant pairwise structure alignments results in inverted approximately 6% extra alignments with at least 50% structurally superposed nucleotides and base pairs. A first attempt to perform RNA automatic functional annotation based on structure alignments indicates that SARA can correctly assign the deepest SCOR classification to >60% of the query structures. The SARA program is freely available through a World Wide Web server http://sgu.bioinfo.cipf.es/services/SARA/. Supplementary data are available at Bioinformatics online.
Learning abstract algebra with ISETL
Dubinsky, Ed
1994-01-01
Most students in abstract algebra classes have great difficulty making sense of what the instructor is saying. Moreover, this seems to remain true almost independently of the quality of the lecture. This book is based on the constructivist belief that, before students can make sense of any presentation of abstract mathematics, they need to be engaged in mental activities which will establish an experiential base for any future verbal explanation. No less, they need to have the opportunity to reflect on their activities. This approach is based on extensive theoretical and empirical studies as well as on the substantial experience of the authors in teaching astract algebra. The main source of activities in this course is computer constructions, specifically, small programs written in the mathlike programming language ISETL; the main tool for reflections is work in teams of 2-4 students, where the activities are discussed and debated. Because of the similarity of ISETL expressions to standard written mathematics...
Communication and Agreement Abstractions for Fault-Tolerant Asynchronous Distributed Systems
Raynal, Michel
2010-01-01
Understanding distributed computing is not an easy task. This is due to the many facets of uncertainty one has to cope with and master in order to produce correct distributed software. Considering the uncertainty created by asynchrony and process crash failures in the context of message-passing systems, the book focuses on the main abstractions that one has to understand and master in order to be able to produce software with guaranteed properties. These fundamental abstractions are communication abstractions that allow the processes to communicate consistently (namely the register abstraction
Directory of Open Access Journals (Sweden)
Tibor Koltay
2010-04-01
Full Text Available Information literacy is a complex phenomenon that requires a multifaceted interdisciplinary approach as it is related to verbal communication, literacy, functional literacy and academic literacy, including issues of plagiarism. It also includes text authoring in a full range of genres, among others abstracts. Abstracting is a well-known act of verbal communication, and abstracts are a genre of written communication. The essence of abstracting is summarizing information making use of critical reading. Abstracting thus can be regarded as one of the instances of exercising information literacy on a higher level. Both information literacy and abstracting are of prime professional interest for linguists (among others in the field of ESP and information professionals.
Experiencing art: the influence of expertise and painting abstraction level
Directory of Open Access Journals (Sweden)
Elina ePihko
2011-09-01
Full Text Available How does expertise influence the perception of representational and abstract paintings? We asked 20 experts on art history and 20 laypersons to explore and evaluate a series of paintings ranging in style from representational to abstract in five categories. We compared subjective aesthetic judgments and emotional evaluations, gaze patterns, and electrodermal reactivity between the two groups of participants. The level of abstraction affected aesthetic judgments and emotional valence ratings of the laypersons but had no effect on the opinions of the experts: the laypersons’ aesthetic and emotional ratings were highest for representational paintings and lowest for abstract paintings, whereas the opinions of the experts were independent of the abstraction level. The gaze patterns of both groups changed as the level of abstraction increased: the number of fixations and the length of the scanpaths increased while the duration of the fixations decreased. The viewing strategies—reflected in the target, location and path of the fixations—however indicated that experts and laypersons paid attention to different aspects of the paintings. The electrodermal reactivity did not vary according to the level of abstraction in either group but expertise was reflected in weaker responses, compared with laypersons, to information received about the paintings.
Yalçınkaya, Merter; Bagatur, Erdem
2013-01-01
The aim of this study was to evaluate the publication rates of full-text articles after presentation of abstracts at a Turkish National Orthopaedics and Traumatology Congress, determine the time lag from the congress date to publication of full-text articles and assess the consistency between abstracts and the subsequent publications. All abstracts from the scientific program of the 20th Turkish National Orthopaedics and Traumatology Congress (2007) were identified and computerized PubMed searches were conducted to determine whether an abstract had been followed by publication of a full-text article and key features were compared to evaluate their consistency. The time lag to publication and the impact factors of the journals where the articles were published were noted. Of the 770 abstracts (264 oral, 506 poster presentations), 227 (29.5%) were followed by a full-text and 116 (44%) of the 264 oral and 111 (22%) of the 506 poster presentations were published. The mean time to publication was 14.9±16.075 (range: 33 to 55) months. Thirty-three (14.5%) were published prior to the presentation at the congress. The likelihood of publication decreased after the third year (26 of 227, 11.5%). A total of 182 (80.2%) articles showed inconsistencies with the abstract; 74 (32.6%) minor, 14 (6.2%) major, and 94 (41.4%) minor and major inconsistencies. The mean impact factor of the journals was 1.152±0.858. The vast majority of abstracts presented at this congress were not followed by publication of a full-text article. Additionally, frequent inconsistencies between the final published article and the original abstract indicated the inadequacy of quality of reporting in abstracts.
The neural representation of abstract words: the role of emotion.
Vigliocco, Gabriella; Kousta, Stavroula-Thaleia; Della Rosa, Pasquale Anthony; Vinson, David P; Tettamanti, Marco; Devlin, Joseph T; Cappa, Stefano F
2014-07-01
It is generally assumed that abstract concepts are linguistically coded, in line with imaging evidence of greater engagement of the left perisylvian language network for abstract than concrete words (Binder JR, Desai RH, Graves WW, Conant LL. 2009. Where is the semantic system? A critical review and meta-analysis of 120 functional neuroimaging studies. Cerebral Cortex. 19:2767-2796; Wang J, Conder JA, Blitzer DN, Shinkareva SV. 2010. Neural representation of abstract and concrete concepts: A meta-analysis of neuroimaging studies. Hum Brain Map. 31:1459-1468). Recent behavioral work, which used tighter matching of items than previous studies, however, suggests that abstract concepts also entail affective processing to a greater extent than concrete concepts (Kousta S-T, Vigliocco G, Vinson DP, Andrews M, Del Campo E. The representation of abstract words: Why emotion matters. J Exp Psychol Gen. 140:14-34). Here we report a functional magnetic resonance imaging experiment that shows greater engagement of the rostral anterior cingulate cortex, an area associated with emotion processing (e.g., Etkin A, Egner T, Peraza DM, Kandel ER, Hirsch J. 2006. Resolving emotional conflict: A role for the rostral anterior cingulate cortex in modulating activity in the amygdala. Neuron. 52:871), in abstract processing. For abstract words, activation in this area was modulated by the hedonic valence (degree of positive or negative affective association) of our items. A correlation analysis of more than 1,400 English words further showed that abstract words, in general, receive higher ratings for affective associations (both valence and arousal) than concrete words, supporting the view that engagement of emotional processing is generally required for processing abstract words. We argue that these results support embodiment views of semantic representation, according to which, whereas concrete concepts are grounded in our sensory-motor experience, affective experience is crucial in the
Selected Translated Abstracts of Russian-Language Climate-Change Publications, II. Clouds
Energy Technology Data Exchange (ETDEWEB)
Ravina, C.B.
1994-01-01
This report presents abstracts (translated into English) of important Russian-language literature concerning clouds as they relate to climate change. In addition to the bibliographic citations and abstracts translated into English, this report presents the original citations and abstracts in Russian. Author and title indexes are included, to assist the reader in locating abstracts of particular interest.
What does the brain tell us about abstract art?
Directory of Open Access Journals (Sweden)
Vered eAviv
2014-02-01
Full Text Available In this essay I focus on the question of why we are attracted to abstract art (or, perhaps more accurately, non-representational art. After elaborating on the processing of visual art in general and abstract art in particular, I discuss recent data from neuroscience and behavioral studies related to abstract art. I conclude with several speculations concerning our apparent appeal to this particular type of art. In particular, I claim that abstract art frees our brain from the dominance of reality, enabling it to flow within its inner states, create new emotional and cognitive associations, and activate brain-states that are otherwise harder to access. This process is apparently rewarding as it enables the exploration of yet undiscovered inner territories of the viewer’s brain.
Arche papers on the mathematics of abstraction
Cook, Roy T
2007-01-01
This volume collects together a number of important papers concerning both the method of abstraction generally and the use of particular abstraction principles to reconstruct central areas of mathematics along logicist lines. Gottlob Frege's original logicist project was, in effect, refuted by Russell's paradox. Crispin Wright has recently revived Frege's enterprise, however, providing a philosophical and technical framework within which a reconstruction of arithmetic is possible. While the Neo-Fregean project has recieved extensive attention and discussion, the present volume is unique in pre
From Outermost Reduction Semantics to Abstract Machine
DEFF Research Database (Denmark)
Danvy, Olivier; Johannsen, Jacob
to transform a reduction-based normalization function into a reduction-free one where the reduction sequence is not enumerated. This reduction-free normalization function takes the form of an abstract machine that navigates from one redex site to the next without systematically detouring via the root...... of a redex. In this article, we consider such an outermost reduction semantics with backward-overlapping rules, and we investigate how to apply refocusing to still obtain a reduction-free normalization function in the form of an abstract machine....
1982-12-01
Third Molars in Naval Personnel,- (Abstract #1430) 7. A. SEROWSKI* and F. AKER --"The Effect of Marine and Fresh-Water Atmospheric Environments on...record to determine changes in surface coverage or other outcomes -- extraction, endodontic therapy , crown placement -- which occurred over time. The...MR0412002-0443. 0 e5 History of Retention and Extraction of Third Molars in Naval Personnel. D. C. SCHROEDER*, J. C. CECIL and M. E. COHEN. Naval
Teaching abstraction in introductory courses
Koppelman, Herman; van Dijk, Betsy
Abstraction is viewed as a key concept in computer science. It is not only an important concept but also one that is difficult to master. This paper focuses on the problems that novices experience when they first encounter this concept. Three assignments from introductory courses are analyzed, to
Control-flow analysis of function calls and returns by abstract interpretation
DEFF Research Database (Denmark)
Midtgaard, Jan; Jensen, Thomas P.
2009-01-01
We derive a control-flow analysis that approximates the interprocedural control-flow of both function calls and returns in the presence of first-class functions and tail-call optimization. In addition to an abstract environment, our analysis computes for each expression an abstract control stack......, effectively approximating where function calls return across optimized tail calls. The analysis is systematically calculated by abstract interpretation of the stack-based CaEK abstract machine of Flanagan et al. using a series of Galois connections. Abstract interpretation provides a unifying setting in which...
Algorithmic Approach to Abstracting Linear Systems by Timed Automata
DEFF Research Database (Denmark)
Sloth, Christoffer; Wisniewski, Rafael
2011-01-01
This paper proposes an LMI-based algorithm for abstracting dynamical systems by timed automata, which enables automatic formal verification of linear systems. The proposed abstraction is based on partitioning the state space of the system using positive invariant sets, generated by Lyapunov...... functions. This partitioning ensures that the vector field of the dynamical system is transversal to all facets of the cells, which induces some desirable properties of the abstraction. The algorithm is based on identifying intersections of level sets of quadratic Lyapunov functions, and determining...
International Nuclear Information System (INIS)
1978-01-01
This volume contains the program and abstracts of the conference. The following topics are included: metal vapor molecular lasers, magnetohydrodynamics, rare gas halide and nuclear pumped lasers, transfer mechanisms in arcs, kinetic processes in rare gas halide lasers, arcs and flows, XeF kinetics and lasers, fundamental processes in excimer lasers, electrode effects and vacuum arcs, electron and ion transport, ion interactions and mobilities, glow discharges, diagnostics and afterglows, dissociative recombination, electron ionization and excitation, rare gas excimers and group VI lasers, breakdown, novel laser pumping techniques, electrode-related discharge phenomena, photon interactions, attachment, plasma chemistry and infrared lasers, electron scattering, and reactions of excited species
Energy Technology Data Exchange (ETDEWEB)
NONE
2016-05-15
The volume on the meeting of pediatric radiology includes abstract on the following issues: chest, cardiovascular system, neuroradiology, CT radiation DRs (diagnostic reference levels) and dose reporting guidelines, genitourinary imaging, gastrointestinal radiology, oncology an nuclear medicine, whole body imaging, fetal/neonates imaging, child abuse, oncology and hybrid imaging, value added imaging, muscoskeletal imaging, dose and radiation safety, imaging children - immobilization and distraction techniques, information - education - QI and healthcare policy, ALARA, the knowledge skills and competences for a technologist/radiographer in pediatric radiology, full exploitation of new technological features in pediatric CT, image quality issues in pediatrics, abdominal imaging, interventional radiology, MR contrast agents, tumor - mass imaging, cardiothoracic imaging, ultrasonography.
International Nuclear Information System (INIS)
2016-01-01
The volume on the meeting of pediatric radiology includes abstract on the following issues: chest, cardiovascular system, neuroradiology, CT radiation DRs (diagnostic reference levels) and dose reporting guidelines, genitourinary imaging, gastrointestinal radiology, oncology an nuclear medicine, whole body imaging, fetal/neonates imaging, child abuse, oncology and hybrid imaging, value added imaging, muscoskeletal imaging, dose and radiation safety, imaging children - immobilization and distraction techniques, information - education - QI and healthcare policy, ALARA, the knowledge skills and competences for a technologist/radiographer in pediatric radiology, full exploitation of new technological features in pediatric CT, image quality issues in pediatrics, abdominal imaging, interventional radiology, MR contrast agents, tumor - mass imaging, cardiothoracic imaging, ultrasonography.
Abstract concepts, language and sociality: from acquisition to inner speech.
Borghi, Anna M; Barca, Laura; Binkofski, Ferdinand; Tummolini, Luca
2018-08-05
The problem of representation of abstract concepts, such as 'freedom' and 'justice', has become particularly crucial in recent years, owing to the increased success of embodied and grounded views of cognition. We will present a novel view on abstract concepts and abstract words. Since abstract concepts do not have single objects as referents, children and adults might rely more on input from others to learn them; we, therefore, suggest that linguistic and social experience play an important role for abstract concepts. We will discuss evidence obtained in our and other laboratories showing that processing of abstract concepts evokes linguistic interaction and social experiences, leading to the activation of the mouth motor system. We will discuss the possible mechanisms that underlie this activation. Mouth motor system activation can be due to re-enactment of the experience of conceptual acquisition, which occurred through the mediation of language. Alternatively, it could be due to the re-explanation of the word meaning, possibly through inner speech. Finally, it can be due to a metacognitive process revealing low confidence in the meaning of our concepts. This process induces in us the need to rely on others to ask/negotiate conceptual meaning. We conclude that with abstract concepts language works as a social tool: it extends our thinking abilities and pushes us to rely on others to integrate our knowledge.This article is part of the theme issue 'Varieties of abstract concepts: development, use, and representation in the brain'. © 2018 The Author(s).
Abstract generalized vector quasi-equilibrium problems in noncompact Hadamard manifolds
Directory of Open Access Journals (Sweden)
Haishu Lu
2017-05-01
Full Text Available Abstract This paper deals with the abstract generalized vector quasi-equilibrium problem in noncompact Hadamard manifolds. We prove the existence of solutions to the abstract generalized vector quasi-equilibrium problem under suitable conditions and provide applications to an abstract vector quasi-equilibrium problem, a generalized scalar equilibrium problem, a scalar equilibrium problem, and a perturbed saddle point problem. Finally, as an application of the existence of solutions to the generalized scalar equilibrium problem, we obtain a weakly mixed variational inequality and two mixed variational inequalities. The results presented in this paper unify and generalize many known results in the literature.
ILL2020 Vision - Posters and Abstracts
International Nuclear Information System (INIS)
Baker, M.L.; Bocian, A.; Bousige, C.; Cermak, P.; Cooper, J.F.K.; Cronenberg, G.; Ford, S.; Hennig, M.; Jones, A.O.F.; Knoll, W.; Leung, K.; Mourigal, M.; Sigrist, M.S.; Trapp, M.; Wang, Weiwei; Martinez Pena, J.L.; Ruegg, C.; Bramwell, S.; Klotz, S.; Fragneto, G.; Fouquet, P.; Nesvizhevsky, V.V.; Harrison, A.; Andersen, K.; Lelievre-Berna, E.; Schober, H.; Enderle, M.; Jobic, H.; Wilson, C.C.; Teschner, D.; Bourges, P.; Braden, M.; McMorrow, D.; Snogerup Linse, S.; Podjarny, A.; Richardson, J.; Schurtenberger, P.; Farago, B.; Pfrang, C.; Simpson, G.; Plonka-Spehr, C.; Nuttall, W.J.; Chapon, L.C.; Koza, M.M.; Withers, P.J.; Zabel, H.; Lyonnard, S.; Morineau, D.; Salmon, P.S.; Johnson, M.; Forsyth, T.; Wagner, R.
2011-01-01
The aim of the Millennium Programme is to maintain and develop the ILL's instrument suite as the world reference, as well as to upgrade our support facilities and basic neutron technologies so that they continue to satisfy changing demands from the user community. This document gathers the abstracts of the poster session and the paper abstracts. The posters present the latest achievements in the application of neutrons diffraction for instance to the dynamics of molecules or the study of magnetism. The topics of the papers is more about the need for new equipment than about research topics. The proposals for new or upgraded equipment includes neutron spin-echo spectrometers, multimodal diffractometers, time-of-flight spectrometers, small angle neutron spectrometers, and high magnetic field devices for spectroscopy
Regulatory and technical reports (abstract index journal)
International Nuclear Information System (INIS)
1994-03-01
This compilation consists of bibliographic data and abstracts for the formal regulatory and technical reports issued by the US Nuclear Regulatory Commission staff and its contractors. There are four types of reports included: staff reports, conference reports, contractor reports, and international agreement reports. In addition to the main citations with abstracts, the following are also included: Secondary report number index; Personal author index; Subject index; NRC originating organization indices for staff reports and international agreement reports; NRC contract sponsor index; Contractor index; International organization index; and Licensed facility index
Handbook for inventorying surface fuels and biomass in the Interior West
James K. Brown; Rick D. Oberheu; Cameron M. Johnston
1982-01-01
Presents comprehensive procedures for inventorying weight per unit area of living and dead surface vegetation, to facilitate estimation of biomass and appraisal of fuels. Provides instructions for conducting fieldwork and calculating estimates of downed woody material, forest floor litter and duff, herbaceous vegetation, shrubs, and small conifers. Procedures produce...
2013-08-14
... drop their eggs in the vicinity of the food plant, Eryngium yuccifolium (rattlesnake-master), where the eggs overwinter in the duff; young larvae emerge between mid-May and early June (Derkovitz 2013, pers... time, 10 known sites contain rattlesnake-master borer moths in 8 Illinois counties (Will, Cook, Grundy...
2012-10-16
.... 791(a)-825(r). h. Applicant Contact: Duff Mitchell, Business Manager, Juneau Hydropower, Inc., P.O... information at the end of your comments. For assistance, please contact FERC Online Support at FERCOnline... access the document. For assistance, contact FERC Online Support. You may also register online at http...
2010-10-05
... Hydropower, Inc.; Notice of Intent To File License Application, Filing of Pre-Application Document, and....: 13563-001. c. Dated Filed: July 28, 2010. d. Submitted By: Juneau Hydropower, Inc. e. Name of Project... Commission's regulations. h. Potential Applicant Contact: Duff W. Mitchell, Juneau Hydropower, Inc., P.O. Box...
13th International Mass Spectrometry Conference. Book of Abstracts
International Nuclear Information System (INIS)
1994-01-01
The collection contains abstracts of several hundred papers presented at the international conference on new research and development results and applications of mass spectrometry. Abstracts falling into the INIS scope were indexed separately in the INIS database. (Roboz, P.)
13th International Mass Spectrometry Conference. Book of Abstracts
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
The collection contains abstracts of several hundred papers presented at the international conference on new research and development results and applications of mass spectrometry. Abstracts falling into the INIS scope were indexed separately in the INIS database. (Roboz, P.).
Coupling Radar Rainfall to Hydrological Models for Water Abstraction Management
Asfaw, Alemayehu; Shucksmith, James; Smith, Andrea; MacDonald, Ken
2015-04-01
The impacts of climate change and growing water use are likely to put considerable pressure on water resources and the environment. In the UK, a reform to surface water abstraction policy has recently been proposed which aims to increase the efficiency of using available water resources whilst minimising impacts on the aquatic environment. Key aspects to this reform include the consideration of dynamic rather than static abstraction licensing as well as introducing water trading concepts. Dynamic licensing will permit varying levels of abstraction dependent on environmental conditions (i.e. river flow and quality). The practical implementation of an effective dynamic abstraction strategy requires suitable flow forecasting techniques to inform abstraction asset management. Potentially the predicted availability of water resources within a catchment can be coupled to predicted demand and current storage to inform a cost effective water resource management strategy which minimises environmental impacts. The aim of this work is to use a historical analysis of UK case study catchment to compare potential water resource availability using modelled dynamic abstraction scenario informed by a flow forecasting model, against observed abstraction under a conventional abstraction regime. The work also demonstrates the impacts of modelling uncertainties on the accuracy of predicted water availability over range of forecast lead times. The study utilised a conceptual rainfall-runoff model PDM - Probability-Distributed Model developed by Centre for Ecology & Hydrology - set up in the Dove River catchment (UK) using 1km2 resolution radar rainfall as inputs and 15 min resolution gauged flow data for calibration and validation. Data assimilation procedures are implemented to improve flow predictions using observed flow data. Uncertainties in the radar rainfall data used in the model are quantified using artificial statistical error model described by Gaussian distribution and
Perlindungan Hukum Kelompok Teisme dalam Sistem Negara Hukum Pancasila
Directory of Open Access Journals (Sweden)
Tomy Michael
2017-05-01
Full Text Available Di era global saat ini, suatu bangsa dituntut mampu bersaing dengan negara lain. Agar tidak terlepas dari unsur khas Indonesia maka penguatan Pancasila sebagai ideologi adalah keharusan. Pancasila yang melingkupi keragaman suku, agama, ras dan antar golongan (SARA kurang tercermin dalam UU Nomor 23 Tahun 2006. Permasalahan yang timbul yaitu hilangnya unsur khas Indonesia yaitu kepercayaan atau agama tradisional karena adanya diskriminasi dengan pengosongan kolom agama dalam Kartu Kelurga (KK dan Kartu Tanda Penduduk (KTP (Pasal 61 dan Pasal 64 UU No. 23-2006. Penelitian ini bertujuan untuk menganalisis korelasi hukum UU No. 23 tahun 2016 dengan keberadaan Pancasila dan SARA di Indonesia. Metode penelitian yang digunakan adalah penelitian hukum normatif. Hasil penelitian ini menunjukkan bahwa UU No. 23 Tahun 2006 tidak selaras dengan semangat Pancasila yang mengakui keragaman SARA dan bertentang dengan asas keadilan dalam UU No. 12Tahun 2011. In the global era, a nation supposedly able to compete with other countries. In order not to be separated from the typical elements of Indonesia, the strengthening of Pancasila as an ideology is a must. Pancasila surrounding ethnic, religious, racial and sectarian (SARA less diversity reflected in Law No. 23 of 2006. The problems that arise, namely the loss of the typical elements of Indonesia namely traditional religious beliefs or because of their discrimination by emptying the religion column in Family Card (KK and Identity Card (KTP (Article 61 and Article 64 of Law No. 23-2006. This study aims to analyze the correlation on Law No. 23of 2016 with the existence of Pancasila and SARA in Indonesia. The method used is a normative legal research. The result of this study reveals that the Law No. 23 of 2006 not in line with the spirit of Pancasila that recognizes the diversity of SARA and incompatible with the principles of justice on Law No. 12 of 2011.
Medical physics 2013. Abstracts
International Nuclear Information System (INIS)
Treuer, Harald
2013-01-01
The proceedings of the medical physics conference 2013 include abstract of lectures and poster sessions concerning the following issues: Tele-therapy - application systems, nuclear medicine and molecular imaging, neuromodulation, hearing and technical support, basic dosimetry, NMR imaging -CEST (chemical exchange saturation transfer), medical robotics, magnetic particle imaging, audiology, radiation protection, phase contrast - innovative concepts, particle therapy, brachytherapy, computerized tomography, quantity assurance, hybrid imaging techniques, diffusion and lung NMR imaging, image processing - visualization, cardiac and abdominal NMR imaging.
Journal of Food Technology in Africa - Vol 7, No 3 (2002)
African Journals Online (AJOL)
Identification of Lactic Acid Bacteria isolated from Opaque beer (Chibuku) for potential use as a starter culture. Chamunorwa A Togo, Sara B Sara B. Feresu, Anthony Mutukumira. http://dx.doi.org/10.4314/jfta.v7i3.19239 · Performance of different strains of Pleurotus species under Ghanaian conditions. K Vowotor, M Obodai.
GIBS Geospatial Data Abstraction Library (GDAL)
National Aeronautics and Space Administration — GDAL is an open source translator library for raster geospatial data formats that presents a single abstract data model to the calling application for all supported...
International Nuclear Information System (INIS)
2006-01-01
This publications related with Hacettepe University, Turkish Atomic Energy Authority, The Scientific and Technological Research Council of Turkey, International Atomic Energy Agency, CEA-Saclay, CEA-Saclay Drecam, ANKAmall Shopping Center and Ion Beam Applications Industrial that was held in Antalya, Turkey, 23-28 September 2006. A separate abstract was prepared for each paper
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
This publications related with Hacettepe University, Turkish Atomic Energy Authority, The Scientific and Technological Research Council of Turkey, International Atomic Energy Agency, CEA-Saclay, CEA-Saclay Drecam, ANKAmall Shopping Center and Ion Beam Applications Industrial that was held in Antalya, Turkey, 23-28 September 2006. A separate abstract was prepared for each paper.
GOClonto: an ontological clustering approach for conceptualizing PubMed abstracts.
Zheng, Hai-Tao; Borchert, Charles; Kim, Hong-Gee
2010-02-01
Concurrent with progress in biomedical sciences, an overwhelming of textual knowledge is accumulating in the biomedical literature. PubMed is the most comprehensive database collecting and managing biomedical literature. To help researchers easily understand collections of PubMed abstracts, numerous clustering methods have been proposed to group similar abstracts based on their shared features. However, most of these methods do not explore the semantic relationships among groupings of documents, which could help better illuminate the groupings of PubMed abstracts. To address this issue, we proposed an ontological clustering method called GOClonto for conceptualizing PubMed abstracts. GOClonto uses latent semantic analysis (LSA) and gene ontology (GO) to identify key gene-related concepts and their relationships as well as allocate PubMed abstracts based on these key gene-related concepts. Based on two PubMed abstract collections, the experimental results show that GOClonto is able to identify key gene-related concepts and outperforms the STC (suffix tree clustering) algorithm, the Lingo algorithm, the Fuzzy Ants algorithm, and the clustering based TRS (tolerance rough set) algorithm. Moreover, the two ontologies generated by GOClonto show significant informative conceptual structures.
SATURATED ZONE FLOW AND TRANSPORT MODEL ABSTRACTION
International Nuclear Information System (INIS)
B.W. ARNOLD
2004-01-01
The purpose of the saturated zone (SZ) flow and transport model abstraction task is to provide radionuclide-transport simulation results for use in the total system performance assessment (TSPA) for license application (LA) calculations. This task includes assessment of uncertainty in parameters that pertain to both groundwater flow and radionuclide transport in the models used for this purpose. This model report documents the following: (1) The SZ transport abstraction model, which consists of a set of radionuclide breakthrough curves at the accessible environment for use in the TSPA-LA simulations of radionuclide releases into the biosphere. These radionuclide breakthrough curves contain information on radionuclide-transport times through the SZ. (2) The SZ one-dimensional (I-D) transport model, which is incorporated in the TSPA-LA model to simulate the transport, decay, and ingrowth of radionuclide decay chains in the SZ. (3) The analysis of uncertainty in groundwater-flow and radionuclide-transport input parameters for the SZ transport abstraction model and the SZ 1-D transport model. (4) The analysis of the background concentration of alpha-emitting species in the groundwater of the SZ
Variability-Specific Abstraction Refinement for Family-Based Model Checking
DEFF Research Database (Denmark)
Dimovski, Aleksandar; Wasowski, Andrzej
2017-01-01
and property, while the number of possible scenarios is very large. In this work, we present an automatic iterative abstraction refinement procedure for family-based model checking. We use Craig interpolation to refine abstract variational models based on the obtained spurious counterexamples (traces...
Reading and Abstracting Journal Articles in Sedimentology and Stratigraphy.
Conrad, Susan Howes
1991-01-01
An assignment centered on reading journal articles and writing abstracts is an effective way to improve student reading and writing skills in sedimentology and stratigraphy laboratories. Each student reads two articles and writes informative abstracts from the author's point of view. (PR)
Abstract analogical reasoning in high-functioning children with autism spectrum disorders.
Green, Adam E; Kenworthy, Lauren; Mosner, Maya G; Gallagher, Natalie M; Fearon, Edward W; Balhana, Carlos D; Yerys, Benjamin E
2014-12-01
Children with autism spectrum disorders (ASD) exhibit a deficit in spontaneously recognizing abstract similarities that are crucial for generalizing learning to new situations. This may contribute to deficits in the development of appropriate schemas for navigating novel situations, including social interactions. Analogical reasoning is the central cognitive mechanism that enables typically developing children to understand abstract similarities between different situations. Intriguingly, studies of high-functioning children with ASD point to a relative cognitive strength in basic, nonabstract forms of analogical reasoning. If this analogical reasoning ability extends to abstract analogical reasoning (i.e., between superficially dissimilar situations), it may provide a bridge between a cognitive capability and core ASD deficits in areas such as generalization and categorization. This study tested whether preserved analogical reasoning abilities in ASD can be extended to abstract analogical reasoning, using photographs of real-world items and situations. Abstractness of the analogies was determined via a quantitative measure of semantic distance derived from latent semantic analysis. Children with ASD performed as well as typically developing children at identifying abstract analogical similarities when explicitly instructed to apply analogical reasoning. Individual differences in abstract analogical reasoning ability predicted individual differences in a measure of social function in the ASD group. Preliminary analyses indicated that children with ASD, but not typically developing children, showed an effect of age on abstract analogical reasoning. These results provide new evidence that children with ASD are capable of identifying abstract similarities through analogical reasoning, pointing to abstract analogical reasoning as a potential lever for improving generalization skills and social function in ASD. © 2014 International Society for Autism Research, Wiley
Abstract Interpretation-based verification/certification in the ciaoPP system
Puebla Sánchez, Alvaro Germán; Albert Albiol, Elvira; Hermenegildo, Manuel V.
2005-01-01
CiaoPP is the abstract interpretation-based preprocessor of the Ciao multi-paradigm (Constraint) Logic Programming system. It uses modular, incremental abstract interpretation as a fundamental tool to obtain information about programs. In CiaoPP, the semantic approximations thus produced have been applied to perform high- and low-level optimizations during program compilation, including transformations such as múltiple abstract specialization, parallelization, partial evaluation, resource...
From mind to matter: neural correlates of abstract and concrete mindsets
Liberman, Nira; Maril, Anat
2014-01-01
Much work in the field of social cognition shows that adopting an abstract (vs concrete) mindset alters the way people construe the world, thereby exerting substantial effects across innumerable aspects of human behavior. In order to investigate the cognitive and neural basis of these effects, we scanned participants as they performed two widely used tasks that induce an abstracting vs concretizing mindsets. Specifically, participants: (i) indicated ‘why’ perform certain activities (a task that involves abstraction) or ‘how’ the same activities are performed (a task that involves concretization) and (ii) generated superordinate categories for certain objects (a task that involves abstraction) or subordinate exemplars for the same objects (a task that involves concretization). We conducted a conjunction analysis of the two tasks, in order to uncover the neural activity associated with abstraction and concretization. The results showed that concretization was associated with activation in fronto-parietal regions implicated in goal-directed action; abstraction was associated with activity within posterior regions implicated in visual perception. We discuss these findings in light of construal-level theory’s notion of abstraction. PMID:23482624
Institute of Scientific and Technical Information of China (English)
2012-01-01
Strategic Realism: An Option for China' s Grand Strategy Song Dexing (4) [ Abstract] As a non-Western emerging power, China should positively adapt its grand strategy to the strategic psychological traits in the 21st century, maintain a realist tone consistent with the national conditions of China, and avoid adventurist policies while awaring both strategic strength and weakness. In the 21st century, China' s grand strategy should be based on such core values as security, development, peace and justice, especially focusing on development in particular, which we named "strategic realism". Given the profound changes in China and the world, strategic realism encourages active foreign policy to safe- guard the long-term national interests of China. Following the self-help logic and the fun- damental values of security and prosperity, strategic realism concerns national interests as its top-priority. It advocates smart use of power, and aims to achieve its objectives by optimizing both domestic and international conditions. From the perspective of diplomatic phi- losophy, strategic realism is not a summarization of concrete policies but a description of China' s grand strategy orientations in the new century. [ Key Words] China, grand strategy, strategic realism [ Author]Song Dexing, Professor, Ph.D. Supervisor, and Director of the Center for International Strategic Studies, University of International Studies of PLA.
Computational Abstraction Steps
DEFF Research Database (Denmark)
Thomsen, Lone Leth; Thomsen, Bent; Nørmark, Kurt
2010-01-01
and class instantiations. Our teaching experience shows that many novice programmers find it difficult to write programs with abstractions that materialise to concrete objects later in the development process. The contribution of this paper is the idea of initiating a programming process by creating...... or capturing concrete values, objects, or actions. As the next step, some of these are lifted to a higher level by computational means. In the object-oriented paradigm the target of such steps is classes. We hypothesise that the proposed approach primarily will be beneficial to novice programmers or during...... the exploratory phase of a program development process. In some specific niches it is also expected that our approach will benefit professional programmers....
An introduction to abstract algebra
Robinson, Derek JS
2003-01-01
This is a high level introduction to abstract algebra which is aimed at readers whose interests lie in mathematics and in the information and physical sciences. In addition to introducing the main concepts of modern algebra, the book contains numerous applications, which are intended to illustrate the concepts and to convince the reader of the utility and relevance of algebra today. In particular applications to Polya coloring theory, latin squares, Steiner systems and error correcting codes are described. Another feature of the book is that group theory and ring theory are carried further than is often done at this level. There is ample material here for a two semester course in abstract algebra. The importance of proof is stressed and rigorous proofs of almost all results are given. But care has been taken to lead the reader through the proofs by gentle stages. There are nearly 400 problems, of varying degrees of difficulty, to test the reader''s skill and progress. The book should be suitable for students ...
Verification Based on Set-Abstraction Using the AIF Framework
DEFF Research Database (Denmark)
Mödersheim, Sebastian Alexander
The AIF framework is a novel method for analyzing advanced security protocols, web services, and APIs, based a new abstract interpretation method. It consists of the specification language AIF and a translation/abstraction processes that produces a set of first-order Horn clauses. These can...
Retributivist Arguments against Presuming Innocence : Answering to Duff
van Dijk, A.A.
2013-01-01
Factors justifying not presuming innocence are generally incorporated into the Presumption of Innocence (PoI). A confusing discourse has resulted: numerous guilt-presuming acts are deemed consistent with the PoI. I argue for an unusually broad PoI: any act that might convey to a reasonable actor
Fuel: Logs, sticks, needles, duff, and much more
Russell T. Graham; Theresa Benevidez Jain; Alan E. Harvey
2000-01-01
Fuels burned by either prescribed or wildfires are complex and important components of forested ecosystems. Fine fuels consisting of fallen limbs, twigs, and leaves of shrubs and trees are rich in nutrients. If these fuels are not immediately burned, nutrients can leach from these materials into the forest floor, especially if they overwinter. Larger fuels consisting...
Book Review: Commemoration as Conflict: Space, Memory and Identity in Peace Processes
DEFF Research Database (Denmark)
McQuaid, Sara Dybris
2016-01-01
Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7......Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7...
Directory of Open Access Journals (Sweden)
Renee M Petri
Full Text Available Subacute rumen acidotic (SARA conditions are a consequence of high grain feeding. Recent work has shown that the pattern of grain feeding can significantly impact the rumen epimural microbiota. In a continuation of these works, the objective of this study was to determine the role of grain feeding patterns on the colonization and associated changes in predicted functional properties of the fiber-adherent microbial community over a 48 h period. Eight rumen-cannulated Holstein cows were randomly assigned to interrupted or continuous 60%-grain challenge model (n = 4 per model to induce SARA conditions. Cows in the continuous model were challenged for 4 weeks, whereas cows of interrupted model had a 1-wk break in between challenges. To determine dynamics of rumen fiber-adherent microbial community we incubated the same hay from the diet samples for 24 and 48 h in situ during the baseline (no grain fed, week 1 and 4 of the continuous grain feeding model as well as during the week 1 following the break in the interrupted model. Microbial DNA was extracted and 16SrRNA amplicon (V3-V5 region sequencing was done with the Illumina MiSeq platform. A significant decrease (P 0.1% relative abundance in the rumen, 18 of which were significantly impacted by the feeding challenge model. Correlation analysis of the significant OTUs to rumen pH as an indicator of SARA showed genus Succiniclasticum had a positive correlation to SARA conditions regardless of treatment. Predictive analysis of functional microbial properties suggested that the glyoxylate/dicarboxylate pathway was increased in response to SARA conditions, decreased between 24h to 48h of incubation, negatively correlated with propanoate metabolism and positively correlated to members of the Veillonellaceae family including Succiniclasticum spp. This may indicate an adaptive response in bacterial metabolism under SARA conditions. This research clearly indicates that changes to the colonizing fiber
Early positivity signals changes in an abstract linguistic pattern.
Directory of Open Access Journals (Sweden)
Júlia Monte-Ordoño
Full Text Available The extraction of abstract structures from speech (or from gestures in the case of sign languages has been claimed to be a fundamental mechanism for language acquisition. In the present study we registered the neural responses that are triggered when a violation of an abstract, token-independent rule is detected. We registered ERPs while presenting participants with trisyllabic CVCVCV nonsense words in an oddball paradigm. Standard stimuli followed an ABB rule (where A and B are different syllables. Importantly, to distinguish neural responses triggered by changes in surface information from responses triggered by changes in the underlying abstract structure, we used two types of deviant stimuli. Phoneme deviants differed from standards only in their phonemes. Rule deviants differed from standards in both their phonemes and their composing rule. We observed a significant positivity as early as 300 ms after the presentation of deviant stimuli that violated the abstract rule (Rule deviants. The amplitude of this neural response was correlated with participants' performance in a behavioral rule learning test. Differences in electrophysiological responses observed between learners and non-learners suggest that individual differences in an abstract rule learning task might be related to how listeners select relevant sources of information.
The Emotions of Abstract Words: A Distributional Semantic Analysis.
Lenci, Alessandro; Lebani, Gianluca E; Passaro, Lucia C
2018-04-06
Recent psycholinguistic and neuroscientific research has emphasized the crucial role of emotions for abstract words, which would be grounded by affective experience, instead of a sensorimotor one. The hypothesis of affective embodiment has been proposed as an alternative to the idea that abstract words are linguistically coded and that linguistic processing plays a key role in their acquisition and processing. In this paper, we use distributional semantic models to explore the complex interplay between linguistic and affective information in the representation of abstract words. Distributional analyses on Italian norming data show that abstract words have more affective content and tend to co-occur with contexts with higher emotive values, according to affective statistical indices estimated in terms of distributional similarity with a restricted number of seed words strongly associated with a set of basic emotions. Therefore, the strong affective content of abstract words might just be an indirect byproduct of co-occurrence statistics. This is consistent with a version of representational pluralism in which concepts that are fully embodied either at the sensorimotor or at the affective level live side-by-side with concepts only indirectly embodied via their linguistic associations with other embodied words. Copyright © 2018 Cognitive Science Society, Inc.
A half century of abstracting at the African Studies Centre Leiden
Doorn, van M.C.A.
2013-01-01
The article discusses the history of the abstracts and indexing journal originally known as 'Documentatieblad,' which was renamed to 'African Studies Abstracts (ASA)' and later to 'African Studies Abstracts Online' (ASAO), published by the African Studies Centre (ASC) in Leiden, the Netherlands
South African Journal of Animal Science - Vol 38, No 3 (2008)
African Journals Online (AJOL)
Effects of ovariectomy and anabolic steroid implantation on the somatotrophic axis in feedlot heifers · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CR Bailey, GC Duff, SR Sanders, SP Cuneo, CP McMurphy, SW Limesand, JA Marchello, DW Schafer, ML Rhoads, ...
Fixed Points on Abstract Structures without the Equality Test
DEFF Research Database (Denmark)
Korovina, Margarita
2002-01-01
The aim of this talk is to present a study of definability properties of fixed points of effective operators on abstract structures without the equality test. The question of definability of fixed points of -operators on abstract structures with equality was first studied by Gandy, Barwise, Mosch...
Final program and book of abstracts
International Nuclear Information System (INIS)
1999-01-01
The Israel Nuclear Society, Israel Society of radiation protection, Israel Society of medical Physics and Israel Society of Radiation Research combined in the 20th conference of the Nuclear Societies in Israel. Extended abstracts are presented
Final program and book of abstracts
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-12-20
The Israel Nuclear Society, Israel Society of radiation protection, Israel Society of medical Physics and Israel Society of Radiation Research combined in the 20th conference of the Nuclear Societies in Israel. Extended abstracts are presented.
Small Business Innovation Research. Abstracts of Phase I awards, 1999
Energy Technology Data Exchange (ETDEWEB)
None
1999-12-01
This booklet presents technical abstracts of Phase I awards made in Fiscal Year (FY) 1999 under the DOE Small Business Innovation Research (SBIR) program. SBIR research explores innovative concepts in important technological and scientific areas that can lead to valuable new technology and products. The work described in the abstracts is novel, high-risk research, but the benefits will also be potentially high if the objectives are met. Brief comments on the potential applications, as described by the awardee, are given after each abstract. Individuals and organizations, including venture capital and larger industrial firms, with an interest in the research described in any of the abstracts are encouraged to contact the appropriate small business directly.
Control-Flow Analysis of Function Calls and Returns by Abstract Interpretation
DEFF Research Database (Denmark)
Midtgaard, Jan; Jensen, Thomas P.
, effectively approximating where function calls return across optimized tail calls. The analysis is systematically calculated by abstract interpretation of the stack-based CaEK abstract machine of Flanagan et al. using a series of Galois connections. Abstract interpretation provides a unifying setting in which...
The value of Institute of Human Virology meeting abstracts and beyond
Directory of Open Access Journals (Sweden)
Jeang Kuan-Teh
2005-12-01
Full Text Available Abstract This month Retrovirology publishes the meeting abstracts from the 10th annual Institute of Human Virology conference held August 29th to September 2nd, 2005 in Baltimore, Maryland, USA. In this editorial, the rationale for publishing meeting abstracts is discussed.
Abstraction and climate change in Europe
Laize, Cedric
2014-01-01
Invited oral presentation at the British Hydrological Society National meeting on "Hydroecology and water abstraction: science, practice and licence reform", Birmingham, 18 December 2013. Link below: full paper in River Research and Applications (Laize et al., 2014)
Moves Analysis on Abstracts Written by the Students in Academic Writing Class
Ajeng Setyorini
2017-01-01
This paper contains analysis results on abstracts written by students in Academic Writing course. The analysis includes analyses on moves and linguistic features. The analysis aims at finding out how the abstract writing structures of the English Education students are in the Academic Writing course. The abstract analysis also includes the analysis on the use of the linguistic features in the abstracts. The analysis uses a qualitative research approach. There are totally 10 abstracts that are...
International Nuclear Information System (INIS)
Bowers, M.K.; Rodgers, B.R.; Jolley, R.L.
1986-05-01
The overall task of this program was to provide an assessment of currently available technology for treating commercial low-level radioactive waste (LLRW), to initiate development of a methodology for choosing one technology for a given application, and to identify research needed to improve current treatment techniques and decision methodology. The resulting report is issued in four volumes. Volume 3 of this series is a collection of abstracts of most of the reference documents used for this study. Because of the large volume of literature, the abstracts have been printed in two separate parts. Volume 3, part 1 presents abstracts of the open literature relating to LLRW treatment methodologies. Some of these references pertain to treatment processes for hazardous wastes that may also be applicable to LLRW management. All abstracts have been limited to 21 lines (for brevity), but each abstract contains sufficient information to enable the reader to determine the potential usefulness of the source document and to locate each article. The abstracts are arranged alphabetically by author or organization, and indexed by keyword
Energy Technology Data Exchange (ETDEWEB)
Bowers, M.K.; Rodgers, B.R.; Jolley, R.L.
1986-05-01
The overall task of this program was to provide an assessment of currently available technology for treating commercial low-level radioactive waste (LLRW), to initiate development of a methodology for choosing one technology for a given application, and to identify research needed to improve current treatment techniques and decision methodology. The resulting report is issued in four volumes. Volume 3 of this series is a collection of abstracts of most of the reference documents used for this study. Because of the large volume of literature, the abstracts have been printed in two separate parts. Volume 3, part 1 presents abstracts of the open literature relating to LLRW treatment methodologies. Some of these references pertain to treatment processes for hazardous wastes that may also be applicable to LLRW management. All abstracts have been limited to 21 lines (for brevity), but each abstract contains sufficient information to enable the reader to determine the potential usefulness of the source document and to locate each article. The abstracts are arranged alphabetically by author or organization, and indexed by keyword.
Radioactive isotopes in clinical medicine and research. Abstracts
International Nuclear Information System (INIS)
2005-01-01
The contribution displays 44 abstracts and 35 posters from the 27th International Symposium on ''radioactive isotopes in clinical medicine and research'', organized by the Austrian society of nuclear medicine and the department of nuclear medicine and the center for biomedical engineering and physics of the Vienna medical university. The abstracts are sorted according to lecture headers: radiopharmaceutical sciences, endocrinology, clinical PET, neurology, oncology, physics and instrumentation, cardiology, inflammation, therapy and varia. (uke)
Visually defining and querying consistent multi-granular clinical temporal abstractions.
Combi, Carlo; Oliboni, Barbara
2012-02-01
The main goal of this work is to propose a framework for the visual specification and query of consistent multi-granular clinical temporal abstractions. We focus on the issue of querying patient clinical information by visually defining and composing temporal abstractions, i.e., high level patterns derived from several time-stamped raw data. In particular, we focus on the visual specification of consistent temporal abstractions with different granularities and on the visual composition of different temporal abstractions for querying clinical databases. Temporal abstractions on clinical data provide a concise and high-level description of temporal raw data, and a suitable way to support decision making. Granularities define partitions on the time line and allow one to represent time and, thus, temporal clinical information at different levels of detail, according to the requirements coming from the represented clinical domain. The visual representation of temporal information has been considered since several years in clinical domains. Proposed visualization techniques must be easy and quick to understand, and could benefit from visual metaphors that do not lead to ambiguous interpretations. Recently, physical metaphors such as strips, springs, weights, and wires have been proposed and evaluated on clinical users for the specification of temporal clinical abstractions. Visual approaches to boolean queries have been considered in the last years and confirmed that the visual support to the specification of complex boolean queries is both an important and difficult research topic. We propose and describe a visual language for the definition of temporal abstractions based on a set of intuitive metaphors (striped wall, plastered wall, brick wall), allowing the clinician to use different granularities. A new algorithm, underlying the visual language, allows the physician to specify only consistent abstractions, i.e., abstractions not containing contradictory conditions on
Abstracting event-based control models for high autonomy systems
Luh, Cheng-Jye; Zeigler, Bernard P.
1993-01-01
A high autonomy system needs many models on which to base control, management, design, and other interventions. These models differ in level of abstraction and in formalism. Concepts and tools are needed to organize the models into a coherent whole. The paper deals with the abstraction processes for systematic derivation of related models for use in event-based control. The multifaceted modeling methodology is briefly reviewed. The morphism concepts needed for application to model abstraction are described. A theory for supporting the construction of DEVS models needed for event-based control is then presented. An implemented morphism on the basis of this theory is also described.
Health physics research abstracts no. 11
International Nuclear Information System (INIS)
1984-07-01
The present issue No. 11 of Health Physics Research Abstracts is the continuation of a series of Bulletins published by the Agency since 1967. They collect reports from Member States on Health Physics research in progress or just completed. The main aim in issuing such reports is to draw attention to work that is about to be published and to enable interested scientists to obtain further information through direct correspondence with the investigators. The attention of users of this publication is drawn to the fact that abstracts of published documents on Health Physics are published eventually in INIS Atomindex, which is one of the output products of the Agency's International Nuclear Information System. The present issue contains 235 reports received up to December 1983 from the following Member States. In parentheses the country's ISO code and number of reports are given
AIF-ω: Set-Based Protocol Abstraction with Countable Families
DEFF Research Database (Denmark)
Mödersheim, Sebastian Alexander; Bruni, Alessandro
2016-01-01
this limitation by abstracting state into countable families of sets. We can then formalize a problem with unbounded agents, where each agent maintains its own set of keys. Still, our method does not loose the benefits of the abstraction approach, in particular, it translates a verification problem to a set...
Making Sense of the Abstraction Hierarchy in the Power Plant Domain
DEFF Research Database (Denmark)
Lind, Morten
2003-01-01
The paper discusses the abstraction hierarchy proposed by Rasmussen [(1986) Information processing and human-machine interaction, North-Holland] for design of human-machine interfaces for supervisory control. The purpose of the abstraction hierarchy is to represent a work domain by multiple levels...... of means-end and part-whole abstractions. It is argued in the paper that the abstraction hierarchy suffers from both methodological and conceptual problems. A cluster of selected problems are analyzed and illustrated by concrete examples from the power plant domain. It is concluded that the semantics...... in the model-building process. It is also pointed out that attempts to clarify the semantics of the abstraction hierarchy will invariably reduce the range of work domains where it can be applied....
Methods for solving reasoning problems in abstract argumentation – A survey
Charwat, Günther; Dvořák, Wolfgang; Gaggl, Sarah A.; Wallner, Johannes P.; Woltran, Stefan
2015-01-01
Within the last decade, abstract argumentation has emerged as a central field in Artificial Intelligence. Besides providing a core formalism for many advanced argumentation systems, abstract argumentation has also served to capture several non-monotonic logics and other AI related principles. Although the idea of abstract argumentation is appealingly simple, several reasoning problems in this formalism exhibit high computational complexity. This calls for advanced techniques when it comes to implementation issues, a challenge which has been recently faced from different angles. In this survey, we give an overview on different methods for solving reasoning problems in abstract argumentation and compare their particular features. Moreover, we highlight available state-of-the-art systems for abstract argumentation, which put these methods to practice. PMID:25737590
Energy Technology Data Exchange (ETDEWEB)
Sahin, S [Gazi University, Technical Education Faculty, Ankara (Turkey)
2007-07-01
In this book Conference Program and Abstracts were included 13th International Conference on Emerging Nuclear Energy Systems which held between 03-08 June 2007 in Istanbul, Turkey. The main objective of International Conference series on Emerging Nuclear Energy Systems (ICENES) is to provide an international scientific and technical forum for scientists, engineers, industry leaders, policy makers, decision makers and young professionals who will shape future energy supply and technology , for a broad review and discussion of various advanced, innovative and non-conventional nuclear energy production systems. The main topics of 159 accepted papers from 35 countries are fusion science and technology, fission reactors, accelerator driven systems, transmutation, laser in nuclear technology, radiation shielding, nuclear reactions, hydrogen energy, solar energy, low energy physics and societal issues.
International Nuclear Information System (INIS)
Sahin, S.
2007-01-01
In this book Conference Program and Abstracts were included 13th International Conference on Emerging Nuclear Energy Systems which held between 03-08 June 2007 in Istanbul, Turkey. The main objective of International Conference series on Emerging Nuclear Energy Systems (ICENES) is to provide an international scientific and technical forum for scientists, engineers, industry leaders, policy makers, decision makers and young professionals who will shape future energy supply and technology , for a broad review and discussion of various advanced, innovative and non-conventional nuclear energy production systems. The main topics of 159 accepted papers from 35 countries are fusion science and technology, fission reactors, accelerator driven systems, transmutation, laser in nuclear technology, radiation shielding, nuclear reactions, hydrogen energy, solar energy, low energy physics and societal issues
Beauty in abstract paintings: Perceptual contrast and statistical properties
Directory of Open Access Journals (Sweden)
Birgit eMallon
2014-03-01
Full Text Available In this study, we combined the behavioral and objective approach in the field of empirical aesthetics. First, we studied the perception of beauty by investigating shifts in evaluation on perceived beauty of abstract artworks (Experiment 1. Because the participants showed heterogeneous individual preferences for the paintings, we divided them into seven clusters for the test. The experiment revealed a clear pattern of perceptual contrast. The perceived beauty of abstract paintings increased after exposure to paintings that were rated as less beautiful, and it decreased after exposure to paintings that were rated as more beautiful. Next, we searched for correlations of beauty ratings and perceptual contrast with statistical properties of abstract artworks (Experiment 2. The participants showed significant preferences for certain image properties. These preferences differed between the clusters of participants. Strikingly, next to color measures like hue, saturation, value and lightness, the recently described PHOG self-similarity value seems to be a predictor for aesthetic appreciation of abstract artworks. We speculate that the shift in evaluation in Experiment 1 was, at least in part, based on low-level adaptation to some of the statistical image properties analyzed in Experiment 2. In conclusion, our findings demonstrate that the perception of beauty in abstract artworks is altered after exposure to beautiful or non-beautiful images and correlates with particular image properties, especially color measures and self-similarity.
STEM Education Related Dissertation Abstracts: A Bounded Qualitative Meta-study
Banning, James; Folkestad, James E.
2012-12-01
This article utilizes a bounded qualitative meta-study framework to examine the 101 dissertation abstracts found by searching the ProQuest Dissertation and Theses™ digital database for dissertations abstracts from 1990 through 2010 using the search terms education, science, technology, engineer, and STEM/SMET. Professional search librarians established the search criteria used to establish the database. The overarching research question for this study was: What can we learn from the examination of doctoral dissertations abstracts that focus on the STEM education found from 1990 through 2010? The study's findings provide an overview of doctoral research related to STEM education and the discussion section focuses on quality of abstracts, questions regarding the use of the pipeline metaphor, and location of instructional innovation.
An abstract machine model of dynamic module replacement
Walton, Chris; Kırlı, Dilsun; Gilmore, Stephen
2000-01-01
In this paper we define an abstract machine model for the mλ typed intermediate language. This abstract machine is used to give a formal description of the operation of run-time module replacement for the programming language Dynamic ML. The essential technical device which we employ for module replacement is a modification of two-space copying garbage collection. We show how the operation of module replacement could be applied to other garbage-collected languages such as Java.
Program and Abstracts, Boron Americas IX Final Report
Energy Technology Data Exchange (ETDEWEB)
Feakes, Debra A.
2006-08-09
The Scientific and Technical Information (STI) submitted includes the final report and a collection of abstracts for the Ninth Boron in the Americas Conference which was held May 19-22, 2004, in San Marcos, Texas. The topics covered in the abstracts include: Application in Medicine, Application in Organic Synthesis and Catalysis, Boranes and Carboranes, Materials and Polymers, Metallaboranes and Metallacarboranes, Organoboron Compounds, Synthesis and Catalysis, and Theoretical Studies. Attendees represented researchers from government, industry, and academia.
Luguri, Jamie B; Napier, Jaime L; Dovidio, John F
2012-07-01
Myrdal (1944) described the "American dilemma" as the conflict between abstract national values ("liberty and justice for all") and more concrete, everyday prejudices. We leveraged construal-level theory to empirically test Myrdal's proposition that construal level (abstract vs. concrete) can influence prejudice. We measured individual differences in construal level (Study 1) and manipulated construal level (Studies 2 and 3); across these three studies, we found that adopting an abstract mind-set heightened conservatives' tolerance for groups that are perceived as deviating from Judeo-Christian values (gay men, lesbians, Muslims, and atheists). Among participants who adopted a concrete mind-set, conservatives were less tolerant of these nonnormative groups than liberals were, but political orientation did not have a reliable effect on tolerance among participants who adopted an abstract mind-set. Attitudes toward racial out-groups and dominant groups (e.g., Whites, Christians) were unaffected by construal level. In Study 3, we found that the effect of abstract thinking on prejudice was mediated by an increase in concerns about fairness.
Abstract Word Definition in Patients with Amnestic Mild Cognitive Impairment
Kim, Soo Ryon; Baek, Min Jae; Kim, HyangHee
2015-01-01
The aims of this study were to investigate concrete and abstract word definition ability (1) between patients with amnestic mild cognitive impairment (aMCI) and normal adults and (2) between the aMCI subtypes (i.e., amnestic single-domain MCI and amnestic multidomain MCI; asMCI and amMCI) and normal controls. The 68 patients with aMCI (29 asMCI and 39 amMCI) and 93 age- and education-matched normal adults performed word definition tasks composed of five concrete (e.g., train) and five abstract nouns (e.g., jealousy). Task performances were analyzed on total score, number of core meanings, and number of supplementary meanings. The results were as follows. First, the aMCI patients scored significantly poorer than the normal controls in only abstract word definition. Second, both subtypes of aMCI performed worse than the controls in only abstract word definition. In conclusion, a definition task of abstract rather than concrete concepts may provide richer information to show semantic impairment of aMCI. PMID:26347214
Abstract Word Definition in Patients with Amnestic Mild Cognitive Impairment
Directory of Open Access Journals (Sweden)
Soo Ryon Kim
2015-01-01
Full Text Available The aims of this study were to investigate concrete and abstract word definition ability (1 between patients with amnestic mild cognitive impairment (aMCI and normal adults and (2 between the aMCI subtypes (i.e., amnestic single-domain MCI and amnestic multidomain MCI; asMCI and amMCI and normal controls. The 68 patients with aMCI (29 asMCI and 39 amMCI and 93 age- and education-matched normal adults performed word definition tasks composed of five concrete (e.g., train and five abstract nouns (e.g., jealousy. Task performances were analyzed on total score, number of core meanings, and number of supplementary meanings. The results were as follows. First, the aMCI patients scored significantly poorer than the normal controls in only abstract word definition. Second, both subtypes of aMCI performed worse than the controls in only abstract word definition. In conclusion, a definition task of abstract rather than concrete concepts may provide richer information to show semantic impairment of aMCI.
Clark, Allan
1984-01-01
This concise, readable, college-level text treats basic abstract algebra in remarkable depth and detail. An antidote to the usual surveys of structure, the book presents group theory, Galois theory, and classical ideal theory in a framework emphasizing proof of important theorems.Chapter I (Set Theory) covers the basics of sets. Chapter II (Group Theory) is a rigorous introduction to groups. It contains all the results needed for Galois theory as well as the Sylow theorems, the Jordan-Holder theorem, and a complete treatment of the simplicity of alternating groups. Chapter III (Field Theory)
Parameterized Dataflow (Extended Abstract
Directory of Open Access Journals (Sweden)
Dominic Duggan
2016-10-01
Full Text Available Dataflow networks have application in various forms of stream processing, for example for parallel processing of multimedia data. The description of dataflow graphs, including their firing behavior, is typically non-compositional and not amenable to separate compilation. This article considers a dataflow language with a type and effect system that captures the firing behavior of actors. This system allows definitions to abstract over actor firing rates, supporting the definition and safe composition of actor definitions where firing rates are not instantiated until a dataflow graph is launched.
Effects of semantic neighborhood density in abstract and concrete words.
Reilly, Megan; Desai, Rutvik H
2017-12-01
Concrete and abstract words are thought to differ along several psycholinguistic variables, such as frequency and emotional content. Here, we consider another variable, semantic neighborhood density, which has received much less attention, likely because semantic neighborhoods of abstract words are difficult to measure. Using a corpus-based method that creates representations of words that emphasize featural information, the current investigation explores the relationship between neighborhood density and concreteness in a large set of English nouns. Two important observations emerge. First, semantic neighborhood density is higher for concrete than for abstract words, even when other variables are accounted for, especially for smaller neighborhood sizes. Second, the effects of semantic neighborhood density on behavior are different for concrete and abstract words. Lexical decision reaction times are fastest for words with sparse neighborhoods; however, this effect is stronger for concrete words than for abstract words. These results suggest that semantic neighborhood density plays a role in the cognitive and psycholinguistic differences between concrete and abstract words, and should be taken into account in studies involving lexical semantics. Furthermore, the pattern of results with the current feature-based neighborhood measure is very different from that with associatively defined neighborhoods, suggesting that these two methods should be treated as separate measures rather than two interchangeable measures of semantic neighborhoods. Copyright © 2017 Elsevier B.V. All rights reserved.
Terrestrial ecology in South Africa - project abstracts for 1980-1981
CSIR Research Space (South Africa)
Huntley, BJ
1982-12-01
Full Text Available Abstracts are provided for research projects conducted during 1980-1981 in South African terrestrial ecosystems. The abstracts are arranged alphabetically according to author name and a keyword index is provided....
Reconstruction of abstract quantum theory
International Nuclear Information System (INIS)
Drieschner, M.; Goernitz, T.; von Weizsaecker, C.F.
1988-01-01
Understanding quantum theory as a general theory of prediction, we reconstruct abstract quantum theory. Abstract means the general frame of quantum theory, without reference to a three-dimensional position space, to concepts like particle or field, or to special laws of dynamics. Reconstruction is the attempt to do this by formulating simple and plausible postulates on prediction in order to derive the basic concepts of quantum theory from them. Thereby no law of classical physics is presupposed which would then have to be quantized. We briefly discuss the relationship of theory and interpretation in physics and the fundamental role of time as a basic concept for physics. Then a number of assertions are given, formulated as succinctly as possible in order to make them easily quotable and comparable. The assertations are arranged in four groups: heuristic principles, verbal definitions of some terms, three basic postulates, and consequences. The three postulates of separable alternatives, indeterminism, and kinematics are the central points of this work. These brief assertions are commented upon, and their relationship with the interpretation of quantum theory is discussed. Also given are an outlook on the further development into concrete quantum theory and some philosophical reflections
Tense Use and Move Analysis in Journal Article Abstracts
Wang, Shih-ping; Tu, Pin-ning
2014-01-01
There has long been a growing interest in journal article (JA) abstract writing, and this pervading interest has boosted the exigency for further research. This current study therefore aims to investigate both the various applications of verb tense and the rhetorical structure within JA abstracts. A corpus of 1,000 JAs was collected from four…
Student Scientific Conference 2001. Abstracts of papers of students and post-graduate students
International Nuclear Information System (INIS)
Stankovicova, H.
2001-04-01
The aim of the Student Scientific Conference was to review the works of students and post-graduate students from universities of the Slovak Republic and Czech Republic as well as from Slovak Academy of Sciences and Czech Academy of Sciences. The proceedings of the conference contain 63 abstracts of Biological Section, 16 abstracts of Didactic Section, 39 abstracts of Environmental Section, 15 abstracts of Geography Section, 12 abstracts of Geology Section, and 42 abstracts of Chemical Section
Constraint-Based Abstraction of a Model Checker for Infinite State Systems
DEFF Research Database (Denmark)
Banda, Gourinath; Gallagher, John Patrick
Abstract interpretation-based model checking provides an approach to verifying properties of infinite-state systems. In practice, most previous work on abstract model checking is either restricted to verifying universal properties, or develops special techniques for temporal logics such as modal t...... to implementation of abstract model checking algorithms for abstract domains based on constraints, making use of an SMT solver....
Full-text publication of abstracts presented at European Orthodontic Society congresses.
Livas, Christos; Pandis, Nikolaos; Ren, Yijin
2014-10-01
Empirical evidence has indicated that only a subsample of studies conducted reach full-text publication and this phenomenon has become known as publication bias. A form of publication bias is the selectively delayed full publication of conference abstracts. The objective of this article was to examine the publication status of oral abstracts and poster-presentation abstracts, included in the scientific program of the 82nd and 83rd European Orthodontic Society (EOS) congresses, held in 2006 and 2007, and to identify factors associated with full-length publication. A systematic search of PubMed and Google Scholar databases was performed in April 2013 using author names and keywords from the abstract title to locate abstract and full-article publications. Information regarding mode of presentation, type of affiliation, geographical origin, statistical results, and publication details were collected and analyzed using univariable and multivariable logistic regression. Approximately 51 per cent of the EOS 2006 and 55 per cent of the EOS 2007 abstracts appeared in print more than 5 years post congress. A mean period of 1.32 years elapsed between conference and publication date. Mode of presentation (oral or poster), use of statistical analysis, and research subject area were significant predictors for publication success. Inherent discrepancies of abstract reporting, mainly related to presentation of preliminary results and incomplete description of methods, may be considered in analogous studies. On average 52.2 per cent of the abstracts presented at the two EOS conferences reached full publication. Abstracts presented orally, including statistical analysis, were more likely to get published. © The Author 2013. Published by Oxford University Press on behalf of the European Orthodontic Society. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Natural radiation environment III. [Lead Abstract
Energy Technology Data Exchange (ETDEWEB)
Gesell, T.F.; Lowder, W.M. (eds.)
1980-01-01
Separate abstracts were prepared for the 52 research papers presented at this symposium in April 1978. The major topics in this volume deal with penetrating radiation measurements, radiation surveys and population exposure, radioactivity in the indoor environment, and technologically enhanced natural radioactivity. (KRM)
Functional Abstraction of Stochastic Hybrid Systems
Bujorianu, L.M.; Blom, Henk A.P.; Hermanns, H.
2006-01-01
The verification problem for stochastic hybrid systems is quite difficult. One method to verify these systems is stochastic reachability analysis. Concepts of abstractions for stochastic hybrid systems are needed to ease the stochastic reachability analysis. In this paper, we set up different ways
Waste management research abstracts No. 18
International Nuclear Information System (INIS)
1987-12-01
The eighteenth issue of this publication contains over 750 abstracts from 33 IAEA member countries comprehending various aspects of radioactive waste management. Radioactive waste disposal, processing and storage, geochemical and geological investigations related to waste management, mathematical models and environmental impacts are reviewed
Nuclear medicine 2009. Abstracts; NuklearMedizin 2009. Vortraege
Energy Technology Data Exchange (ETDEWEB)
NONE
2009-07-01
The journal contains the abstracts of 188 lectures and the abstracts of 103 poster contributions concerning the following topics: systemic therapy; oncology: PET/therapy; physics: device technology; oncology: PET/new pharmaceuticals; neurology: receptors; motion correction methods; oncology: PET/FDG; cardiology; malign thyroid tumors; neuroendocrine tumors; radiochemistry {sup 1}8F, oncology: pre-clinic PET; neurology-oncology-activation; physics: quantification; various topics; radiochemistry: radioactive metals; benign thyroid tumors; therapeutical studies; neurology: neurodegeneration; oncology: SPECT/planar scintigraphy; local therapy; inflammation; dosimetry - radiation protection; radiochemistry: halogens.
Cryogenic foam insulation: Abstracted publications
Williamson, F. R.
1977-01-01
A group of documents were chosen and abstracted which contain information on the properties of foam materials and on the use of foams as thermal insulation at cryogenic temperatures. The properties include thermal properties, mechanical properties, and compatibility properties with oxygen and other cryogenic fluids. Uses of foams include applications as thermal insulation for spacecraft propellant tanks, and for liquefied natural gas storage tanks and pipelines.
Directory of Open Access Journals (Sweden)
Gabriel Badea
2016-11-01
Full Text Available The main purpose of this paper is to study the connections that can be established between the modern abstractionism and the abstract tendencies from other historical eras. In the first part I will present three distinct interpretations: the first direction is based on authors as Mircea Eliade and Roger Lipsey, who see modern art through the links still alive between art and religion, from a syncretic perspective, or, after Eliade’s expression, based on a creative hermeneutics. The second direction is represented by the work of Adorno, Compagnon, Greenberg, Lyotard, for whom the modern art is a manifestation of radical discontinuity in relation to the art of the past, and the emergence of abstractionism is due primarily to a historical necessity (the increasing rupture between form and content, the increased autonomy of the sensible over the intelligible. The third direction is represented to Wilhelm Worringer, whose work (Abstraktion und Einfühlung, 1907 predates the emergence of the first abstract paintings, but relying on the German aesthetic tradition, manages to go beyond the threshold distinction between figurative and abstract, thus identifying a type of Einfühlung art and another of abstract type, namely the predominance of one or the other in different historical contexts and civilizational patterns. In the second part of the paper I will refer to instances of the spirit of abstraction in the case of Byzantine sacred art, especially in the footsteps of Plotinian aesthetics and as a result of the iconoclastic crisis. In the last part, I will present the key ideas for three major representatives of abstractionism (Kandinsky, Klee, Mondrian and the survival of the concepts of sacred art in their works and art theories.
The Pipeline From Abstract Presentation to Publication in Pediatric Hospital Medicine.
Herrmann, Lisa E; Hall, Matthew; Kyler, Kathryn; Cochran, Joseph; Andrews, Annie L; Williams, Derek J; Wilson, Karen M; Shah, Samir S
2018-02-01
The annual Pediatric Hospital Medicine (PHM) conference serves as a venue for the dissemination of research in this rapidly growing discipline. A measure of research validity is subsequent publication in peer-reviewed journals. To identify the publication rate of abstracts submitted to the 2014 PHM conference and determine whether presentation format was associated with subsequent journal publication or time to publication. We identified abstracts submitted to the 2014 PHM conference. Presentation formats included rejected abstracts and poster and oral presentations. Abstracts subsequently published in journals were identified by searching the author and abstract title in PubMed, MedEdPORTAL, and Google Scholar. We used logistic regression and Cox proportional hazards models to determine if presentation format was associated with publication, time to publication, and publishing journal impact factor. Of 226 submitted abstracts, 19.0% were rejected, 68.0% were selected for posters, and 12.8% were selected for oral presentations; 36.3% were subsequently published within 30 months after the conference. Abstracts accepted for oral presentation had more than 7-fold greater odds of publication (adjusted odds ratio 7.8; 95% confidence interval [CI], 2.6-23.5) and a 4-fold greater likelihood of publication at each month (adjusted hazard ratio 4.5; 95% CI, 2.1-9.7) compared with rejected abstracts. Median journal impact factor was significantly higher for oral presentations than other presentation formats (P presentation; however, the low overall publication rate may indicate that presented results are preliminary or signify a need for increased mentorship and resources for research development in PHM.
Towards Measuring the Abstractness of State Machines based on Mutation Testing
Directory of Open Access Journals (Sweden)
Thomas Baar
2017-01-01
Full Text Available Abstract. The notation of state machines is widely adopted as a formalism to describe the behaviour of systems. Usually, multiple state machine models can be developed for the very same software system. Some of these models might turn out to be equivalent, but, in many cases, different state machines describing the same system also differ in their level of abstraction. In this paper, we present an approach to actually measure the abstractness level of state machines w.r.t. a given implemented software system. A state machine is considered to be less abstract when it is conceptionally closer to the implemented system. In our approach, this distance between state machine and implementation is measured by applying coverage criteria known from software mutation testing. Abstractness of state machines can be considered as a new metric. As for other metrics as well, a known value for the abstractness of a given state machine allows to assess its quality in terms of a simple number. In model-based software development projects, the abstract metric can help to prevent model degradation since it can actually measure the semantic distance from the behavioural specification of a system in form of a state machine to the current implementation of the system. In contrast to other metrics for state machines, the abstractness cannot be statically computed based on the state machine’s structure, but requires to execute both state machine and corresponding system implementation. The article is published in the author’s wording.
Raju, Suneil A; Sanders, David S; Akram, Rahim; Glover, Rebecca; Al-Rifaie, Ammar; Peever, Elise; Purves, Josh; Scanu, Emily; Kurien, Matthew
2017-10-01
Abstracts presentations at scientific meetings enable rapid dissemination of novel research. The percentage of abstracts that proceed to full publication from differing medical specialties is highly variable. This study aims to evaluate the outcomes of abstracts presented at the United European Gastroenterology Week (UEGW). All abstracts presented at UEGW between 2009 and 2011 were assessed. Cross-referencing of the first author, senior author and at least one keyword of the abstract was performed using PubMed and EMBASE databases. Abstracts and possible resultant full publications were then examined in tandem to ensure that they represented the same study. Data were also collected on lag time to publication, journal impact factors, country of the author and factors influencing subsequent publication. A total of 6785 abstracts (1438 oral and 5347 poster presentations) were presented during the period assessed. Of these, 2099 (30.9%) proceeded to full publication in indexed journals. Oral abstract presentations were most likely to proceed to full publication compared with poster presentations (odds ratio: 1.38, 95% confidence interval: 1.22-1.56) and were more likely to achieve publication in higher impact journals (median impact factor 4.78 vs. 2.89, PEuropean Gastroenterology abstract conversion rate to full publication (46.8%). This is the first study to assess the publication rates of UEGW. Findings are favourable with similar studies from other societies.
Graphical Abstract: Publishing with Objective Charisma: Breaking Science’s Paradox
Science, Animate Your
2018-01-01
Graphical abstract for Doubleday, Z. A., & Connell, S. D. (2017). Publishing with objective charisma: breaking science’s paradox. Trends in ecology & evolution, 32(11), 803-805.Graphical abstract by Animate Your Science (www.animate-science.com)
Automatic Probabilistic Program Verification through Random Variable Abstraction
Directory of Open Access Journals (Sweden)
Damián Barsotti
2010-06-01
Full Text Available The weakest pre-expectation calculus has been proved to be a mature theory to analyze quantitative properties of probabilistic and nondeterministic programs. We present an automatic method for proving quantitative linear properties on any denumerable state space using iterative backwards fixed point calculation in the general framework of abstract interpretation. In order to accomplish this task we present the technique of random variable abstraction (RVA and we also postulate a sufficient condition to achieve exact fixed point computation in the abstract domain. The feasibility of our approach is shown with two examples, one obtaining the expected running time of a probabilistic program, and the other the expected gain of a gambling strategy. Our method works on general guarded probabilistic and nondeterministic transition systems instead of plain pGCL programs, allowing us to easily model a wide range of systems including distributed ones and unstructured programs. We present the operational and weakest precondition semantics for this programs and prove its equivalence.
Single neurons in prefrontal cortex encode abstract rules.
Wallis, J D; Anderson, K C; Miller, E K
2001-06-21
The ability to abstract principles or rules from direct experience allows behaviour to extend beyond specific circumstances to general situations. For example, we learn the 'rules' for restaurant dining from specific experiences and can then apply them in new restaurants. The use of such rules is thought to depend on the prefrontal cortex (PFC) because its damage often results in difficulty in following rules. Here we explore its neural basis by recording from single neurons in the PFC of monkeys trained to use two abstract rules. They were required to indicate whether two successively presented pictures were the same or different depending on which rule was currently in effect. The monkeys performed this task with new pictures, thus showing that they had learned two general principles that could be applied to stimuli that they had not yet experienced. The most prevalent neuronal activity observed in the PFC reflected the coding of these abstract rules.
Development of abstract mathematical reasoning: the case of algebra.
Susac, Ana; Bubic, Andreja; Vrbanc, Andrija; Planinic, Maja
2014-01-01
Algebra typically represents the students' first encounter with abstract mathematical reasoning and it therefore causes significant difficulties for students who still reason concretely. The aim of the present study was to investigate the developmental trajectory of the students' ability to solve simple algebraic equations. 311 participants between the ages of 13 and 17 were given a computerized test of equation rearrangement. Equations consisted of an unknown and two other elements (numbers or letters), and the operations of multiplication/division. The obtained results showed that younger participants are less accurate and slower in solving equations with letters (symbols) than those with numbers. This difference disappeared for older participants (16-17 years), suggesting that they had reached an abstract reasoning level, at least for this simple task. A corresponding conclusion arises from the analysis of their strategies which suggests that younger participants mostly used concrete strategies such as inserting numbers, while older participants typically used more abstract, rule-based strategies. These results indicate that the development of algebraic thinking is a process which unfolds over a long period of time. In agreement with previous research, we can conclude that, on average, children at the age of 15-16 transition from using concrete to abstract strategies while solving the algebra problems addressed within the present study. A better understanding of the timing and speed of students' transition from concrete arithmetic reasoning to abstract algebraic reasoning might help in designing better curricula and teaching materials that would ease that transition.
Beauty in abstract paintings: perceptual contrast and statistical properties
Mallon, Birgit; Redies, Christoph; Hayn-Leichsenring, Gregor U.
2014-01-01
In this study, we combined the behavioral and objective approach in the field of empirical aesthetics. First, we studied the perception of beauty by investigating shifts in evaluation on perceived beauty of abstract artworks (Experiment 1). Because the participants showed heterogeneous individual preferences for the paintings, we divided them into seven clusters for the test. The experiment revealed a clear pattern of perceptual contrast. The perceived beauty of abstract paintings increased after exposure to paintings that were rated as less beautiful, and it decreased after exposure to paintings that were rated as more beautiful. Next, we searched for correlations of beauty ratings and perceptual contrast with statistical properties of abstract artworks (Experiment 2). The participants showed significant preferences for particular image properties. These preferences differed between the clusters of participants. Strikingly, next to color measures like hue, saturation, value and lightness, the recently described Pyramid of Histograms of Orientation Gradients (PHOG) self-similarity value seems to be a predictor for aesthetic appreciation of abstract artworks. We speculate that the shift in evaluation in Experiment 1 was, at least in part, based on low-level adaptation to some of the statistical image properties analyzed in Experiment 2. In conclusion, our findings demonstrate that the perception of beauty in abstract artworks is altered after exposure to beautiful or non-beautiful images and correlates with particular image properties, especially color measures and self-similarity. PMID:24711791
Student Scientific Conference 2000. Abstracts of papers of students and post-graduate students
International Nuclear Information System (INIS)
Ilias, M.
2000-04-01
The aim of the Student Scientific Conference was review of works of students and post-graduate students from universities of the Slovak Republic and Czech Republic. The proceedings of the conference contain 43 abstracts of Biological Section, 69 abstracts of Chemical Section, 18 abstracts of Environmental Section, 15 abstracts of Geography and Cartography Section, and 31 abstracts of Geology Section
Geometry of abstraction in quantum computation
Pavlovic, Dusko; Abramsky, S.; Mislove, M.W.
2012-01-01
Quantum algorithms are sequences of abstract operations, per formed on non-existent computers. They are in obvious need of categorical semantics. We present some steps in this direction, following earlier contribu tions of Abramsky, Goecke and Selinger. In particular, we analyze function
Old Romanian pluralized mass and abstract nouns
Directory of Open Access Journals (Sweden)
Gabriela Pană Dindelegan
2017-09-01
Full Text Available The analysis of a rich old Romanian corpus shows that the ‘pluralization’ of mass and abstract nouns is extremely frequent in old Romanian. The semantic effects of pluralization are similar for mass and abstract nouns, consisting in the creation of denotative and/or connotative semantic variants. Of the plural endings, –uri is specialized for the pluralization of mass nouns in Daco-Romanian. The evolution of the ending –uri illustrates the specific process by which a grammatical (plural morpheme is converted into a lexical morpheme (the so-called ‘lexical plurals’. ‘Lexical plurals’ have isolated occurrences in other Romance languages, but they have not reached the spread and regularity they display in Romanian.
FFCAct Clearinghouse, Directory of abstracts. Revision 1
International Nuclear Information System (INIS)
Harwood, T.
1994-05-01
The Federal Facility Compliance Act (FFCAct) Clearinghouse is a card catalog of information about the FFCAct and its requirements for developing Site Treatment Plans (STP). The information available in the clearinghouse includes abstracts describing computer applications, technical reports, and a list of technical experts. Information can be accessed for use in responding to FFCAct requirements, and the clearinghouse provides search capabilities on particular topics and issues related to STP development. Appendix A includes: contacts from each site, for which contact has been made, who are developing STPs; the FFCAct Clearinghouse Fact Sheet and; additional hard copy forms to be used to populate the database. This report contains 50 abstracts related to the Radioactive Waste Technical Support Program
Evidence for cross-script abstract identities in learners of Japanese kana.
Schubert, Teresa; Gawthrop, Roderick; Kinoshita, Sachiko
2018-05-07
The presence of abstract letter identity representations in the Roman alphabet has been well documented. These representations are invariant to letter case (upper vs. lower) and visual appearance. For example, "a" and "A" are represented by the same abstract identity. Recent research has begun to consider whether the processing of non-Roman orthographies also involves abstract orthographic representations. In the present study, we sought evidence for abstract identities in Japanese kana, which consist of two scripts, hiragana and katakana. Abstract identities would be invariant to the script used as well as to the degree of visual similarity. We adapted the cross-case masked-priming letter match task used in previous research on Roman letters, by presenting cross-script kana pairs and testing adult beginning -to- intermediate Japanese second-language (L2) learners (first-language English readers). We found robust cross-script priming effects, which were equal in magnitude for visually similar (e.g., り/リ) and dissimilar (e.g., あ/ア) kana pairs. This pattern was found despite participants' imperfect explicit knowledge of the kana names, particularly for katakana. We also replicated prior findings from Roman abstract letter identities in the same participants. Ours is the first study reporting abstract kana identity priming (in adult L2 learners). Furthermore, these representations were acquired relatively early in our adult L2 learners.
Sports Physical Therapy Section Poster Presentations (Abstracts SPO1-SPO166).
2018-01-01
These abstracts are presented here as prepared by the authors. The accuracy and content of each abstract remain the responsibility of the authors. In the identification number above each abstract, SPO designates a Sports Physical Therapy Section poster presentation. J Orthop Sports Phys Ther 2018;48(1):A203-A276. doi:10.2519/jospt.2018.48.1.A203.
Geothermal environmental projects publication list with abstracts 1975-1978
Energy Technology Data Exchange (ETDEWEB)
Ricker, Y.E.; Anspaugh, L.R.
1979-05-15
This report contains 119 abstracts of publication resulting from or closely related to geothermal environmental projects conducted by the Environmental Sciences Division at Lawrence Livermore Laboratory. Publications are listed chronologically from 1975 through 1978. The main entries are numbered sequentially, and include the full citation, an abstract, and selected keywords. This section is followed by an author index, and a keyword index.
A critical analysis of publication rates of national oncology meeting abstracts in Turkey
Directory of Open Access Journals (Sweden)
S. Kilickap
2018-04-01
Full Text Available Purpose: In this study our aim is to analyze the publication rates of abstracts, which were presented between 2006 and 2011 years in biennial National Cancer Meeting of Turkey (NCM and Turkish Medical Oncology Society Meeting (TMOSM and to determine the timely change of publication rates and to predict the quality of the abstracts. Methods: All abstracts, which are either accepted as podium or poster presentations in NCM and TMOM between 2006 and 2011, are extracted. Subsequent publication rate of those abstracts were defined by searching PubMed and Turkish Medical Index. Results: Between 2006 and 2011, overall 2451 abstracts were presented in annual NC and TMOS meetings. Of these 2451 abstracts, 286 of them (11.7% were published in consecutive years. Median publication interval was 11 months. While 28 of 286 (9.8% abstracts were published in national journals, 258 of them (90.2% were published in international journals. 97 of a total of 424 podium presentations (22.9% were published. The publication rate was correlated with the type of presentation (OP vs. PP: 22.9% vs. 9.3%, p < 0.001. The highest publication rate was for prospective studies (%14.4. Majority of abstracts (53.1% were published in journals indexed within the science citation index (SCI. Rest of the published abstracts were in index of SCI-expanded. Conclusions: Non-publication of research abstracts is a problem for 88.3% of abstracts of this study. The data presented in this study should lead abstract authors to criticize themselves and find a way to improve their study quality. Keywords: Abstract, Full-text, Manuscript, Peer-review, Publication rate
Language abstraction in word of mouth
Schellekens, G.A.C.; Verlegh, P.W.J.; Smidts, A.
2010-01-01
This research examines the language that consumers use in word of mouth. For both positive and negative product experiences, we demonstrate that consumers use more abstract terms when they describe experiences that are in line with the valence of their product attitude. This effect cannot be
Temperatures below leaf litter during winter prescribed burns: implications for litter-roosting bats
Roger W. Perry; Virginia L. McDaniel
2015-01-01
Some bat species, including eastern red bats (Lasiurus borealis), roost for short periods beneath leaf litter on the forest floor during winter in the south-eastern USA, a region subjected to frequent fire. The variability in fuel consumption, the heterogeneous nature of burns, and the effects of litter and duff moisture on forest-floor...
Semantic Neighborhood Effects for Abstract versus Concrete Words.
Danguecan, Ashley N; Buchanan, Lori
2016-01-01
Studies show that semantic effects may be task-specific, and thus, that semantic representations are flexible and dynamic. Such findings are critical to the development of a comprehensive theory of semantic processing in visual word recognition, which should arguably account for how semantic effects may vary by task. It has been suggested that semantic effects are more directly examined using tasks that explicitly require meaning processing relative to those for which meaning processing is not necessary (e.g., lexical decision task). The purpose of the present study was to chart the processing of concrete versus abstract words in the context of a global co-occurrence variable, semantic neighborhood density (SND), by comparing word recognition response times (RTs) across four tasks varying in explicit semantic demands: standard lexical decision task (with non-pronounceable non-words), go/no-go lexical decision task (with pronounceable non-words), progressive demasking task, and sentence relatedness task. The same experimental stimulus set was used across experiments and consisted of 44 concrete and 44 abstract words, with half of these being low SND, and half being high SND. In this way, concreteness and SND were manipulated in a factorial design using a number of visual word recognition tasks. A consistent RT pattern emerged across tasks, in which SND effects were found for abstract (but not necessarily concrete) words. Ultimately, these findings highlight the importance of studying interactive effects in word recognition, and suggest that linguistic associative information is particularly important for abstract words.
The meaning of 'life' and other abstract words: Insights from neuropsychology.
Hoffman, Paul
2016-09-01
There are a number of long-standing theories on how the cognitive processing of abstract words, like 'life', differs from that of concrete words, like 'knife'. This review considers current perspectives on this debate, focusing particularly on insights obtained from patients with language disorders and integrating these with evidence from functional neuroimaging studies. The evidence supports three distinct and mutually compatible hypotheses. (1) Concrete and abstract words differ in their representational substrates, with concrete words depending particularly on sensory experiences and abstract words on linguistic, emotional, and magnitude-based information. Differential dependence on visual versus verbal experience is supported by the evidence for graded specialization in the anterior temporal lobes for concrete versus abstract words. In addition, concrete words have richer representations, in line with better processing of these words in most aphasic patients and, in particular, patients with semantic dementia. (2) Abstract words place greater demands on executive regulation processes because they have variable meanings that change with context. This theory explains abstract word impairments in patients with semantic-executive deficits and is supported by neuroimaging studies showing greater response to abstract words in inferior prefrontal cortex. (3) The relationships between concrete words are governed primarily by conceptual similarity, while those of abstract words depend on association to a greater degree. This theory, based primarily on interference and priming effects in aphasic patients, is the most recent to emerge and the least well understood. I present analyses indicating that patterns of lexical co-occurrence may be important in understanding these effects. © 2015 The Authors. Journal of Neuropsychology published by John Wiley & Sons Ltd on behalf of the British Psychological Society.
Generation and exploration of aggregation abstractions for scheduling and resource allocation
Lowry, Michael R.; Linden, Theodore A.
1993-01-01
This paper presents research on the abstraction of computational theories for scheduling and resource allocation. The paper describes both theory and methods for the automated generation of aggregation abstractions and approximations in which detailed resource allocation constraints are replaced by constraints between aggregate demand and capacity. The interaction of aggregation abstraction generation with the more thoroughly investigated abstractions of weakening operator preconditions is briefly discussed. The purpose of generating abstract theories for aggregated demand and resources includes: answering queries about aggregate properties, such as gross feasibility; reducing computational costs by using the solution of aggregate problems to guide the solution of detailed problems; facilitating reformulating theories to approximate problems for which there are efficient problem-solving methods; and reducing computational costs of scheduling by providing more opportunities for variable and value-ordering heuristics to be effective. Experiments are being developed to characterize the properties of aggregations that make them cost effective. Both abstract and concrete theories are represented in a variant of first-order predicate calculus, which is a parameterized multi-sorted logic that facilitates specification of large problems. A particular problem is conceptually represented as a set of ground sentences that is consistent with a quantified theory.
Xue, Fuguang; Pan, Xiaohua; Jiang, Linshu; Guo, Yuming; Xiong, Benhai
2018-01-01
Thiamine is known to attenuate high-concentrate diet induced subacute ruminal acidosis (SARA) in dairy cows, however, the underlying mechanisms remain unclear. The major objective of this study was to investigate the metabolic mechanisms of thiamine supplementation on high-concentrate diet induced SARA. Six multiparous, rumen-fistulated Holstein cows were used in a replicated 3 × 3 Latin square design. The treatments included a control diet (CON; 20% starch, dry matter basis), a SARA-inducing diet (SAID; 33.2% starch, dry matter basis) and SARA-inducing diet supplemented with 180 mg of thiamine/kg of dry matter intake (SAID + T). On d21 of each period, ruminal fluid samples were collected at 3 h post feeding, and GC/MS was used to analyze rumen fluid samples. PCA and OPLS-DA analysis demonstrated that the ruminal metabolite profile were different in three treatments. Compared with CON treatment, SAID feeding significantly decreased rumen pH, acetate, succinic acid, increased propionate, pyruvate, lactate, glycine and biogenic amines including spermidine and putrescine. Thiamine supplementation significantly decreased rumen content of propionate, pyruvate, lactate, glycine and spermidine; increase rumen pH, acetate and some medium-chain fatty acids. The enrichment analysis of different metabolites indicated that thiamine supplementation mainly affected carbohydrates, amino acids, pyruvate and thiamine metabolism compared with SAID treatment. These findings revealed that thiamine supplementation could attenuate high-concentrate diet induced SARA by increasing pyruvate formate-lyase activity to promote pyruvate to generate acetyl-CoA and inhibit lactate generation. Besides, thiamine reduced biogenic amines to alleviate ruminal epithelial inflammatory response.
Caudron, Corentin; White, Robert S.; Green, Robert G.; Woods, Jennifer; Ágústsdóttir, Thorbjörg; Donaldson, Clare; Greenfield, Tim; Rivalta, Eleonora; Brandsdóttir, Bryndís.
2018-01-01
Magma is transported in brittle rock through dikes and sills. This movement may be accompanied by the release of seismic energy that can be tracked from the Earth's surface. Locating dikes and deciphering their dynamics is therefore of prime importance in understanding and potentially forecasting volcanic eruptions. The Seismic Amplitude Ratio Analysis (SARA) method aims to track melt propagation using the amplitudes recorded across a seismic network without picking the arrival times of individual earthquake phases. This study validates this methodology by comparing SARA locations (filtered between 2 and 16 Hz) with the earthquake locations (same frequency band) recorded during the 2014-2015 Bár∂arbunga-Holuhraun dike intrusion and eruption in Iceland. Integrating both approaches also provides the opportunity to investigate the spatiotemporal characteristics of magma migration during the dike intrusion and ensuing eruption. During the intrusion SARA locations correspond remarkably well to the locations of earthquakes. Several exceptions are, however, observed. (1) A low-frequency signal was possibly associated with a subglacial eruption on 23 August. (2) A systematic retreat of the seismicity was also observed to the back of each active segment during stalled phases and was associated with a larger spatial extent of the seismic energy source. This behavior may be controlled by the dike's shape and/or by dike inflation. (3) During the eruption SARA locations consistently focused at the eruptive site. (4) Tremor-rich signal close to ice cauldrons occurred on 3 September. This study demonstrates the power of the SARA methodology, provided robust site amplification; Quality Factors and seismic velocities are available.
From abstract to peer-reviewed publication: country matters
DEFF Research Database (Denmark)
Fosbol, E.; Fosbøl, Philip Loldrup; Eapen, Z. J.
2013-01-01
within 2 years of the conference. Less is known about the relative difference between countries in regards to likelihood of publication. Methods: Using a validated automated computer algorithm, we searched the ISI Web of Science to identify peer-reviewed publications of abstracts presented at the AHA...... observed a significant variation among countries in terms of odds of subsequent publication (Figure). Conclusions: Our results show that conversion of science from an abstract into a peer-reviewed publication varies significantly by country. Local national initiatives should be deployed in order to break...
Energy Technology Data Exchange (ETDEWEB)
1980-01-01
This volume contains all abstracts (931) received by the conference organizers before June 20, 1980. The abstracts are grouped according to the following topics: nucleon-nucleon interactions, free and in nuclei; distribution of matter, charge, and magnetism; exotic nuclei and exotic probes; giant resonances and other high-lying excitations; applications of nuclear science; nuclei with large angular momentum and deformation; heavy-ion reactions and relaxation phenomena; new techniques and instruments; pion absorption and scattering by nuclei; and miscellaneous. Some of these one-page abstracts contain data. A complete author index is provided. (RWR)
Correlations and fluctuations '98. Collected abstracts
International Nuclear Information System (INIS)
Csoergoe, T.; Hegyi, S.; Hwa, R.C.; Jancso, G.
1998-01-01
The proceedings of the 8. International workshop on multiparticle production contains the abstracts of papers on various topics of correlations and fluctuations. Hydrodynamic models, Bose-Einstein correlations, hadron-hadron interactions, heavy ion reactions are discussed in detail. 54 items are indexed separately for the INIS database. (K.A.)
Abstracts: NRC Waste Management Program reports
Energy Technology Data Exchange (ETDEWEB)
Heckman, R.A.; Minichino, C.
1979-11-01
This document consists of abstracts of all reports published by the Nuclear Regulatory Commission (NRC) Waste Management Program at Lawrence Livermore Laboratory (LLL). It will be updated at regular intervals. Reports are arranged in numerical order, within each category. Unless otherwise specified, authors are LLL scientists and engineers.