WorldWideScience

Sample records for sara cyclotron

  1. Calculations for the design and modification of the 2 cyclotrons of S.A.R.A

    International Nuclear Information System (INIS)

    Albrand, P.S.; Belmont, J.L.; Ripouteau, F.

    1983-09-01

    S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron

  2. News developments at Sara

    International Nuclear Information System (INIS)

    Belmont, J.L.; Fruneau, M.; Martin, P.

    1989-05-01

    SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration

  3. 2012 SARA Students Technical Report

    International Nuclear Information System (INIS)

    Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet

    2012-01-01

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of

  4. 2012 SARA Students Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

    2012-07-30

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the

  5. Interpreting the SARA and RCRA training requirements

    International Nuclear Information System (INIS)

    Moreland, W.M.; Wells, S.M.

    1987-01-01

    The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements

  6. Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.

    Science.gov (United States)

    O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J

    2008-04-01

    Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.

  7. System Analysis and Risk Assessment system (SARA) Version 4.0

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1992-01-01

    This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis

  8. The relationship between SARA fractions and crude oil stability

    Directory of Open Access Journals (Sweden)

    Siavash Ashoori

    2017-03-01

    Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.

  9. Layering of life (Sara novel of Peter Sarić

    Directory of Open Access Journals (Sweden)

    Kostić Dragomir J.

    2015-01-01

    Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safe­guard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.

  10. The SARA REU Site Program

    Science.gov (United States)

    Wood, M. A.; Oswalt, T. D.; SARA Collaboration

    2000-12-01

    We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.

  11. Gene : CBRC-SARA-01-1996 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

  12. Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

    Directory of Open Access Journals (Sweden)

    Jessica N Snowden

    Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.

  13. Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

    Directory of Open Access Journals (Sweden)

    M. Sidi Ritau'din

    2017-06-01

    Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.

  14. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...

  15. ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

    Directory of Open Access Journals (Sweden)

    Sulistyastuti Sutomo

    2015-01-01

    Full Text Available Not only does art   have   self-fullfillment, but  it also has axiological  benefits both socially, culturally, religiously, and economiclally.  So does Sara Douda dance.  Sara Douda aesthetics  is first contained  in its whole dance movements. In addition, it  can also be found in the whole dance equipments.  Moreover,  this dance aesthetics  may  also be contained in the verbal symbols in the speech forms  prior to the dance performance. However,  both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and  religious values in the Loli community about  their honoring their ancestors,  having social harmony, and  highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance.   Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda

  16. System Analysis and Risk Assessment System (SARA), Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.

    1992-02-01

    This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs

  17. Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural

    Directory of Open Access Journals (Sweden)

    Tiara Kharisma

    2017-12-01

    Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.

  18. The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

    International Nuclear Information System (INIS)

    Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan

    2013-01-01

    Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques

  19. System Analysis and Risk Assessment (SARA) system

    International Nuclear Information System (INIS)

    Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

    1986-01-01

    Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable

  20. Concurrent software system design supported by SARA at the age of one

    Energy Technology Data Exchange (ETDEWEB)

    Campos, I.M.; Estrin, G.

    A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.

  1. Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

    Science.gov (United States)

    Thomas, S. M.; Su, Y. C.; Hummel, P. R.

    2016-12-01

    Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance

  2. SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS

    International Nuclear Information System (INIS)

    Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.

    2015-01-01

    SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index

  3. Mengukur Politisasi Agama dalam Ruang Publik: Komunikasi SARA dalam Perdebatan Rational Choice Theory

    Directory of Open Access Journals (Sweden)

    Mohammad Supriyadi

    2015-12-01

    Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

  16. Identification of Differentially Expressed Proteins in Liver in Response to Subacute Ruminal Acidosis (SARA Induced by High-concentrate Diet

    Directory of Open Access Journals (Sweden)

    X. Y. Jiang

    2014-08-01

    Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  7. Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

    2009-07-01

    Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench

  8. Medical Cyclotrons

    Science.gov (United States)

    Friesel, D. L.; Antaya, T. A.

    Particle accelerators were initially developed to address specific scientific research goals, yet they were used for practical applications, particularly medical applications, within a few years of their invention. The cyclotron's potential for producing beams for cancer therapy and medical radioisotope production was realized with the early Lawrence cyclotrons and has continued with their more technically advanced successors — synchrocyclotrons, sector-focused cyclotrons and superconducting cyclotrons. While a variety of other accelerator technologies were developed to achieve today's high energy particles, this article will chronicle the development of one type of accelerator — the cyclotron, and its medical applications. These medical and industrial applications eventually led to the commercial manufacture of both small and large cyclotrons and facilities specifically designed for applications other than scientific research.

  9. Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.

    Science.gov (United States)

    Zhao, Bryan M; Hoffmann, F Michael

    2006-09-01

    Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...

  11. The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

    Science.gov (United States)

    Wood, M. A.

    2003-12-01

    The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.

  12. SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

    DEFF Research Database (Denmark)

    Martin, Christer; Heinze, C.; Busch, M.

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

  17. Superconducting cyclotrons

    International Nuclear Information System (INIS)

    Blosser, H.G.; Johnson, D.A.; Burleigh, R.J.

    1976-01-01

    Superconducting cyclotrons are particularly appropriate for acceleration of heavy ions. A review is given of design features of a superconducting cyclotron with energy 440 (Q 2 /A) MeV. A strong magnetic field (4.6 tesla average) leads to small physical size (extraction radius 65 cm) and low construction costs. Operating costs are also low. The design is based on established technology (from present cyclotrons and from large bubble chambers). Two laboratories (in Chalk River, Canada and in East Lansing, Michigan) are proceeding with construction of full-scale prototype components for such cyclotrons

  18. PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

    Directory of Open Access Journals (Sweden)

    Jorge A. Orrego-Ruiz

    2014-06-01

    Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...

  20. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    Science.gov (United States)

    Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

    2017-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.

  1. DETERMINACIÓN DE LAS FRACCIONES SARA DE ASFALTOS COLOMBIANOS ENVEJECIDOS AL MEDIO AMBIENTE EMPLEANDO CROMATOGRAFÍA LÍQUIDA EN COLUMNA DETERMINAÇÃO DAS FRAÇÕES SARA DE ASFALTOS COLOMBIANOS ENVELHECIDOS AO MÉDIO AMBIENTE EMPREGANDO CROMATOGRAFIA LÍQUIDA EM COLUNA DETERMINATION OF SARA FRACTIONS OF ENVIRONMENTALLY AGED COLOMBIAN ASPHALTS USING LIQUID CHROMATOGRAPHY COLUMN

    Directory of Open Access Journals (Sweden)

    Fredy Alberto Reyes

    2012-06-01

    Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p

  2. Vancouver Cyclotron Conference

    International Nuclear Information System (INIS)

    Clark, David J.

    1993-01-01

    Although no longer on the high energy frontier, the cyclotron field is still a major scientific growth area. Its progress is highlighted at the international conference on cyclotron design, development and utilization held at intervals of about three years, under the auspices of the International Union of Pure and Applied Physics (IUPAP). Vancouver, surrounded by mountains, water and some cyclotrons, provided a pleasant setting for the 13th Conference, held last summer. With over 200 cyclotrons in operation around the world, the attendance, 241 delegates and 26 industrial exhibitors, was a near record, reflecting the flourishing state of the field. The early sessions covered the initial operation of new or upgraded cyclotron facilities. Major facilities completed since the previous Conference in Berlin in May 1989 included the 400 MeV ring cyclotron at Osaka, the U400M cyclotron at Dubna which will be coupled to the U400 to give 20 MeV nucléon uranium beams, the 130 MeV cyclotron at Jyvaskyla (in Finland, the furthest north!), the 110 MeV JAERI machine in Japan, and the 65 MeV proton therapy cyclotron in Nice. Among the facility upgrades were the KFA cyclotron at Julich which will inject the 2.5 GeV storage ring COSY, and the addition of an FM mode to the K=200 CW mode at Uppsala to give protons up to 180 MeV. The impressive current of 1.5 mA at 72 MeV obtained from the PSI Injector II will soon be injected into the 590 MeV ring

  3. Hemolytic disease of the fetus and newborn caused by an antibody to a low-prevalence antigen, anti-SARA.

    Science.gov (United States)

    Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy

    2011-09-01

    The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.

  4. Staphylococcus aureus Quorum Regulator SarA Targeted Compound, 2-[(Methylaminomethyl]phenol Inhibits Biofilm and Down-Regulates Virulence Genes

    Directory of Open Access Journals (Sweden)

    P. Balamurugan

    2017-07-01

    Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.

  5. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...

  6. Transferring generic SARA/OSHA training to US Department of Energy facilities

    International Nuclear Information System (INIS)

    White, A.; McKinley, T.

    1989-01-01

    The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...

  8. SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-05-01

    Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.

  9. MICHIGAN: Cyclotron conference

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1984-10-15

    A sense of excitement was in the air as cyclotron physicists and engineers from 17 countries convened on 30 April for the opening of the Tenth International Conference on Cyclotrons and Their Applications. Some 50 years after its invention, the redoubtable cyclotron remains a topic of compelling current interest. Cyclotron experts gathered at Michigan State University's Kellogg Center to hear of latest developments, of progress and successes on new machines which had come into operation, of new projects which were underway, and of dreams which lay ahead.

  10. Electromagnetic cyclotron harmonic waves

    International Nuclear Information System (INIS)

    Ohnuma, T.; Watanabe, T.; Hamamatsu, K.

    1981-09-01

    Electromagnetic electron cyclotron harmonic waves just below the electron cyclotron harmonics are investigated numerically and experimentally. Backward waves which are observed to propagate nearly perpendicular to the magnetic field just below the electron cyclotron frequency in a high density magnetoplasma are confirmed to be in accord with the theoretical electromagnetic cyclotron waves. (author)

  11. MICHIGAN: Cyclotron conference

    International Nuclear Information System (INIS)

    Anon.

    1984-01-01

    A sense of excitement was in the air as cyclotron physicists and engineers from 17 countries convened on 30 April for the opening of the Tenth International Conference on Cyclotrons and Their Applications. Some 50 years after its invention, the redoubtable cyclotron remains a topic of compelling current interest. Cyclotron experts gathered at Michigan State University's Kellogg Center to hear of latest developments, of progress and successes on new machines which had come into operation, of new projects which were underway, and of dreams which lay ahead

  12. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  13. Cyclotron waves in plasma

    CERN Document Server

    Lominadze, D G

    2013-01-01

    Cyclotron Waves in Plasma is a four-chapter text that covers the basic physical concepts of the theory of cyclotron waves and cyclotron instabilities, brought about by the existence of steady or alternating plasma currents flowing perpendicular to the magnetic field.This book considers first a wide range of questions associated with the linear theory of cyclotron oscillations in equilibrium plasmas and in electron plasmas in metals and semiconductors. The next chapter deals with the parametric excitation of electron cyclotron oscillations in plasma in an alternating electric field. A chapter f

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w

  15. Cyclotron waves in plasma

    International Nuclear Information System (INIS)

    Lominadse, D.G.

    1975-01-01

    The book deals with fundamental physical concepts of the theory of cyclotron waves and cyclotron instabilities conditioned by the presence in plasma of direct or alternating electric currents passing in it perpendicularily to a magnetic field. A great variety of problems is considered connected with the linear theory of cyclotron oscillations in equilibrium and electron plasma of metals and semiconductors. Parametric excitations of electron cyclotron oscillations of plasma in an alternating electric field are studied. Particular attention is paid to the investigation of plasma turbulence arising as a result of development of cyclotron instabilities. Experimental data are discussed and compared with theoretical results

  16. Cyclotrons: 1978

    International Nuclear Information System (INIS)

    Martin, J.A.

    1978-01-01

    A compilation is presented of the experimental facilities of the world's cyclotrons including history and status, staff and operation, research staff, target facilities, magnet, acceleration system, vacuum system, characteristic beams, beam properties, and a plan view of the facility for each cyclotron

  17. Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge

    DEFF Research Database (Denmark)

    Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette

    2017-01-01

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...

  18. Cyclotrons as mass spectrometers

    International Nuclear Information System (INIS)

    Clark, D.J.

    1984-04-01

    The principles and design choices for cyclotrons as mass spectrometers are described. They are illustrated by examples of cyclotrons developed by various groups for this purpose. The use of present high energy cyclotrons for mass spectrometry is also described. 28 references, 12 figures

  19. Medical applications of cyclotrons

    International Nuclear Information System (INIS)

    Jean, R.; Fauchet, M.

    1978-01-01

    Isochronous cyclotrons used to accelerate different charged particles (protons, deuterons, alphas...) at variable energies, have important medical applications, for neutron teletherapy, in vivo or in vitro activation analysis or production of short-lived radioisotopes for nuclear medicine. The characteristics of the cyclotron presently available are described for these three applications (low energy 'compact' cyclotrons, cyclotrons of intermediate and high energies), and their advantages are discussed from the points of view of the medical requirements, the financial investments and the results obtained. (orig.) [de

  20. Sara John: Ethnisierte Arbeit. Eine feministische Perspektive. Marburg: Tectum Wissenschaftsverlag 2009.

    Directory of Open Access Journals (Sweden)

    Grit Grigoleit

    2011-03-01

    Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.

  1. Layering of life (Sara novel of Peter Sarić)

    OpenAIRE

    Kostić, Dragomir J.

    2015-01-01

    Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

  3. Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

    Directory of Open Access Journals (Sweden)

    Tirshem Kumar Kaushik

    2015-05-01

    Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.

  4. Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010

    OpenAIRE

    Beaulé, Sophie

    2014-01-01

    With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...

  5. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    Directory of Open Access Journals (Sweden)

    Abdullah K. Shehabat

    2016-09-01

    Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.

  6. The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...

  7. A simple blowdown code for SUPER-SARA loop conditions

    International Nuclear Information System (INIS)

    Fritz, G.

    1981-01-01

    The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic

  10. Radiation protection of cyclotron vault with maze in PET Cyclotron Center

    International Nuclear Information System (INIS)

    Fueloep, Marko

    2003-01-01

    The PET Cyclotron center (PCC) is a complex for production, research and application of positron radiopharmaceuticals for PET (Positron Emission Tomography), which was commissioned this year (2004) in Bratislava, Slovak Republic. Positron radionuclides are produced by 18/9 MeV proton/deuteron cyclotron CYCLONE 18/9. Radiation protection of personnel and inhabitants against ionizing radiation in the PCC is solved with regard to the ICRP recommendations and Slovak regulatory system, protection rules and criteria and optimization of radiation protection. In the article comparisons of calculated and measured neutron and gamma dose equivalent rates around the CYCLONE 18/9 and at various points behind the shielding of cyclotron vault with maze are presented. Description of the CYCLONE 18/9 as a source of angular distribution of neutron energy spectra (production of 18 F was considered) was simulated by Monte Carlo code MCNPX. Code MCNP4B was used for shielding calculation of cyclotron vault with maze. Neutron energy spectra behind the shielding were measured by Bonner spectrometer. The values of neutron dose equivalent, which were calculated and measured around the CYCLONE 18/9 and at various points behind the shielding of cyclotron vault with maze, are within the range of factor 2. (authors)

  11. Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.

    1995-01-01

    Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs

  12. Injection and extraction for cyclotrons

    International Nuclear Information System (INIS)

    Heikkinen, P.

    1994-01-01

    External ion sources for cyclotrons are needed for polarised and heavy ions. This calls for injection systems, either radial or axial. Radial injection is also needed when a cyclotron works as a booster after another cyclotron or a linear accelerator (usually tandem). Requirements for injection differ from separated sector cyclotrons where there is plenty of room to house inflectors and/or strippers, to superconducting cyclotrons where the space is limited by a small magnet gap, and high magnetic field puts other limitations to the inflectors. Several extraction schemes are used in cyclotrons. Stripping injection is used for H - and also for heavy ions where the q/m ratio is usually doubled. For other cases, electric and magnetic deflection has to be used. To increase the turn separation before the first deflector, both resonant and non-resonant schemes are used. In this lecture, external injection systems are surveyed and some rules to thumb for injection parameters are given. Extraction schemes are also reviewed. (orig.)

  13. Medical cyclotron: why, where, how

    International Nuclear Information System (INIS)

    Scheer, Kurt; Comar, Dominique; Kellershohn, Claude

    1976-01-01

    Cyclotrons for medical purposes are particularly useful for the production of radioactive isotopes of elements normally constituting organic matter ( 15 O, 13 N, 11 C). The short half-life and positron emission of those elements are of great interest in medical diagnosis. Many others carrier-free radioisotopes can be produced by cyclotrons. Three categories of cyclotrons are mentioned. Desk top cyclotron only adapted to the production of short-lived radioisotopes in a hospital; low energy and average energy cyclotrons which require well-entrained personnel for their operation and are best adapted to the production of radioelements on a regional or even national scale. Examples relative to the interest of short-lived radioisotopes in lung and brain investigations and tumor detection are given

  14. Cyclotrons for isotope production

    International Nuclear Information System (INIS)

    Milton, B.F.; Stevenson, N.R.

    1995-06-01

    Cyclotrons continue to be efficient accelerators for radioisotope production. In recent years, developments in the accelerator technology have greatly increased the practical beam current in these machines while also improving the overall system reliability. These developments combined with the development of new isotopes for medicine and industry, and a retiring of older machines indicates a strong future for commercial cyclotrons. In this paper we will survey recent developments in the areas of cyclotron technology, and isotope production, as they relate to the new generation of commercial cyclotrons. We will also discuss the possibility of systems capable of extracted energies up to 100 MeV and extracted beam currents of up to 2.0 mA. (author). 6 refs., 2 tabs., 3 figs

  15. Isochronous cyclotron data base description

    International Nuclear Information System (INIS)

    Kiyan, I.N.; Vorozhtsov, S.B.; Tarashkevich, R.

    2004-01-01

    The relational data base of the control parameters of the isochronous cyclotron, Isochronous Cyclotron Data Base (ICDB), is described. The relational data base under consideration, written in Transact SQL for the MS SQL Server 2000 with the use of MS Enterprise Manager and MS Query Analyzer, was installed on the server of the AIC144 isochronous cyclotron in Krakow, which operates under the control of the operating system MS Windows Server 2003 (Standard Edition). The interface of the data base under considerations is written in C++ with the use of Visual C++ .NET and is built in the Cyclotron Operator Help Program (COHP), which is used for modeling the operational modes of the isochronous cyclotron. Communication between the COHP and the relational data base is realised on the base of the Open Data Base Connectivity protocol. The relational data base of the control parameter of the isochronous cyclotron is intended: firstly, for systematization and automatic use of all measured and modelled magnetic field maps in the process of modeling the operational modes; secondly, for systematization and convenient access to the stored operational modes; thirdly, for simplifying the operator's work. The relational data base of the control parameter of the isochronous cyclotron reflects its physical structure and the logic of its operator's work. (author)

  16. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0. Volume 5, Systems Analysis and Risk Assessment (SARA) tutorial manual

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities

  17. Fourier Transform Ion Cyclotron Resonance Mass Spectrometry at the Cyclotron Frequency.

    Science.gov (United States)

    Nagornov, Konstantin O; Kozhinov, Anton N; Tsybin, Yury O

    2017-04-01

    The phenomenon of ion cyclotron resonance allows for determining mass-to-charge ratio, m/z, of an ensemble of ions by means of measurements of their cyclotron frequency, ω c . In Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS), the ω c quantity is usually unavailable for direct measurements: the resonant state is located close to the reduced cyclotron frequency (ω + ), whereas the ω c and the corresponding m/z values may be calculated via theoretical derivation from an experimental estimate of the ω + quantity. Here, we describe an experimental observation of a new resonant state, which is located close to the ω c frequency and is established because of azimuthally-dependent trapping electric fields of the recently developed ICR cells with narrow aperture detection electrodes. We show that in mass spectra, peaks close to ω + frequencies can be reduced to negligible levels relative to peaks close to ω c frequencies. Due to reduced errors with which the ω c quantity is obtained, the new resonance provides a means of cyclotron frequency measurements with precision greater than that achieved when ω + frequency peaks are employed. The described phenomenon may be considered for a development into an FT-ICR MS technology with increased mass accuracy for applications in basic research, life, and environmental sciences. Graphical Abstract ᅟ.

  18. Building on TR-24 success. Advanced Cyclotron Systems Inc. launches a new cyclotron model

    International Nuclear Information System (INIS)

    Russell Watt; William Gyles; Alexander Zyuzin

    2015-01-01

    ACSI is designing a new 30 MeV cyclotron based on the TR-24. While minimizing changes from the proven TR-24, including maintaining the same outer dimensions, the energy of the cyclotron will be increased to 30 MeV, which will make it the most compact, non-superconducting, 30 MeV cyclotron design to date. Maximum beam current will match the TR-24 at 1 mA. With the size and footprint of a typical low energy PET cyclotron, this system will offer users a cost effective solution for a diversified facility capable of producing a wide spectrum of PET and SPECT radioisotopes for research and commercial distribution. (author)

  19. Advances in superconducting cyclotrons at MSU

    International Nuclear Information System (INIS)

    Blosser, H.; Antaya, T.; Au, R.

    1987-01-01

    Intensive work on superconducting cyclotrons began at MSU in late 1973 (a brief earlier study had occurred in the early 1960's) and continues vigorously at present. One large cyclotron, the ''K500'', has been operating for a number of years, a second, the ''K800'', is nearing completion, the first operating tests of its magnet having occurred at the time of the previous conference, and a third, the ''medical cyclotron'', is now also nearing completion with first operation of its magnet expected just after the present conference. These cyclotrons like other superconducting cyclotrons are all dramatically smaller than comparable room temperature machines; overall weight is typically about 1/20th of that of room temperature cyclotrons of the same energy. This large reduction in the quantities of materials is partially offset by added complexity, but finally, a net overall cost savings of 50 to 70 % typically results; as a consequence the superconducting cyclotron is widely viewed as the cyclotron of the future. The thirteen years of experience at MSU involving three of these cyclotrons, together with much important work at other laboratories, gives a rather clear view of the advantages and disadvantages of various design approaches including by now a rather significant period of long term evaluation. This paper reviews highlights of this program. (author)

  20. Medical cyclotron facilities

    International Nuclear Information System (INIS)

    1984-09-01

    This report examines the separate proposals from the Austin Hospital and the Australian Atomic Energy Commission for a medical cyclotron facility. The proponents have argued that a cyclotron facility would benefit Australia in areas of patient care, availability and export of radioisotopes, and medical research. Positron emission tomography (PET) and neutron beam therapy are also examined

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

  4. Development of Medical Cyclotron in KIRAMS

    International Nuclear Information System (INIS)

    Chai, Jong Seo; Jung, In Su; An, Dong Hyun

    2005-01-01

    This paper is presented on the development and status of medical cyclotron at the Korea Institute of Radiological and Medical Sciences (KIRAMS) at present. We have developed medical cyclotron which is KIRAMS-13. And the improvement of KIRAMS-13 is presented. Furthermore, the design of new cyclotrons, such as KIRAMS-5 and KIRAMS-30 cyclotron, are presented, and R and D studies for future plan of heavy ion accelerator are discussed

  5. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    Science.gov (United States)

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…

  6. All-magnetic extraction for cyclotron beam reacceleration

    Science.gov (United States)

    Hudson, E.D.; Mallory, M.L.

    1975-07-22

    An isochronous cyclotron can be modified to provide an initial electron stripping stage, a complete acceleration of the stripped ions through the cyclotron to a first energy state, means for returning the ions to an intermediate cyclotron orbit through a second stripping stage, further acceleration of the now higher energy stripped ions through the cyclotron to their final energy, and final extraction of the ions from the cyclotron. (auth)

  7. Trends in cyclotrons for radionuclide production

    International Nuclear Information System (INIS)

    Vera Ruiz, H.; Lambrecht, R.M.

    1999-01-01

    The IAEA recently concluded a worldwide survey of the cyclotrons used for radionuclide production. Most of the institutions responded to the questionnaire. The responses identified technical, utilisation and administrative information for 206 cyclotrons. Compiled data includes the characteristics, performance and popularity of each of the different commercial cyclotrons. Over 20 cyclotrons are scheduled for installation in 1998. The expansion in the number of cyclotron installations during the last decade was driven by the advent of advances in medical imaging instrumentation (namely, positron emission tomography (PET), and more recently by 511 KeV emission tomography); introduction of user friendly compact medical cyclotrons; and recent governmental decisions that permit reimbursement for cyclotron radiopharmaceutical studies by the government or insurance companies. The priorities for the production of clinical, commercial and research radionuclides were identified. The emphasis is on radionuclides used for medical diagnosis with SPET (e.g. 123 I, 201 Tl) and PET (e.g. 11 C, 13 N, 15 O, 18 F) radiopharmaceuticals, and for individualized patient radiation treatment planning (e.g. 64 Cu, 86 Y, 124 I) with PET. There is an emerging trend to advance the cyclotron as an alternative method to nuclear reactors for the production of neutron-rich radionuclides (e.g. 64 Cu, 103 Pd, 186 Re) needed for therapeutic applications. (authors)

  8. Future cyclotron systems : an industrial perspective

    International Nuclear Information System (INIS)

    Stevenson, N.R.; Dickie, W.J.

    1995-09-01

    The use of commercial cyclotron systems for the production of radioisotopes continues to grow on a world-wide scale. Improvements in technology have significantly increased the production capabilities of modem cyclotron-based isotope production facilities. In particular, the change to negative ion acceleration and new high power systems have resulted in dramatic improvements in reliability, increases in capacity, and decreases in personnel radiation dose. As more and more older machines are retired decisions regarding their replacement are made based on several factors including the market's potential and the cyclotron system's abilities. Taking the case of the recently upgraded TR30 cyclotron at TRIUMF/Nordion, we investigate the requirements industrial/medical users are likely to impose on future commercial cyclotron systems and the impact this will have on cyclotron technology by the end of the century. (author)

  9. Future cyclotron systems: An industrial perspective

    International Nuclear Information System (INIS)

    Stevenson, N.R.; Dickie, W.J.

    1995-09-01

    The use of commercial cyclotron systems for the production of radioisotopes continues to grow on a world-wide scale. Improvements in technology have significantly increased the production capabilities of modern cyclotron-based isotope production facilities. In particular, the change to negative ion acceleration and new high power systems have resulted in dramatic improvements in reliability, increases in capacity, and decreases in personnel radiation dose. As more and more older machines are retired, decisions regarding their replacement are made based on several factors including the market's potential and the cyclotron system's abilities. Taking the case of the recently upgraded TR30 cyclotron at TRIUMF/Nordion, the authors investigate the requirements industrial/medical users are likely to impose on future commercial cyclotron systems and the impact this will have on cyclotron technology by the end of the century

  10. Computer design of a compact cyclotron

    International Nuclear Information System (INIS)

    Bing Wang; Huanfeng Hao; Qinggao Yao; Jinquan Zhang; Mingtao Song; Vorozhtsov, S.B.; Smirnov, V.L.; Hongwei Zhao

    2011-01-01

    Here we present results of the computer design of the structural elements of a compact cyclotron by the example of HITFiL cyclotron selected as the driving accelerator that is under construction at the Institute of Modern Physics (Lanzhou, China). In the article a complex approach to modeling of the compact cyclotron, including calculation of electromagnetic fields of the structural elements and beam dynamics calculations, is described. The existing design data on the axial injection, magnetic, acceleration and extraction systems of the cyclotron are used as a starting point in the simulation. Some of the upgrades of the cyclotron structural elements were proposed, which led to substantial improvement of the beam quality and transmission

  11. Startup work on Inshas cyclotron

    International Nuclear Information System (INIS)

    Vorogushin, M.F.; Strokach, A.P.; Shikhov, V.Ya.; Galchuk, A.V.; Soliman, A.N.; El-Abyad, M.; Comsan, M.N.H.; Saleh, Z.A.; Azzam, A.N.

    2001-01-01

    Startup works on the MGC-20 variable energy cyclotron in the Inshas Nuclear Research Center (Egypt) are described. The cyclotron is intended for acceleration of hydrogen and helium ions in a wide energy range (for protons - from 5 to 20 MeV). Main units of the cyclotron and results of computer experimental acceleration of protons to 18 MeV are described. The prospects of furthers investigations are presented [ru

  12. Lepidoptera, Nymphalidae, Heliconiinae, Heliconius sara apseudes (Hübner, 1813: Distribution extension

    Directory of Open Access Journals (Sweden)

    Iserhard, C. A.

    2010-01-01

    Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.

  13. A line-of-sight electron cyclotron emission receiver for electron cyclotron resonance heating feedback control of tearing modes

    DEFF Research Database (Denmark)

    Oosterbeek, J.W.; Bürger, A.; Westerhof, E.

    2008-01-01

    An electron cyclotron emission (ECE) receiver inside the electron cyclotron resonance heating (ECRH) transmission line has been brought into operation. The ECE is extracted by placing a quartz plate acting as a Fabry-Perot interferometer under an angle inside the electron cyclotron wave (ECW) bea...

  14. Method and apparatus for ion cyclotron spectrometry

    Science.gov (United States)

    Dahl, David A [Idaho Falls, ID; Scott, Jill R [Idaho Falls, ID; McJunkin, Timothy R [Idaho Falls, ID

    2010-08-17

    An ion cyclotron spectrometer may include a vacuum chamber that extends at least along a z-axis and means for producing a magnetic field within the vacuum chamber so that a magnetic field vector is generally parallel to the z-axis. The ion cyclotron spectrometer may also include means for producing a trapping electric field within the vacuum chamber that includes at least a first section that induces a first magnetron effect that increases a cyclotron frequency of an ion and at least a second section that induces a second magnetron effect that decreases the cyclotron frequency of an ion. The cyclotron frequency changes induced by the first and second magnetron effects substantially cancel one another so that an ion traversing the at least first and second sections will experience no net change in cyclotron frequency.

  15. Commercial compact cyclotrons in the 90's

    International Nuclear Information System (INIS)

    Milton, B.F.

    1995-09-01

    Cyclotrons continue to be efficient accelerators for radio-isotope production. In recent years, developments in the accelerator technology have greatly increased the practical beam current in these machines while also improving the overall system reliability. These developments combined with the development of new isotopes for medicine and industry, and a retiring of older machines indicate a strong future for commercial cyclotrons. In this paper we will survey recent developments in the areas of cyclotron technology, as they relate to the new generation of commercial cyclotrons. Design criteria for the different types of commercial cyclotrons will be presented, with reference to those demands that differ from those in a research oriented cyclotron project. We will also discuss the possibility of systems designed for higher energies and capable of extracted beam currents of up to 2.0 mA. (author)

  16. Commercial compact cyclotrons in the 90's

    International Nuclear Information System (INIS)

    Milton, B.F.

    1995-09-01

    Cyclotrons continue to be efficient accelerators for radio-isotope production. In recent years, developments in the accelerator technology have greatly increased the practical beam current in these machines while also improving the overall system reliability. These developments combined with the development of new isotopes for medicine and industry, and a retiring of older machines indicate a strong future for commercial cyclotrons. In this paper the authors will survey recent developments in the areas of cyclotron technology, as they relate to the new generation of commercial cyclotrons. Design criteria for the different types of commercial cyclotrons will be presented, with reference to those demands that differ from those in a research oriented cyclotron project. The authors also discuss the possibility of systems designed for higher energies and capable of extracted beam currents of up to 2.0 mA

  17. Ion-cyclotron-resonance- and Fourier-transform-ion-cyclotron-resonance spectroscopy: technology and application

    International Nuclear Information System (INIS)

    Luederwald, I.

    1977-01-01

    Instrumentation and technology of Ion-Cyclotron-Resonance and Fourier-Transform-Ion-Cyclotron-Resonance Spectroscopy are described. The method can be applied to studies of ion/molecule reactions in gas phase, to obtain thermodynamic data as gas phase acidity or basicity, proton and electron affinity, and to establish reaction mechanisms and ion structures. (orig.) [de

  18. Developing the smallest possible medical cyclotron

    CERN Multimedia

    Katarina Anthony

    2011-01-01

    Imagine a portable medical cyclotron operated in a conventional radioactive facility at a hospital. Imagine a nurse or technician switching it on and producing isotopes at the patient’s bedside. Sounds like science fiction? Think again.   CERN has teamed up with Spain’s national scientific research centre (CIEMAT) to develop an avant-garde cyclotron to be used for Positron Emission Tomography (PET). “We plan to make a cyclotron that doesn't need an insulated building or ‘vault’: a cyclotron small enough to fit inside a hospital lift,” explains Jose Manuel Perez, who is leading the CIEMAT/CERN collaboration. “It will be the smallest possible medical cyclotron for single patient dose production and will dramatically reduce costs for hospitals.” While PET technology has transformed imaging techniques, many of its medical benefits have remained confined to highly specialised hospitals. “Studies have foun...

  19. Medical cyclotron basic concepts and its applications

    International Nuclear Information System (INIS)

    Kumar, Rajeev; Sonkawade, R.G.

    2012-01-01

    More than 3000 nuclides are known, of which approximately 2700 are radioactive, and rest are stable. The majority of radionuclides are artificially produced in the reactor and cyclotron. In a cyclotron, Charge particle such as proton, Deuteron, á (Alpha) particle, 3 He particles and so forth are accelerated in circular paths within the Dees under vacuum by means of an electromagnetic field. These accelerated particles can possess few KeV to several BeV of kinetic energy depending on the design of the cyclotron. At our setup we have an 11 MeV dual beam multi target cyclotron which is capable producing 11 C, 13 N, 15 O, 18 F and 2 F radioisotopes and all have been successfully produced and tested in our lab. Earlier cyclotrons were the best source of high-energy beams for nuclear physics experiments; several cyclotrons are still in use for this type of research. Cyclotrons can be used to treat cancer. Ion beams from cyclotrons can be used, as in proton therapy. The positron emitting isotopes are suitable for PET imaging. As discussed we are producing mainly Carbon-11, Nitrogen-13, Oxygen-15, and Fluorine-18: These are positron emitters used in PET for studying brain physiology and pathology, in particular for localizing epileptic focus, and in dementia, psychiatry and neuropharmacology studies. So these are having significant role in diagnosis of Oncological, Neurological and Cardiological disorder. More than ninety percent we are producing 18 F in FDG. 18 F in FDG (Flouro-Deoxy-glucose) has become very important in detection of cancers and the monitoring of progress in their treatment, using PET. Medical cyclotron is complex equipment requiring delicate handling by highly trained personnel. The aim of this article is to highlight few finer aspects of Medical cyclotron operation, including precautions for safety and smooth functioning of this sophisticated equipment. (author)

  20. The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

    Directory of Open Access Journals (Sweden)

    John M Morrison

    2012-03-01

    Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.

  1. 20 years Rossendorf cyclotron

    International Nuclear Information System (INIS)

    1978-08-01

    On the occasion of the 20th anniversary of initiating of the Rossendorf cyclotron accounts are given of most important works and results in the field of accelerator engineering and utilization of this machine. The reports show the trend of development and actual spectrum of application. The enclosed literature lists give a survey of technical and experimental works at cyclotron. (author)

  2. Intravenous immunoglobulin in the management of a rare cause of hemolytic disease of the newborn: Anti-SARA antibodies.

    Science.gov (United States)

    Venkataraman, Rohini; Yusuf, Kamran

    2017-01-01

    Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.

  3. Medical cyclotrons

    International Nuclear Information System (INIS)

    Wolf, A.P.

    1976-01-01

    Cyclotrons as tools for therapy and for the production of radionuclides for use in nuclear medicine have been extensively reviewed in the literature. The current world status with respect to cyclotrons used primarily for research, development and application in nuclear medicine is reviewed here in the context of geographical distribution and type of use, presently available commercial types, machine characteristics and trends. Aspects of design requirements from a user perspective such as machine, beam and target characteristics are covered. Some special problems concerning many factors which can lead to effective production of the desired radionuclide or product are considered in light of machine characteristics. Consideration is also given to future directions for accelerators in nuclear medicine

  4. Application of superconductivity in cyclotron construction

    International Nuclear Information System (INIS)

    Blosser, H.G.

    1982-01-01

    This paper reviews major concepts and design features of the new class of cyclotrons which use superconducting coils to provide main magnet excitation. The discussion begins with a brief historical review tracing the evolution of these ''superconducting'' cyclotrons and the impact of this application of superconductivity in pushing back traditional cyclotron construction limits. This is followed by a review of the principal phenomena which come into play to set new limits on the operating regime, and the nature of these limits, some of which arise from orbit properties and some of which result from construction intricacies in the coil and in the rf system. Conclusions anticipate a future widely encompassing role in the application of superconductivity to cyclotron

  5. National Medical Cyclotron

    International Nuclear Information System (INIS)

    Boyd, Rex.

    1991-01-01

    The National Medical Cyclotron, under construction at Sydney's Royal Prince Alfred Hospital(RPAH) is to be operated by the Australian Nuclear Science and Technology Organization in collaboration with the hospital. Its main purpose is to produce radioisotopes on commercial basis for distribution to hospitals through Australia as well as short-lived radioisotopes (2 minutes to 2 hours) for immediate application at RPAH in Positron Emission Tomography, to study the dynamics of human physiology and metabolism in organs, bones and soft tissues. A list of the principal cyclotron-produced radionuclides is provided. ills

  6. How cyclotrons work

    International Nuclear Information System (INIS)

    Nolan, D.

    1992-01-01

    The operating principles of a cyclic accelerator are presented based on the IBA Cyclone 30 negative ion cyclotron, selected for the Australia's first medical cyclotron. Its main features are: acceleration with variable energy of between 15-30 million electron volts, the capability of extracting two beams simultaneously, low power consumption, easy maintenance. Other aspects not directly related to the principle of operation discussed include the vacuum and the radio-frequency systems as well as the complex computerized control system used to automatically control start-up and shut-down operations. ills

  7. Severe accident recriticality analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H

    2001-11-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated

  8. Severe accident recriticality analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.

    2001-01-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady

  9. Cyclotrons and positron emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    Wolf, A.P.; Fowler, J.S.

    1984-01-01

    The state of the art of Positron Emission Tomography (PET) technology as related to cyclotron use and radiopharmaceutical production is reviewed. The paper discusses available small cyclotrons, the positron emitters which can be produced and the yields possible, target design, and radiopharmaceutical development and application. 97 refs., 12 tabs

  10. A new cyclotron for biomedical research

    International Nuclear Information System (INIS)

    Wolber, G.

    1988-01-01

    This paper presents the rationale for replacing the old AEG Compact Cyclotron (built in 1969/71) of the Institute for Radiology and Pathophysiology at the German Cancer Research Center by a 30 MeV H - /15 MeV D - cyclotron. A status report is followed by the scientific and technical reasoning as well as budgetary and organizational considerations. In the appendix we tried to explain the function of a cyclotron in a simple and comprehensive manner. (orig.) [de

  11. Cyclotron Phase-Coherent Ion Spatial Dispersion in a Non-Quadratic Trapping Potential is Responsible for FT-ICR MS at the Cyclotron Frequency

    Science.gov (United States)

    Nagornov, Konstantin O.; Kozhinov, Anton N.; Tsybin, Yury O.

    2018-01-01

    Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS) at the cyclotron frequency instead of the reduced cyclotron frequency has been experimentally demonstrated using narrow aperture detection electrode (NADEL) ICR cells. Here, based on the results of SIMION simulations, we provide the initial mechanistic insights into the cyclotron frequency regime generation in FT-ICR MS. The reason for cyclotron frequency regime is found to be a new type of a collective motion of ions with a certain dispersion in the initial characteristics, such as pre-excitation ion velocities, in a highly non-quadratic trapping potential as realized in NADEL ICR cells. During ion detection, ions of the same m/z move in phase for cyclotron ion motion but out of phase for magnetron (drift) ion motion destroying signals at the fundamental and high order harmonics that comprise reduced cyclotron frequency components. After an initial magnetron motion period, ion clouds distribute into a novel type of structures - ion slabs, elliptical cylinders, or star-like structures. These structures rotate at the Larmor (half-cyclotron) frequency on a plane orthogonal to the magnetic field, inducing signals at the true cyclotron frequency on each of the narrow aperture detection electrodes. To eliminate the reduced cyclotron frequency peak upon dipolar ion detection, a number of slabs or elliptical cylinders organizing a star-like configuration are formed. In a NADEL ICR cell with quadrupolar ion detection, a single slab or an elliptical cylinder is sufficient to minimize the intensity of the reduced cyclotron frequency components, particularly the second harmonic. [Figure not available: see fulltext.

  12. Cyclotrons and positron emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Wolf, A.P.; Fowler, J.S.

    1984-01-01

    The state of the art of Positron Emission Tomography (PET) technology as related to cyclotron use and radiopharmaceutical production is reviewed. The paper discusses available small cyclotrons, the positron emitters which can be produced and the yields possible, target design, and radiopharmaceutical development and application. 97 refs., 12 tabs. (ACR)

  13. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    OpenAIRE

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...

  14. Cyclotron method for heavy ion acceleration

    International Nuclear Information System (INIS)

    Gikal, B.N.; Gul'bekyan, G.G.; Kutner, V.B.; Oganesyan, R.Ts.

    1984-01-01

    Studies on heavy ion beams in a wide range of masses (up to uranium) and energies disclose essential potential opportunities for solution of both fundamental scientific and significant economical problems. A cyclotron method for heavy ion acceleration is considered. Development of low and medium energy heavy ion accelerators is revealed. The design of a complex comprising two isochronous cyclotrons which is planned to be constrdcted 1n the JINR is described. The cyclotron complex includes the U-400 and the U-400 M cyclotrons and it is intended for acceleration of both 35-20 MeV/nucleon superheavy ions such as Xe-U and 120 MeV/nucleon light ions. Certain systems of the accelerators are described. Prospects of the U-400 and the U-400 M development are displayed

  15. Commercial cyclotrons. Part I: Commercial cyclotrons in the energy range 10 30 MeV for isotope production

    Science.gov (United States)

    Papash, A. I.; Alenitsky, Yu. G.

    2008-07-01

    A survey of commercial cyclotrons for production of medical and industrial isotopes is presented. Compact isochronous cyclotrons which accelerate negative hydrogen ions in the energy range 10 30 MeV have been widely used over the last 25 years for production of medical isotopes and other applications. Different cyclotron models for the energy range 10 12 MeV with moderate beam intensity are used for production of 11C, 13N, 15O, and 18F isotopes widely applied in positron emission tomography. Commercial cyclotrons with high beam intensity are available on the market for production of most medical and industrial isotopes. In this work, the physical and technical parameters of different models are compared. Possibilities of improving performance and increasing intensity of H- beams up to 2 3 mA are discussed.

  16. Solid targetry for compact cyclotrons

    International Nuclear Information System (INIS)

    Comor, J.

    2004-01-01

    In this presentation authors present experimental results of solid targetry for compact cyclotrons. It is concluded: Solid targetry is not restricted to large accelerator centers anymore; Small and medium scale radioisotope production is feasible with compact cyclotrons; The availability of versatile solid target systems is expected to boost the radiochemistry of 'exotic' positron emitters

  17. Ponderomotive force near cyclotron resonance

    Energy Technology Data Exchange (ETDEWEB)

    Kono, Mitsuo; Sanuki, Heiji

    1987-01-01

    The ponderomotive force, which is involved in the excitation of macroscopic behaviors of plasma caused by wave motion, plays an important role in various non-linear wave motion phenomena. In the present study, equations for the pondermotive force for plasma in a uniform magnetic field is derived using a renormalization theory which is based on the Vlasov equation. It is shown that the pondermotive force, which diverges at the cyclotron resonence point according to adiabatic approximation, can be expressed by a non-divergent equation by taking into account the instability of the cyclotron orbit due to high-order scattering caused by a wave. This is related with chaotic particle behaviors near cyclotron resonance, where the pondermotive force is small and the diffusion process prevails. It is assumed here that the amplitude of the high-frequency electric field is not large and that the broadening of cyclotron levels is smaller than the distance between the levels. A global chaos will be created if the amplitude of the electric field becomes greater to allow the broadening to exceed the distance between the levels. (Nogami, K.).

  18. Cyclotron transitions of bound ions

    Science.gov (United States)

    Bezchastnov, Victor G.; Pavlov, George G.

    2017-06-01

    A charged particle in a magnetic field possesses discrete energy levels associated with particle rotation around the field lines. The radiative transitions between these levels are the well-known cyclotron transitions. We show that a bound complex of particles with a nonzero net charge displays analogous transitions between the states of confined motion of the entire complex in the field. The latter bound-ion cyclotron transitions are affected by a coupling between the collective and internal motions of the complex and, as a result, differ from the transitions of a "reference" bare ion with the same mass and charge. We analyze the cyclotron transitions for complex ions by including the coupling within a rigorous quantum approach. Particular attention is paid to comparison of the transition energies and oscillator strengths to those of the bare ion. Selection rules based on integrals of collective motion are derived for the bound-ion cyclotron transitions analytically, and the perturbation and coupled-channel approaches are developed to study the transitions quantitatively. Representative examples are considered and discussed for positive and negative atomic and cluster ions.

  19. arXiv Cyclotrons: Magnetic Design and Beam Dynamics

    CERN Document Server

    Zaremba, Simon

    Classical, isochronous, and synchro-cyclotrons are introduced. Transverse and longitudinal beam dynamics in these accelerators are covered. The problem of vertical focusing and iscochronism in compact isochronous cyclotrons is treated in some detail. Different methods for isochronization of the cyclotron magnetic field are discussed. The limits of the classical cyclotron are explained. Typical features of the synchro-cyclotron, such as the beam capture problem, stable phase motion, and the extraction problem are discussed. The main design goals for beam injection are explained and special problems related to a central region with an internal ion source are considered. The principle of a Penning ion gauge source is addressed. The issue of vertical focusing in the cyclotron centre is briefly discussed. Several examples of numerical simulations are given. Different methods of (axial) injection are briefly outlined. Different solutions for beam extraction are described. These include the internal target, extracti...

  20. Recent development and progress of IBA cyclotrons

    Energy Technology Data Exchange (ETDEWEB)

    Kleeven, W., E-mail: Willem.Kleeven@iba-group.com [Ion Beam Applications s.a. Chemin du Cyclotron 3, Louvain-la-Neuve (Belgium); Abs, M., E-mail: Michel.Abs@iba-group.com [Ion Beam Applications s.a. Chemin du Cyclotron 3, Louvain-la-Neuve (Belgium); Delvaux, J.L., E-mail: Jean-Luc.Delvaux@iba-group.com [Ion Beam Applications s.a. Chemin du Cyclotron 3, Louvain-la-Neuve (Belgium); Forton, E., E-mail: Eric.Forton@iba-group.com [Ion Beam Applications s.a. Chemin du Cyclotron 3, Louvain-la-Neuve (Belgium); Jongen, Y., E-mail: Yves.Jongen@iba-group.com [Ion Beam Applications s.a. Chemin du Cyclotron 3, Louvain-la-Neuve (Belgium); Medeiros Romao, L., E-mail: Luis.MedeirosRomao@iba-group.com [Ion Beam Applications s.a. Chemin du Cyclotron 3, Louvain-la-Neuve (Belgium); Nactergal, B., E-mail: Benoit.Nactergal@iba-group.com [Ion Beam Applications s.a. Chemin du Cyclotron 3, Louvain-la-Neuve (Belgium); Nuttens, V., E-mail: Vincent.Nuttens@iba-group.com [Ion Beam Applications s.a. Chemin du Cyclotron 3, Louvain-la-Neuve (Belgium); Servais, T., E-mail: Thomas.Servais@iba-group.com [Ion Beam Applications s.a. Chemin du Cyclotron 3, Louvain-la-Neuve (Belgium); Vanderlinden, T., E-mail: Thierry.Vanderlinden@iba-group.com [Ion Beam Applications s.a. Chemin du Cyclotron 3, Louvain-la-Neuve (Belgium); Zaremba, S., E-mail: Simon.Zaremba@iba-group.com [Ion Beam Applications s.a. Chemin du Cyclotron 3, Louvain-la-Neuve (Belgium)

    2011-12-15

    Several cyclotron development projects were recently realized by Ion Beam Applications S.A. (IBA). This contribution presents three of them: (i) the intensity enhancement of the Cyclone 30 cyclotron, a machine mainly used for the production of SPECT isotopes. This project is related with the increased demand for {sup 201}Tl because of the shortage of Mo/Tc generators from nuclear reactors, (ii) development of a new versatile multiple-particle K = 30 isotope-production cyclotron (the Cyclone 30XP) being able to accelerate H{sup -}, D{sup -} and also {alpha}-particles. The {alpha}-beam of this cyclotron will allow the production of new therapeutic isotopes (e.g. {sup 211}At) and (iii) commissioning of the Cyclone 70 cyclotron installed for Arronax in France. This machine is similar to the C30XP but provides higher energy (K = 70) and allows research on new types of medical isotopes.

  1. Synchro-cyclotron

    CERN Multimedia

    CERN PhotoLab

    1972-01-01

    The electromagnetic coil which forms the first section of the proton extraction channel in the improved synchro-cyclotron. The photograph shows the positioning gear and the current septum. An extraction efficiency above 50% is expected.

  2. Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

    Science.gov (United States)

    Goldrick-Rab, Sara; Kelly, Andrew P.

    2016-01-01

    In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…

  3. Compact superconducting cyclotron C400 for hadron therapy

    Energy Technology Data Exchange (ETDEWEB)

    Jongen, Y.; Abs, M.; Blondin, A.; Kleeven, W.; Zaremba, S.; Vandeplassche, D. [IBA, Chemin du Cyclotron 3, B-1348 Louvain-la-Neuve (Belgium); Aleksandrov, V.; Gursky, S.; Karamyshev, O. [JINR, Joliot-Curie 6, 141980 Dubna, Moscow region (Russian Federation); Karamysheva, G., E-mail: gkaram@nu.jinr.r [JINR, Joliot-Curie 6, 141980 Dubna, Moscow region (Russian Federation); Kazarinov, N.; Kostromin, S.; Morozov, N.; Samsonov, E.; Shirkov, G.; Shevtsov, V.; Syresin, E.; Tuzikov, A. [JINR, Joliot-Curie 6, 141980 Dubna, Moscow region (Russian Federation)

    2010-12-01

    The compact superconducting isochronous cyclotron C400 has been designed by the IBA-JINR collaboration. It will be the first cyclotron in the world capable of delivering protons, carbon and helium ions for cancer treatment. The cyclotron construction is started this year within the framework of the Archade project (Caen, France). {sup 12}C{sup 6+} and {sup 4}He{sup 2+} ions will be accelerated to 400 MeV/uu energy and extracted by the electrostatic deflector, H{sub 2}{sup +} ions will be accelerated to the energy of 265 MeV/uu and extracted by stripping. The magnet yoke has a diameter of 6.6 m, the total weight of the magnet is about 700 t. The designed magnetic field corresponds to 4.5 T in the hills and 2.45 T in the valleys. Superconducting coils will be enclosed in a cryostat; all other parts of the cyclotron will be warm. Three external ion sources will be mounted on the switching magnet on the injection line located below the cyclotron. The main parameters of the cyclotron, its design, the current status of the development work on the cyclotron systems are presented.

  4. Severe Accident Recriticality Analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  5. Severe Accident Recriticality Analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  6. Directory of cyclotrons used for radionuclide production in Member States

    International Nuclear Information System (INIS)

    1998-03-01

    The directory of cyclotrons used for radionuclide production is an update of the data base on cyclotrons that was compiled in 1983 by the International Atomic Energy Agency. The directory contains technical, utilization and administrative information supplied to the IAEA as of October 1997. The directory was prepared through information collected by questionnaires sent to institutions that either have a cyclotron, or that were identified to be in the process of installation of a cyclotron. The directory contains 206 entries for cyclotrons operating in 34 Member States. The largest concentration of cyclotrons for radionuclide production are located in the United States of America (66), Japan (33) and Germany (22). The largest number of cyclotrons for a single country is the United States of America. The expansion in number of cyclotrons during the last decade has been driven by the advent of advances in medical imaging instrumentation (PET, SPET and more recently 511 KeV emission tomography); introduction of user friendly compact medical cyclotrons from several companies that manufacture cyclotrons; and recent decisions that 15 O-oxygen PET studies in Japan, and 18 F-FDG PET studies in Germany are eligible for reimbursement by government or insurance companies

  7. Directory of cyclotrons used for radionuclide production in Member States

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    The directory of cyclotrons used for radionuclide production is an update of the data base on cyclotrons that was compiled in 1983 by the International Atomic Energy Agency. The directory contains technical, utilization and administrative information supplied to the IAEA as of October 1997. The directory was prepared through information collected by questionnaires sent to institutions that either have a cyclotron, or that were identified to be in the process of installation of a cyclotron. The directory contains 206 entries for cyclotrons operating in 34 Member States. The largest concentration of cyclotrons for radionuclide production are located in the United States of America (66), Japan (33) and Germany (22). The largest number of cyclotrons for a single country is the United States of America. The expansion in number of cyclotrons during the last decade has been driven by the advent of advances in medical imaging instrumentation (PET, SPET and more recently 511 KeV emission tomography); introduction of user friendly compact medical cyclotrons from several companies that manufacture cyclotrons; and recent decisions that {sup 15}O-oxygen PET studies in Japan, and {sup 18}F-FDG PET studies in Germany are eligible for reimbursement by government or insurance companies.

  8. H-superconducting cyclotron for PET isotope production

    International Nuclear Information System (INIS)

    Smirnov, V.L.; Vorozhtsov, S.B.; Vincent, J.

    2014-01-01

    The scientific design of a 14-MeV H - compact superconducting cyclotron for producing of the 18 F and 13 N isotopes has been developed. Main requirements to the facility as a medical accelerator are met in the design. In particular, the main requirement for the cyclotron was the smallest possible size due to the superconducting magnet. The calculations show that the proposed cyclotron allows extracted beam intensity over 500 μA. To increase system reliability and production rates, an external H - ion source is applied. The choice of the cyclotron concept, design of the structure elements, calculation of the electromagnetic fields and beam dynamics from the ion source to the extraction system were performed.

  9. Status report on cyclotron operation

    International Nuclear Information System (INIS)

    Kovacs, P.; Szuecs, I.; Ander, I.; Lakatos, T.; Fenyvesi, A.; Ditroi, F.; Takacs, S.; Tarkanyi, F.

    2004-01-01

    The operation of the cyclotron in 2003 was again concentrated to 9 months; January, July and August were reserved for maintenance, renewal works and holidays. The overall working time of the accelerator was 4051 hours. The cyclotron was available for users for 3682 hours. In order to improve the circumstances of the irradiations renewal and improvements were done. (N.T.)

  10. Slow wave cyclotron maser

    International Nuclear Information System (INIS)

    Kho, T.H.; Lin, A.T.

    1988-01-01

    Cyclotron masers such as Gyrotrons and the Autoresonance Masers, are fast wave devices: the electromagnetic wave's phase velocity v rho , is greater than the electron beam velocity, v b . To be able to convert the beam kinetic energy into radiation in these devices the beam must have an initial transverse momentum, usually obtained by propagating the beam through a transverse wiggler magnet, or along a nonuniform guide magnetic field before entry into the interaction region. Either process introduces a significant amount of thermal spread in the beam which degrades the performance of the maser. However, if the wave phase velocity v rho v b , the beam kinetic energy can be converted directly into radiation without the requirement of an initial transverse beam momentum, making a slow wave cyclotron maser a potentially simpler and more compact device. The authors present the linear and nonlinear physics of the slow wave cyclotron maser and examine its potential for practical application

  11. A national medical cyclotron facility: report to the Minister of Health by the Medical Cyclotron Committee

    International Nuclear Information System (INIS)

    1985-01-01

    Research and training in nuclear medicine in Australia are both limited by the lack of a medical cyclotron facility. The Committee recommends the establishment of a national medical cyclotron to provide a supply of short-lived radioisotopes for research in relevant fields of medicine, and for diagnostic use in nuclear medicine

  12. Radiation shielding and health physics instrumentation for PET medical cyclotrons

    International Nuclear Information System (INIS)

    Mukherjee, B.

    2002-01-01

    Full text: Modern Medical Cyclotrons produce a variety of short-lived positron emitting PET radioisotopes, and as a result are the source of intense neutron and gamma radiations. Since such cyclotrons are housed within hospitals or medical clinics, there is significant potential for un-intentional exposure to staff or patients in proximity to cyclotron facilities. Consequently, the radiological hazards associated with Cyclotrons provide the impetus for an effective radiological shielding and continuous monitoring of various radiation levels in the cyclotron environment. Management of radiological hazards is of paramount importance for the safe operation of a Medical Cyclotron facility. This work summarised the methods of shielding calculations for a compact hospital based Medical Cyclotron currently operating in Canada, USA and Australia. The design principle and operational history of a real-time health physics monitoring system (Watchdog) operating at a large multi-energy Medical Cyclotron is also highlighted

  13. Development of cyclotron solid targetry

    International Nuclear Information System (INIS)

    D'Souza, J.; Deans, T.; Cryer, D.; Price, R.

    2004-01-01

    Full text: Western Australia's first medical cyclotron was recently installed in the Department of Medical Technology and Physics at Sir Charles Gairdner Hospital. The cyclotron is routinely used for 18 F production using a liquid target, and now research is being undertaken into solid target bombardment for production of novel isotopes such as 124 I, 64 Cu and 96 Tc. The IBA Cyclone 18/9 has a maximum proton beam energy of 18MeV and maximum beam current of 80μA. A proton beam is generated by the acceleration of H- ions in the evacuated cyclotron (10 -6 bar) which are then stripped of 2 electrons just prior to exiting a target port. Each port has two strippers which are made of 10μm thick carbon with dimensions 12mmxl3mm. Due to their thinness, the strippers are easily ruptured. The Cyclone 18/9 has 8 target ports. In order to fit a target onto the cyclotron when the cyclotron is already evacuated the target is first evacuated to 10 -3 bar by a roughing pump before an isolation valve at the port is opened. This stops any damage that may occur by the flow of air from the target reservoir to the cyclotron eg to the strippers. The first step in the project to develop solid targetry is to build a beam line in order to measure the beam profile. If successful, this design will be improved in order to have a beam line and target holder that are suitable for use in solid target bombardment. A 40cm beam line with an internal diameter of 3.6cm was built to fit onto the IBA Cyclone 18/9. The beam line, made out of aluminium, incorporates a step 5cm from the end at which a target material can be fitted. A cover fits onto the beam line, behind the target in order to maintain vacuum. The cover is held in place by the vacuum within the beam line. At the end of bombardment, the beam line can be isolated from the vacuum of the target and normal air pressure restored. In doing so the cover plate falls open and the target falls into a lead pot, ready for removal from the cyclotron

  14. Decontamination of the activation product based on a legal revision of the cyclotron vault room on the non-self-shield compact medical cyclotron

    International Nuclear Information System (INIS)

    Komiya, Isao; Umezu, Yoshiyuki; Fujibuchi, Toshiou; Nakamura, Kazumasa; Baba, Shingo; Honda, Hiroshi

    2016-01-01

    The non-self-shield compact medical cyclotron and the cyclotron vault room were in operation for 27 years. They have now been decommissioned. We efficiently implemented a technique to identify an activation product in the cyclotron vault room. Firstly, the distribution of radioactive concentrations in the concrete of the cyclotron vault room was estimated by calculation from the record of the cyclotron operation. Secondly, the comparison of calculated results with an actual measurement was performed using a NaI scintillation survey meter and a high-purity germanium detector. The calculated values were overestimated as compared to the values measured using the Nal scintillation survey meter and the high-purity germanium detector. However, it could limit the decontamination area. By simulating the activation range, we were able to minimize the concrete core sampling. Finally, the appropriate range of radioactivated area in the cyclotron vault room was decontaminated based on the results of the calculation. After decontamination, the radioactive concentration was below the detection limit value in all areas inside the cyclotron vault room. By these procedures, the decommissioning process of the cyclotron vault room was more efficiently performed. (author)

  15. Rf structure of superconducting cyclotron for therapy application

    International Nuclear Information System (INIS)

    Takekoshi, Hidekuni; Matsuki, Seishi; Mashiko, Katuo; Shikazono, Naomoto.

    1981-01-01

    Advantages of fast neutrons in therapeutical application are now widely recognized. Fast neutrons are generated by bombarding a thick beryllium target with high energy protons and deuterons. The AVF cyclotrons which deliver 50 MeV protons and 25 MeV deuterons are commonly used and are commercially available now. At the treatment usually rotational irradiation is taken to prevent an injury to normal tissue from the high LET effect of fast neutrons. The construction cost of both cyclotrons and isocentric irradiation installation are relatively high, so that the spread of neutron therapy is obstructed. A superconducting cyclotron for neutron therapy application was proposed by a Chalk River group. This low cost design allows the installation to be a dedicated facility located in a hospital, and small size allows installations of the complete cyclotron in a rotatable gantry. The design studies of the superconducting cyclotron based on this idea are going on at Kyoto University. The full scale model experiments for a rf structure of the cyclotron were carried out. (author)

  16. Commissioning of cryogen delivery system for superconducting cyclotron magnet

    International Nuclear Information System (INIS)

    Pal, G.; Nandi, C.; Bhattacharyya, T.K.; Chaudhuri, J.; Bhandari, R.K.

    2005-01-01

    A K-500 superconducting cyclotron is being constructed at VECC Kolkata. The cryogen delivery system distributes liquid helium and liquid nitrogen to the superconducting cyclotron. Liquid helium is required to cool the cyclotron magnet and cryopanels. Liquid nitrogen is used to reduce the capacity of the helium liquefier. This paper describes the system, the current status and the commissioning experiences of cryogen delivery system for cyclotron magnet. (author)

  17. Progress report: Variable Energy Cyclotron Centre, Calcutta

    International Nuclear Information System (INIS)

    1999-01-01

    This volume of the progress report brings out the scientific and technical activities of Variable Energy Cyclotron Centre, Calcutta during the year 1999. This includes brief review of the various R and D activities of the Centre and outside users of the cyclotron from the universities and other research institutes. The operational activities of the cyclotron with ECR ion sources, accelerator oriented research activities, activities on detector, target and electronics are reported. The activities of the Computer and Informatics group are described. The status report of the ongoing projects is also provided. The main activities of the superconducting cyclotron project, radioactive ion beam project, heavy ion experimental facility, advanced computational facility, recovery and analysis of helium from hot springs and material science research are described

  18. 10 GHz ECRIS for Warsaw Cyclotron

    CERN Document Server

    Sudlitz, K

    1999-01-01

    Cusp type, 10 GHz ECRIS has been built and tested earlier. For obtaining intensive beams, more relevant for cyclotron, cusp geometry has been replaced by hexapole. Discharge chamber (stainless steel, 50 mm diameter, 250 mm long) is an extension of a coaxial line, feeding RF (9,6 GHz, up to 200 W) to the plasma. The NdFeB hexapole (0,52 T on the surface) has been used. The axial magnetic field is created by water cooled coils. The axial injection line dedicated to K160 isochronous heavy ion cyclotron has been constructed. The line consists of Glaser lenses, double focusing magnet, solenoid and mirror type inflector. The system provides sufficient transmission of the beam from ECR ion source to the firsts orbits of the cyclotron for m/q ranging from 7 to 2. After successful initial tests which were done in July 1997 the ECRIS serves as an external source for Warsaw Cyclotron.

  19. Electron cyclotron harmonic wave acceleration

    Science.gov (United States)

    Karimabadi, H.; Menyuk, C. R.; Sprangle, P.; Vlahos, L.

    1987-01-01

    A nonlinear analysis of particle acceleration in a finite bandwidth, obliquely propagating electromagnetic cyclotron wave is presented. It has been suggested by Sprangle and Vlahos in 1983 that the narrow bandwidth cyclotron radiation emitted by the unstable electron distribution inside a flaring solar loop can accelerate electrons outside the loop by the interaction of a monochromatic wave propagating along the ambient magnetic field with the ambient electrons. It is shown here that electrons gyrating and streaming along a uniform, static magnetic field can be accelerated by interacting with the fundamental or second harmonic of a monochromatic, obliquely propagating cyclotron wave. It is also shown that the acceleration is virtually unchanged when a wave with finite bandwidth is considered. This acceleration mechanism can explain the observed high-energy electrons in type III bursts.

  20. Electron cyclotron harmonic wave acceleration

    International Nuclear Information System (INIS)

    Karimabadi, H.; Menyuk, C.R.; Sprangle, P.; Vlahos, L.; Salonika Univ., Greece)

    1987-01-01

    A nonlinear analysis of particle acceleration in a finite bandwidth, obliquely propagating electromagnetic cyclotron wave is presented. It has been suggested by Sprangle and Vlahos in 1983 that the narrow bandwidth cyclotron radiation emitted by the unstable electron distribution inside a flaring solar loop can accelerate electrons outside the loop by the interaction of a monochromatic wave propagating along the ambient magnetic field with the ambient electrons. It is shown here that electrons gyrating and streaming along a uniform, static magnetic field can be accelerated by interacting with the fundamental or second harmonic of a monochromatic, obliquely propagating cyclotron wave. It is also shown that the acceleration is virtually unchanged when a wave with finite bandwidth is considered. This acceleration mechanism can explain the observed high-energy electrons in type III bursts. 31 references

  1. 83-inch cyclotron research program. Final report

    International Nuclear Information System (INIS)

    Parkinson, W.C.

    1983-07-01

    In June of 1960 the US Atomic Energy Commission authorized the construction of a modern variable energy cyclotron facility at The University of Michigan to be used for research in nuclear spectroscopy. The Legislature of the State of Michigan made available funds for construction of a building to house the 83-inch cyclotron and auxiliary equipment as well as the University's remodeled 42-inch cyclotron. The research program centered around the 83-inch cyclotron was funded by the AEC and its successors, the Energy Research and Development Administration (ERDA) and the Department of Energy (DOE), from September 1964 through March 1977. The program represented a continuation of the research effort using the 42-inch cyclotron facility which had been supported continuously by the AEC since February 1950. This final report to DOE briefly describes the research facility, the research program, and highlights the principal accomplishments of the effort. It begins with a historical note to place this effort within the context of nuclear physics research in the Department of Physics of the University of Michigan

  2. Recycling and recommissioning a used biomedical cyclotron

    International Nuclear Information System (INIS)

    Carroll, L.R.; Ramsey, F.; Armbruster, J.; Montenero, M.

    2001-01-01

    Biomedical Cyclotrons have a very long life, but there eventually comes a time when any piece of equipment has to be retired from service. From time to time, we have the opportunity to help find new homes for used cyclotrons which, with relatively modest overhaul and refurbishment, can have many additional years of productive service, and thus represent a very valuable asset. The reasons for retiring a cyclotron vary, of course, but in our experience it is often due to an institution's changing priorities or changing needs, rather than the due to any fundamental age-related deficiency in the cyclotron itself. In this paper we will report on the relocation and successful restoration of a used TCC CP-42 cyclotron, which was moved from M.D. Anderson Hospital in Houston to Denton, Texas in early 1998, where it is presently being used for R and D and commercial production of biomedical isotopes. Ownership of the machine has been transferred to the University of North Texas; facility, manpower, and operational resources are provided by International Isotopes, Inc

  3. Diagnostic system for the nuclear medicine with baby cyclotron

    International Nuclear Information System (INIS)

    Kashihara, Masao; Wakasa, Shyuichiro

    1982-01-01

    The system of cyclotron nuclear medicine consists of ''RI-production by using the cyclotron'', ''production of radio-pharmaceuticals labeled with RI'', ''positron tomography''. On the other hand, Ultra compact cyclotron (Baby cyclotron) itself, RI production technique and positron tomography have been rapidly developed and advanced. We think that these three functions must be balance in the development in order to spread this system into the routine work in the hospital. However, since the technology of the synthesis for the labeled compounds is not so developed so far, more advance can be strongly expected. In this report, construction of the cyclotron nuclear medicine, utility for the practical use of RI produced by using the cyclotron, technique of RI production, and the studies on automated and efficient productions of radio-pharmaceuticals labeled with short-lived positron emitters for medical diagnostic use are described. (author)

  4. Development of a Medical Cyclotron Production Facility

    Science.gov (United States)

    Allen, Danny R.

    2003-08-01

    Development of a Cyclotron manufacturing facility begins with a business plan. Geographics, the size and activity of the medical community, the growth potential of the modality being served, and other business connections are all considered. This business used the customer base established by NuTech, Inc., an independent centralized nuclear pharmacy founded by Danny Allen. With two pharmacies in operation in Tyler and College Station and a customer base of 47 hospitals and clinics the existing delivery system and pharmacist staff is used for the cyclotron facility. We then added cyclotron products to contracts with these customers to guarantee a supply. We partnered with a company in the process of developing PET imaging centers. We then built an independent imaging center attached to the cyclotron facility to allow for the use of short-lived isotopes.

  5. Development of a Medical Cyclotron Production Facility

    International Nuclear Information System (INIS)

    Allen, Danny R.

    2003-01-01

    Development of a Cyclotron manufacturing facility begins with a business plan. Geographics, the size and activity of the medical community, the growth potential of the modality being served, and other business connections are all considered. This business used the customer base established by NuTech, Inc., an independent centralized nuclear pharmacy founded by Danny Allen. With two pharmacies in operation in Tyler and College Station and a customer base of 47 hospitals and clinics the existing delivery system and pharmacist staff is used for the cyclotron facility. We then added cyclotron products to contracts with these customers to guarantee a supply. We partnered with a company in the process of developing PET imaging centers. We then built an independent imaging center attached to the cyclotron facility to allow for the use of short-lived isotopes

  6. Method and apparatuses for ion cyclotron spectrometry

    Science.gov (United States)

    Dahl, David A [Idaho Falls, ID; Scott, Jill R [Idaho Falls, ID; McJunkin, Timothy R [Idaho Falls, ID

    2012-03-06

    An ion cyclotron spectrometer may include a vacuum chamber that extends at least along a z-axis and means for producing a magnetic field within the vacuum chamber so that a magnetic field vector is generally parallel to the z-axis. The ion cyclotron spectrometer may also include means for producing a trapping electric field within the vacuum chamber. The trapping electric field may comprise a field potential that, when taken in cross-section along the z-axis, includes at least one section that is concave down and at least one section that is concave up so that ions traversing the field potential experience a net magnetron effect on a cyclotron frequency of the ions that is substantially equal to zero. Other apparatuses and a method for performing ion cyclotron spectrometry are also disclosed herein.

  7. Cyclotron radiation by a multi-group method

    International Nuclear Information System (INIS)

    Chu, T.C.

    1980-01-01

    A multi-energy group technique is developed to study conditions under which cyclotron radiation emission can shift a Maxwellian electron distribution into a non-Maxwellian; and if the electron distribution is non-Maxwellian, to study the rate of cyclotron radiation emission as compared to that emitted by a Maxwellian having the same mean electron density and energy. The assumptions in this study are: the electrons should be in an isotropic medium and the magnetic field should be uniform. The multi-group technique is coupled into a multi-group Fokker-Planck computer code to study electron behavior under the influence of cyclotron radiation emission in a self-consistent fashion. Several non-Maxwellian distributions were simulated to compare their cyclotron emissions with the corresponding energy and number density equivalent Maxwellian distribtions

  8. Low energy cyclotron for radiocarbon dating

    International Nuclear Information System (INIS)

    Welch, J.J.

    1984-12-01

    The measurement of naturally occurring radioisotopes whose half lives are less than a few hundred million years but more than a few years provides information about the temporal behavior of geologic and climatic processes, the temporal history of meteoritic bodies as well as the production mechanisms of these radioisotopes. A new extremely sensitive technique for measuring these radioisotopes at tandem Van de Graaff and cyclotron facilities has been very successful though the high cost and limited availability have been discouraging. We have built and tested a low energy cyclotron for radiocarbon dating similar in size to a conventional mass spectrometer. These tests clearly show that with the addition of a conventional ion source, the low energy cyclotron can perform the extremely high sensitivity 14 C measurements that are now done at accelerator facilities. We found that no significant background is present when the cyclotron is tuned to accelerate 14 C negative ions and the transmission efficiency is adequate to perform radiocarbon dating on milligram samples of carbon. The internal ion source used did not produce sufficient current to detect 14 C directly at modern concentrations. We show how a conventional carbon negative ion source, located outside the cyclotron magnet, would produce sufficient beam and provide for quick sampling to make radiocarbon dating milligram samples with a modest laboratory instrument feasible

  9. PIXE analysis by baby cyclotron

    International Nuclear Information System (INIS)

    Yoshida, Hyogo; Tanaka, Teruaki; Ito, Takashi; Toda, Yohjiro; Wakasa, Hideichiro

    1988-01-01

    The Japan Steel Works, Ltd. has been supplying a very small sized cyclotron (Baby Cyclotron) to hospitals and research facilities. The cyclotron is designed to produce short-lived radioisotopes for medical use. In the present study, this cyclotron is modified so that it can serve for PIXE analysis. The PIXE (particle induced X-ray emission) technique has the following features: (1) Down to 1 ng of trace material in a sample (mg - μg) can be detected, (2) An analysis run is completed in one to ten minutes, permitting economical analysis for a large number of samples, (3) Several elements can be analyzed simultaneously, with an almost constant sensitivity for a variety of elements ranging from aluminum to heavy metals, (4) Analysis can be performed nondestructively without a chemical process, and (5) The use of microbeam can provide data on the distribution of elements with a resolution of several μm. Software for analysis is developed to allow the modified equipment to perform peak search, background fitting, and identification and determination of peaks. A study is now being conducted to examine the performance of the equipment for PIXE analysis of thin samples. Satisfactory results have been obtained. The analysis time, excluding the background correction, is 5-10 min. (Nogami, K.)

  10. Operation of the Karlsruhe Isochronous Cyclotron in 1975

    International Nuclear Information System (INIS)

    Schulz, F.; Schweickert, H.

    1976-06-01

    The operation of the Karlsruhe Isochronous Cyclotron in 1975 is briefly surveyed. The main reasons for a very short period for maintenance, repair and installation, and several additional efforts to improve the reliability of the accelerator installation, are discussed. The status and the results of several technical developments for the cyclotron are described: 1) the axial injection system; 2) computer aided cyclotron operation; 3) ion source development; 4) capacitive current measurement at the external beam; 5) new correction coils for the cyclotron; 6) improvement of the neutron time-of-flight spectrometer. As there is an increasing interest in using this type of accelerator for research in fields other than nuclear physics, it was felt appropriate to present short surveys on investigations at our cyclotron in 1975 in the fields of: 1) solid state physics; 2) engineering; 3) materials research; 4) nuclear medicine; 5) nuclear chemistry. (orig.) [de

  11. Present and future superconducting cyclotrons

    International Nuclear Information System (INIS)

    Nolen, J.A. Jr.

    1987-01-01

    This paper begins with a brief review of the status of present superconducting (SC) cyclotron projects, including the two which are currently operating and the six which are under construction. The next section summarizes the main features shared by five of these machines, while the third section presents recent developments and new concepts introduced in the other three ''second generation'' SC cyclotrons. Projects in early stages of development are discussed in the fourth section

  12. NIRS-Chiba isochronous cyclotron 1975

    International Nuclear Information System (INIS)

    Ogawa, H.; Kumamoto, Y.; Yamada, T.; Hiramoto, T.

    1976-02-01

    The cyclotron facility installed according to the recommendation of the Atomic Energy Committee of Japan is used for neutron therapy and production of short-lived radioisotopes. Construction on the facility was started in the autumn of 1972, and completed in March 1974. Described are the following: beam transport and the experimental hall, machine research and improvement, machine time sharing and the particles and energies, characteristics of the cyclotron, and facility personnel. (auth.)

  13. Knowledge based operation assist system for JAERI AVF cyclotron

    International Nuclear Information System (INIS)

    Agematsu, T.; Okumura, S.; Yokota, W.; Arakawa, K.; Murakami, T.; Okamura, T.

    1992-01-01

    We have developed two operation assist systems for easy and rapid operation of the JAERI AVF cyclotron. One is a knowledge based expert system guiding the sequence of parameter adjustment to inexperienced cyclotron operators. The other is a real-time simulation of the beam trajectories which are calculated from actual operating parameters. It graphically indicates feasible setting range of parameters that satisfies the acceptance of the cyclotron. These systems provide a human interface to adjust the parameters of the cyclotron. (author)

  14. Isochronous cyclotron for thermonuclear reactors driving

    International Nuclear Information System (INIS)

    Alenitskij, Yu.G.

    1998-01-01

    The main requirements to an accelerator as a part of an electronuclear power plant are considered. The range of the parameters of the accelerated proton and deuteron beams, for which the isochronous cyclotron is the most profitable, is proposed. An opportunity of using the cyclotron to drive the research reactors of various types is considered

  15. Sara, a patient with borderline personality structure: A "crisis" management

    Directory of Open Access Journals (Sweden)

    Paola Marinelli

    2015-05-01

    Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma. 

  16. Cyclotron to Oslo University

    International Nuclear Information System (INIS)

    Sandstad, J.

    1978-01-01

    The new cyclotron was delivered to Oslo University on September 21st 1978, and was mannfactured by A/B Scandtronix of Uppsala, Sweden. The contract price was 6,8 million Norwegian kroner and installation will cost a further 4 million. The main specifications are given. The energy will be 36 MeV for protons and alpha particles, 18 MeV deuterons and 48 MeV for helium 3. The principle of a cyclotron is briefly described. While the primary purpose of the machine is nuclear research it is also planned to produce short-lived radioisotopes, primarily iodine 123. (JIW)

  17. A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

    Science.gov (United States)

    Worthen, Helena Harlow

    2012-01-01

    The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…

  18. New superconducting cyclotron driven scanning proton therapy systems

    International Nuclear Information System (INIS)

    Klein, Hans-Udo; Baumgarten, Christian; Geisler, Andreas; Heese, Juergen; Hobl, Achim; Krischel, Detlef; Schillo, Michael; Schmidt, Stefan; Timmer, Jan

    2005-01-01

    Since one and a half decades ACCEL is investing in development and engineering of state of the art particle-therapy systems. A new medical superconducting 250 MeV proton cyclotron with special focus on the present and future beam requirements of fast scanning treatment systems has been designed. The first new ACCEL medical proton cyclotron is under commissioning at PSI for their PROSCAN proton therapy facility having undergone successful factory tests especially of the closed loop cryomagnetic system. The second cyclotron is part of ACCEL's integrated proton therapy system for Europe's first clinical center, RPTC in Munich. The cyclotron, the energy selection system, the beamline as well as the four gantries and patient positioners have been installed. The scanning system and major parts of the control software have already been tested. We will report on the concept of ACCEL's superconducting cyclotron driven scanning proton therapy systems and the current status of the commissioning work at PSI and RPTC

  19. Cyclotron for industrial production of radioisotopes: relevants characteristics

    International Nuclear Information System (INIS)

    Lima, Wanderley de

    1997-01-01

    The industrial production of radioisotopes requests cyclotrons with easy maintenance services, high productivity and low operation costs. To obtain this performance the experts on the have achieved excellent results, taking advantage of modern resources in calculation and modeling. Only by the maximum exploitation of the azimutal variation of the magnetic field, a physical concept introduced in 1967 with the isocronous cyclotrons, it was possible to construct cyclotrons with only 30% of the electrical consumption required by the former cyclotrons. On the other hand, the acceleration of negative ions enable the 100% accelerated beam utilization, without internal energy dissipation, obtaining beam intensities up to 1mA in continuous running which represents an increased factor of 15. Other construction parameters were optimized aiming at reliability and reduction in the components activation. Concerning energy consumption and the beam intensity supplied, a present cyclotron with 30 MeV and 300μA of protons current is 15 times more efficient than its precedent. (author). 6 refs., 1 fig., 2 tabs

  20. 1984-85 ISN progress report

    International Nuclear Information System (INIS)

    1985-01-01

    This progress report ISN 1984-1985 deals with the following subjects: nuclear physics theory, peripheral and intermediate energy physics, characteristics of reaction mechanisms in heavy ion collisions, nuclear structure, fundamental interactions, experimental methods and new instrumentation, some interdisciplinary research activities and technical activities, the SARA cyclotron and finally, technology transfer and valorisation [fr

  1. Present situation of 'baby cyclotron'

    International Nuclear Information System (INIS)

    Yamada, Teruo

    1981-01-01

    A ''baby cyclotron'' has been developed by the Japan Steel Works, Ltd. Its No. 1 model (proton 9.4 MeV) was delivered to the Nakano Hospital of National Sanatorium in March, 1979. It is being used successfully for the production of 11 C, 13 N and 15 O and labeled compounds. The proton or deuteron particles accelerated in the cyclotron collide on target materials. The target box, which is automatically changeable, is directly installed to the accelerating box, thereby taking the safety measures for any leaking radiation. The following matters are described: the production of short-lived radioisotopes (RI yields and treatment); the processes of production in the Nakano Hospital, with No. 1 baby cyclotron, including the photosynthesis of labeled compounds such as 11 C-labeled glucose; the research on the automation in the synthesis of organic labeled compounds like 11 C-palmitic acid. (J.P.N.)

  2. Cryogenic system for VECC K500 superconducting cyclotron

    CERN Document Server

    Pal, G; Bhattacharyya, T K; Bhandari, R K

    2009-01-01

    VEC Centre, Kolkata in India is at an advanced stage of commissioning a K500 superconducting cyclotron. The superconducting coil of the magnet for cyclotron is cooled by liquid helium. Three liquid helium cooled cryopanels, placed inside the Dees of the radiofrequency system, maintain the vacuum in the acceleration region of the superconducting cyclotron. The cryogenic system for magnet for cyclotron has been tested by cooling the coil and energizing the magnet. The cryogenic system for cryopanels has also been tested. Heater and temperature sensor were placed on the liquid helium cold head for cryopanel. The temperature of the cold head was observed to be below 20 K upto a heat load of 11.7 watt.

  3. Variable-Energy Cyclotron for Proton Therapy Application

    CERN Document Server

    Alenitsky, Yu G; Vorozhtsov, A S; Glazov, A A; Mytsyn, G V; Molokanov, A G; Onishchenko, L M

    2004-01-01

    The requirements to characteristics of the beams used for proton therapy are considered. The operation and proposed cyclotrons for proton therapy are briefly described. The technical decisions of creation of the cyclotron with energy variation in the range 70-230 MeV and with current up to 100 nA are estimated. Taking into account the fact, that the size and cost of the cyclotron are approximately determined by the maximum proton energy, it is realistically offered to limit the maximum proton energy to 190 MeV and to elaborate a cyclotron project with a warm winding of the magnet for acceleration of H^{-} ions. The energy of the extracted protons for each run is determined by a stripped target radius in the vacuum chamber of the accelerator, and the radiation dose field for the patient is created by the external devices using the developed techniques.

  4. Radiation exposure to workers at cyclotron facilities

    International Nuclear Information System (INIS)

    Ribeiro, M.S.; Sanches, M.P.; Sanchez, A.S.; Rodrigues, D.L.

    2001-01-01

    Radiopharmaceuticals quickly furnish the information doctors need to establish a precise diagnosis of the patient's condition, and therefore to prescribe the most effective therapy. In cancerology, F18-FDG, the most widely used PET imaging tracer, excels in the early detection of cancer tumors, even very tiny ones, which it locates and clearly distinguishes from healthy surrounding tissues. IPEN-CNEN/SP has two cyclotron accelerators used mainly for radioisotope production to be utilized in nuclear medicine for diagnosis and therapy. The first is a CV-28 cyclotron, variable energy that came into operation in 1982, which was used to produce F18-FDG and Iodine 123 up to 1998. The second, a Cyclone 30 cyclotron, 30 MeV, commenced operation in 1998 for certification purpose, and due to increase demand for radiopharmaceuticals in Brazil, started F18-FDG production in 1999. Cyclotron Laboratory will be a reference Research and Developing Center in our country and will help the Brazilian and Latin-American community. It is necessary to have an adequate database to allow regular follow up and analysis of the individual dose distributions for each group involved in the cyclotron activities. These databases are also important means to assess the effectiveness of efforts in order to maintain doses ALARA and reduce inequalities. The official individual occupational dosimetry is provided by certified Laboratory of Thermoluminescent Dosimetry at IPEN-CNEN/SP. This paper describes the occupational doses distribution in Laboratory of Cyclotrons at IPEN-CNEN/SP from January, 1998 to July, 2000 and propose improvements for the future. (author)

  5. Neutron field inside a PET Cyclotron vault room

    International Nuclear Information System (INIS)

    Vega C, H.R.; Mendez, R.; Iniguez, M.P.; Climent, J.M.; Penuelas, I.; Barquero, R.

    2006-01-01

    The neutron field around a Positron Emission Tomography cyclotron was investigated during 18 F radioisotope production with an 18 MeV proton beam. In this study the Ion Beam Application cyclotron, model Cyclone 18/9, was utilized. Measurements were carried out with a Bonner sphere neutron spectrometer with pairs of thermoluminescent dosemeters (TLD600 and TLD700) as thermal neutron detector. The TLDs readouts were utilized to unfold the neutron spectra at three different positions inside the cyclotron's vault room. With the spectra the Ambient dose equivalent was calculated. Neutron spectra unfolding were performed with the BUNKIUT code and the UTA4 response matrix. Neutron spectra were also determined by Monte Carlo calculations using a detailed model of cyclotron and vault room. (Author)

  6. Ramifide resonators for cyclotrons

    International Nuclear Information System (INIS)

    Smirnov, Yu.V.

    2000-01-01

    The resonators with the conductors ramified form for cyclotrons are systematized and separated into the self-contained class - the ramified resonators for cyclotrons (Carr). The ramified resonators are compared with the quarter-wave and half-wave nonramified resonators, accomplished from the transmitting lines fragments. The CRR are classified into two types: ones with the additional structural element, switched in parallel and in series. The CRR may include several additional structural elements. The CRR calculations may be concluded by analytical methods - the method of matrix calculation or the method of telegraph equations and numerical methods - by means of the ISFEL3D, MAFIA and other programs [ru

  7. Status Report on Cyclotron Operation

    International Nuclear Information System (INIS)

    Kovacs, P.; Szuecs, I.; Ander, I.; Lakatos, T.; Tarkanyi, F.

    2004-01-01

    Complete text of publication follows. The operation of the cyclotron in 2004 was concentrated to the usual 9 months; January, July and August were reserved for maintenance and holidays. The overall working time of the accelerator was 3554 hours, the time used for systematic maintenance was 450 hours. The breakdown periods amounted to 70 hours last year, included in it a 50 hours repair of RF control module under guarantee. The cyclotron was available for users during 3034 hours. The effectively used beam-on-target time statistics is summarized in Table 1. Developments: A new measuring site with a HPGe detector based gamma spectrometer is under installation in the basement of the Cyclotron Laboratory. A two channel pneumatic rabbit system is also under development to enable fast transport of samples between the new measuring site and two irradiation sites (the low intensity fast neutron irradiation site and the beam line used for Thin Layer Activation). (author)

  8. Cyclotron-based neutron source for BNCT

    Energy Technology Data Exchange (ETDEWEB)

    Mitsumoto, T.; Yajima, S.; Tsutsui, H.; Ogasawara, T.; Fujita, K. [Sumitomo Heavy Industries, Ltd (Japan); Tanaka, H.; Sakurai, Y.; Maruhashi, A. [Kyoto University Research Reactor Institute (Japan)

    2013-04-19

    Kyoto University Research Reactor Institute (KURRI) and Sumitomo Heavy Industries, Ltd. (SHI) have developed a cyclotron-based neutron source for Boron Neutron Capture Therapy (BNCT). It was installed at KURRI in Osaka prefecture. The neutron source consists of a proton cyclotron named HM-30, a beam transport system and an irradiation and treatment system. In the cyclotron, H- ions are accelerated and extracted as 30 MeV proton beams of 1 mA. The proton beams is transported to the neutron production target made by a beryllium plate. Emitted neutrons are moderated by lead, iron, aluminum and calcium fluoride. The aperture diameter of neutron collimator is in the range from 100 mm to 250 mm. The peak neutron flux in the water phantom is 1.8 Multiplication-Sign 109 neutrons/cm{sup 2}/sec at 20 mm from the surface at 1 mA proton beam. The neutron source have been stably operated for 3 years with 30 kW proton beam. Various pre-clinical tests including animal tests have been done by using the cyclotron-based neutron source with {sup 10}B-p-Borono-phenylalanine. Clinical trials of malignant brain tumors will be started in this year.

  9. Radioisotope production with a medical cyclotron

    International Nuclear Information System (INIS)

    Silvester, D.J.

    1974-01-01

    The cyclotron of Hammersmith hospital in England was completed and started the operation in 1955. The feature is in its design operable at high beam current, reaching 500μA in internal beam and 300μA in external beam. In 1960's, twelve nuclides of radioactive pharmaceuticals were produced with the cyclotron. C-11, N-13 and O-15 have been used in the form of radioactive gases such as CO or H 2 O to test lung functions. F-18 has been used for bone scanning. K-43 is employed in the research of electrolyte balancing together with Na-24 and Br-77. Fe-52 is utilized in iron ion researches as a tracer. Cs-129 is highly evaluated as an isotope for imaging cardiac clogging part. Radioisotopes must be much more used in the examination of in vivo metabolic function. For this purpose, peculiarly labelled compounds should be further developed. It is welcome that the persons paying attention to the medical prospect of cyclotrons are increasing. The author hopes to continue his endeavour to find new products made with the cyclotron for human welfare. (Wakatsuki, Y.)

  10. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Diego O Andrey

    Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  11. NORTICA - a new code for cyclotron analysis

    International Nuclear Information System (INIS)

    Gorelov, D.; Johnson, D.; Marti, F.

    2001-01-01

    The new package NORTICA (Numerical ORbit Tracking In Cyclotrons with Analysis) of computer codes for beam dynamics simulations is under development at NSCL. The package was started as a replacement for the code MONSTER developed in the laboratory in the past. The new codes are capable of beam dynamics simulations in both CCF (Coupled Cyclotron Facility) accelerators, the K500 and K1200 superconducting cyclotrons. The general purpose of this package is assisting in setting and tuning the cyclotrons taking into account the main field and extraction channel imperfections. The computer platform for the package is Alpha Station with UNIX operating system and X-Windows graphic interface. A multiple programming language approach was used in order to combine the reliability of the numerical algorithms developed over the long period of time in the laboratory and the friendliness of modern style user interface. This paper describes the capability and features of the codes in the present state

  12. NORTICA—a new code for cyclotron analysis

    Science.gov (United States)

    Gorelov, D.; Johnson, D.; Marti, F.

    2001-12-01

    The new package NORTICA (Numerical ORbit Tracking In Cyclotrons with Analysis) of computer codes for beam dynamics simulations is under development at NSCL. The package was started as a replacement for the code MONSTER [1] developed in the laboratory in the past. The new codes are capable of beam dynamics simulations in both CCF (Coupled Cyclotron Facility) accelerators, the K500 and K1200 superconducting cyclotrons. The general purpose of this package is assisting in setting and tuning the cyclotrons taking into account the main field and extraction channel imperfections. The computer platform for the package is Alpha Station with UNIX operating system and X-Windows graphic interface. A multiple programming language approach was used in order to combine the reliability of the numerical algorithms developed over the long period of time in the laboratory and the friendliness of modern style user interface. This paper describes the capability and features of the codes in the present state.

  13. Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia

    Directory of Open Access Journals (Sweden)

    Tjitske F. Lawerman

    2017-12-01

    Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced

  14. Survey on radionuclide producing using cyclotron method in Malaysia

    International Nuclear Information System (INIS)

    Mohd Fadli Mohammad Noh

    2008-01-01

    This research discuss about basic design and systems of medical cyclotron that Malaysia currently have, its applications in radionuclide production and upcoming technologies of cyclotron. Surveys have been carried out on cyclotron facilities at Hospital Putrajaya and Wijaya International Medical Center, WIMC as well as reactor facility at Malaysia Nuclear Agency. The sources in this research also involves on-line and library searches. Information obtained are recorded, categorized, synthesized and discussed. systems of cyclotron of Hospital Putrajaya are further discussed in details. Based from the surveys carried out, it is found out that cyclotron facilities both in Hospital Putrajaya and WIMC only produce ( 18 F)FDG with radioactivity of 18 F produced in 2007 are 16479 mCi and 92546 mCi respectively. Survey also revealed that radioisotope production at Nuclear Malaysia has had its operation been ceased. A new radiopharmaceutical, namely CHOL is suggested to be synthesized by both facilities as a new PET tracer. Latest developments concerning technologies of cyclotron as well as other accelerators such as laser for future medical accelerator, prospect of boron neutron capture and the potential of hadron therapy in Malaysia are discussed here. Radioisotope production in Malaysia is expected to keep booming in future due to increase in usage of PET techniques and the construction of more compact, easy to handle and less costly cyclotrons. (author)

  15. Considerations, measurements and logistics associated with low-energy cyclotron decommissioning

    International Nuclear Information System (INIS)

    Sunderland, J. J.; Erdahl, C. E.; Bender, B. R.; Sensoy, L.; Watkins, G. L.

    2012-01-01

    The University of Iowa’s 20-year-old 17 MeV Scanditronix cyclotron underwent decommissioning in the summer of 2011. To satisfy local, state and federal regulations defining removal, transportation and long-term safe and environmentally secure disposal of the 22 ton activated cyclotron, a series of nuclear spectroscopic measurements were performed to characterize the nature and extent of proton and neutron activation of the 22-ton cyclotron, its associated targets, and the concrete wall that was demolished to remove the old cyclotron. Neutron activation of the concrete wall was minimal and below exempt concentrations resulting in standard landfill disposal. The cyclotron assessment revealed the expected array of short and medium-lived radionuclides. Subsequent calculations suggest that meaningful levels residual activity will have decayed virtually to background after 15 years, with the total residual activity of the entire cyclotron dropping below 37 MBq (1 mCi).

  16. Development of an ion guide coupled to an on-line isotope separation system on Sara. Identification and study of isospin exotic nuclei at Isolde and Sara

    International Nuclear Information System (INIS)

    Bouldjedri, A.

    1992-06-01

    This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements

  17. Development of baby cyclotron for PET in Korea

    International Nuclear Information System (INIS)

    Chai, J.S.; Kim, Y.S.; Hu, J.Y.; Shin, Y.C.; Yoon, M.H.

    2001-01-01

    Development of a 13 MeV cyclotron for Positron Emission Tomography (PET) has been in progress since April 1999 at the Korea Cancer Center Hospital (KCCH). The study has been carried out in a joint collaboration between KCCH and the Pohang University of Science and Technology (POSTECH). Increasing desire for an uninterrupted, reliable and timely supply of the isotopes to customers has prompted obtaining a dedicated 5-13 MeV cyclotron for PET applications and pursuing the purchase of another 30MeV medical cyclotron in the very near future. A decision has been made to design the PET cyclotron in Korea. This will not only ease the problems associated with maintenance during operation but also keep the door open for continuous upgrading of the machine in the future

  18. An experimental study on cyclotron-Cherenkov radiation

    Energy Technology Data Exchange (ETDEWEB)

    Lee, C Y; Masuzaki, M; Yoshida, H; Toyosugi, N; Kamada, K; Ando, R [Kanazawa Univ. (Japan). Department of Physics

    1997-12-31

    Dielectric-loaded cylindrical waveguide configurations with an injected electron beam in which the growth rate of the cyclotron-Cherenkov instability surpasses that of the Cherenkov instability were sought by numerical treatment, and one configuration of this kind was found. This configuration consists of a metallic core and an outer metallic cylinder with a dielectric liner on the inner surface. Based on the calculations, an experimental device was designed and assembled to investigate experimentally radiation due to the cyclotron-Cherenkov instability. Beam propagation in the dielectric-loaded coaxial waveguide and microwave radiation due to the cyclotron-Cherenkov instability and the Cherenkov instability were studied. (author). 6 figs., 10 refs.

  19. Cyclotron Development and Technical Aspects on Accelerator Based Laboratory Development

    International Nuclear Information System (INIS)

    Sunarhadijoso

    2000-01-01

    BATAN is planning to establish an accelerator-based laboratory at P3TM Yogyakarta as an effort in the development and use of accelerator technology for improving industrial performance and public welfare. This paper reviews several aspects of cyclotron technology and describes the combination of a linear accelerator - cyclotron system as an alternative to be considered in the planing of the laboratory. The progress of cyclotron technology is discussed covering three generations, i.e. conventional cyclotron, synchrocyclotron and AVF cyclotron generations. The planning should not consider the accelerator application for radioisotope production because it is established in Serpong with the existing negative ion cyclotron. The proposed facility at P3TM may comprise two linear accelerators coupled with a positive ion cyclotron of synchrocyclotron generation. In fact, the attachment of the synchrocyclotron unit is flexible and it can be installed subsequently if the higher energy particle beam, which can not be produced by the linear accelerators, is extremely needed. Some technical aspects related to ion beam application, building construction and infrastructure, human resources, and specification of function test are discussed for additional information in the implementation of the planning. (author)

  20. Cyclotrons in developing countries

    International Nuclear Information System (INIS)

    Vera Ruiz, Hernan

    2004-01-01

    Cyclotron accelerators are prolific sources of charged particle for the production of radionuclides and have become an essential tool in the practice of modern nuclear medicine by providing reliable radiotracers for SPECT and PET studies. In a recent survey conducted by the IAEA in 2001, the growth in the number of cyclotron facilities installed in laboratories and hospitals in developed as well as developing countries was recorded. This trend, which started in the late 70's, continues in the present time also and all indications are that it will continue in the next five to ten years. The reasons for this growth are several: technology involved has become more user or 'hospital friendly', third party reimbursement for several clinical studies based on F-18 PET radiopharmaceuticals at least in some of the advanced countries started in 1998 and above all, the clear irrefutable and demonstrable conclusion of the positive cost/benefit outcomes of PET studies in the field of oncology to a lesser degree, thus far, for cardiology and neurology. It is however recognizable that the overall financial cost of the technology, which comprises the premises to house the facility, the cyclotron accelerator, the corresponding radiochemistry and quality control equipment and the PET cameras can be nevertheless an expensive proposition that requires careful advance planning. This fact is even more relevant when the facility is planned for installation in a developing country, which, frequently, in addition to having a lack of sufficient financial resources, do have shortage of qualified human resources to efficiently run the facility. In spite of the above, it is fact that more and more public as well as private organizations in the developing countries are setting up cyclotron/PET programmes or are seriously considering the installation of such a facility

  1. Suppression of cyclotron instability in Electron Cyclotron Resonance ion sources by two-frequency heating

    International Nuclear Information System (INIS)

    Skalyga, V.; Izotov, I.; Mansfeld, D.; Kalvas, T.; Koivisto, H.; Komppula, J.; Kronholm, R.; Laulainen, J.; Tarvainen, O.

    2015-01-01

    Multiple frequency heating is one of the most effective techniques to improve the performance of Electron Cyclotron Resonance (ECR) ion sources. The method increases the beam current and average charge state of the extracted ions and enhances the temporal stability of the ion beams. It is demonstrated in this paper that the stabilizing effect of two-frequency heating is connected with the suppression of electron cyclotron instability. Experimental data show that the interaction between the secondary microwave radiation and the hot electron component of ECR ion source plasmas plays a crucial role in mitigation of the instabilities

  2. Initial operation of the cyclotron CYTRACK

    International Nuclear Information System (INIS)

    Denisov, Yu.N.; Dolya, S.N.; Kalinichenko, V.V.; Karamysheva, G.A.; Kostromin, S.A.; Fedorenko, S.B.

    2005-01-01

    The industrial cyclotron CYTRACK is dedicated to produce the track membranes. It is the basic instrument for the industry of membrane products to be consumed in medicine, biotechnology, pharmacology, microelectronics and many other industries. Cyclotron CYTRACK started working in August 2002. Argon ions were accelerated to the project energy - 2.4 MeV/nucleon, the extracted beam intensity was about 200 nA, the extraction efficiency totaled ∼50%

  3. Operational experience and recent developments at the National Medical Cyclotron, Sydney

    International Nuclear Information System (INIS)

    Conard, E.M.; Arnott, D.W.

    1996-01-01

    The National Medical Cyclotron, Sydney, Australia commenced operation in mid 1991, with a mission to provide PET and SPECT radionuclides throughout Australia. The realization of the present production capacity has been synonymous with the development of the facility's industrial cyclotron (IBA Cyclone 30). The choice of cyclotron was based on the Cyclone 30's virtues as a compact, user-friendly, energy efficient cyclotron, offering the beam quality characteristic of negative ion technology. Development of the cyclotron has improved reliability and increased beam capacity, while improvements to targetry have increased production reliability. More recently, the installation and commissioning of a new solid target irradiation facility has provided much needed redundancy. This paper describes the major cyclotron and targetry developments carried out to date. (orig.)

  4. Manufacturing on the radiopharmaceuticals produced by cyclotron

    International Nuclear Information System (INIS)

    Ueda, Nobuo

    1994-01-01

    Radiopharmaceutical (RP) produced by cyclotrons are widely used for the in vivo diagnosis of various diseases such as cancer, cerebral vascular disorders and cardiac diseases. The nuclides used as RPs and their nuclear reactions, and the quantity of RPs supplied in Japan in the last five years are shown. These RPs are delivered to about 1,100 hospitals in Japan. Thallium-201 and iodine-123 showed very high growth rate. Recently, two new I-123 RPs, BMIPP and MIBG which are heart-imaging agents, have been supplied. It suggests that the quantity of I-123 will increase much more in future. The image diagnostic method using RPs is called in vivo nuclear medicine, and has become the indispensable means for medical institutions together with X-ray CT, nuclear magnetic resonance imaging and ultrasonic diagnosis. The RPs for in vivo diagnosis generally used at present are classified into those labeled with the RIs produced with cyclotrons and those labeled with Tc-99m formed by the decay of Mo-99. The quantity being used is overwhelmingly more in the latter, but the former shows the tendency of growth. The commercial production of cyclotron RIs for medical use, the chemical forms and the diagnostic purposes of the RPs using cyclotron RIs, and the state of use of the cyclotron-produced RPs are reported. (K.I.)

  5. Electron cyclotron emission measurements during 28 GHz electron cyclotron resonance heating in Wendelstein WVII-A stellarator

    International Nuclear Information System (INIS)

    Hartfuss, H.J.; Gasparino, U.; Tutter, M.; Brakel, R.; Cattanei, G.; Dorst, D.; Elsner, A.; Engelhardt, K.; Erckmann, V.; Grieger, G.; Grigull, P.; Hacker, H.; Jaeckel, H.; Jaenicke, R.; Junker, J.; Kick, M.; Kroiss, H.; Kuehner, G.; Maassberg, H.; Mahn, C.; Mueller, G.; Ohlendorf, W.; Rau, F.; Renner, H.; Ringler, H.; Sardei, F.; Weller, A.; Wobig, H.; Wuersching, E.; Zippe, M.; Kasparek, W.; Mueller, G.A.; Raeuchle, E.; Schueller, P.G.; Schwoerer, K.; Thumm, M.

    1987-11-01

    Electron cyclotron emission measurements have been carried out on electron cyclotron resonance heated plasmas in the WENDELSTEIN VII-A Stellarator. Blackbody radiation from the thermalized plasma main body as well as radiation from a small amount of weakly relativistic suprathermal electrons has been detected. In addition sideband emission has been observed near the second harmonic of the heating line source. Harmonic generation and parametric wave decay at the upper hybrid layer may be a reasonable explanation. (orig.)

  6. SAPHIRE technical reference manual: IRRAS/SARA Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.

    1993-01-01

    This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix

  7. [Cyclotron based nuclear science

    International Nuclear Information System (INIS)

    1989-06-01

    This report contains papers on the following topics: Heavy ion reactors, nuclear structure and fundamental interactions; atomic and materials studies; nuclear theory; and superconducting cyclotron and instrumentation

  8. A new generation of medical cyclotrons for the 90's

    International Nuclear Information System (INIS)

    Milton, B.F.

    1995-08-01

    Cyclotrons continue to be efficient accelerators for use in radio-isotope production. In recent years, developments in accelerator technology have greatly increased the practical beam current in these machines while also improving the overall system reliability. These developments combined with the development of new isotopes for medicine and industry, and a retiring of older machines indicates a strong future for commercial cyclotrons. In this paper the authors will survey recent developments in the areas of cyclotron technology as they relate to the new generation of commercial cyclotrons. Existing and potential markets for these cyclotrons will be presented. They will also discuss the possibility of systems capable of extracted energies up to 150 MeV and extracted beam currents of up to 2.0 mA

  9. A new generation of medical cyclotrons for the 90's

    International Nuclear Information System (INIS)

    Milton, B.F.

    1995-08-01

    Cyclotrons continue to be efficient accelerators for use in radio-isotope production. In recent years, developments in accelerator technology have greatly increased the practical beam current in these machines while also improving the overall system reliability. These developments combined with the development of new isotopes for medicine and industry, and a retiring of older machines indicates a strong future for commercial cyclotrons. In this paper we will survey recent developments in the areas of cyclotron technology as they relate to the new generation of commercial cyclotrons. Existing and potential markets for these cyclotrons will be presented. We will also discuss the possibility of systems capable of extracted energies up to 150 MeV and extracted beam currents of up to 2.0 mA. (author)

  10. A small low energy cyclotron for radioisotope measurements

    International Nuclear Information System (INIS)

    Bertsche, K.J.

    1989-11-01

    Direct detection of 14 C by accelerator mass spectrometry has proved to be a much more sensitive method for radiocarbon dating than the decay counting method invented earlier by Libby. A small cyclotron (the ''cyclotrino'') was proposed for direct detection of radiocarbon in 1980. This combined the suppression of background through the use of negative ions, which had been used effectively in tandem accelerators, with the high intrinsic mass resolution of a cyclotron. Development of a small electrostatically-focused cyclotron for use as a mass spectrometer was previously reported but the sensitivity needed for detection of 14 C at natural abundance was not achieved. The major contributions of this work are the integration of a high current external ion source with a small flat-field, electrostatically-focused cyclotron to comprise a system capable of measuring 14 C at natural levels, and the analysis of ion motion in such a cyclotron, including a detailed analysis of phase bunching and its effect on mass resolution. A high current cesium sputter negative ion source generates a beam of carbon ions which is pre-separated with a Wien filter and is transported to the cyclotron via a series of electrostatic lenses. Beam is injected radially into the cyclotron using electrostatic deflectors and an electrostatic mirror. Axial focusing is entirely electrostatic. A microchannel plate detector is used with a phase-grated output. In its present form the system is capable of improving the sensitivity of detecting 14 C in some biomedical experiments by a factor of 10 4 . Modifications are discussed which could bring about an additional factor of 100 in sensitivity, which is important for archaeological and geological applications. Possibilities for measurements of other isotopes, such as 3 H, and 10 Be, and 26 Al, are discussed. 70 refs

  11. U-2g0 cyclotron operational experience and improvement

    International Nuclear Information System (INIS)

    Gigal, B.N.; Gul'bekyan, G.G.; Kozlov, S.I.; Oganesyan, R.Ts.

    1983-01-01

    Brief description of main syste's of the U-200 isochronous 2-m cyclotron put into opera ion in 1968 is given and its operational characteristics a e presented. The cyclotron is used for conducting inve tigations in the field of nuclear physics. Ions from d uterium to argon have been accelerated in the cyclotro'. Annual time of target irradiation constitutes 2000-4000. The specific features of the cyclotron are: high l vel of a magnetic field (of about 20 kOe), possibili y of acceleration of ions with different mass-to-charge ratio a low correcting winding power, simple and high-e fective beam extraction by the method of charge exchange on a thin target allowing to vary smoothly energy of extracted ons. An experience in the U-200 cyclotron development and o eration is used as the basis for designing and choosing basic parameters of the U-200P, U-250, U-400 heavy ion cyclotrons

  12. Electron-Cyclotron Waves

    NARCIS (Netherlands)

    Westerhof, E.

    1994-01-01

    The essential elements of the theory of electron cyclotron waves are reviewed, The two main electro-magnetic modes of propagation are identified and their dispersion and absorption properties are discussed. The importance of the use of the relativistic resonance condition is stressed.

  13. Development of HM12 cyclotron for PET

    International Nuclear Information System (INIS)

    Morita, Takuzo; Kawama, Tetsuo; Fujii, Kazuo

    2000-01-01

    In Japan, there are at present more than 30 PET (Positron Emission Tomography) facilities. The movements of medical insurance application to the PET diagnosis using [ 18 F] FDG (2-[ 18 F]-fluoro-2-deoxy-glucose) by the Ministry of Health and Welfare are being enhanced by PET related people. Therefore, more clinical centers using PET system are expected to be built in the near future. HM12 cyclotron was developed to meet such market demands for PET, and the prototype machine has been rent to Cyclotron Radio Isotope Center (CYRIC) of Tohoku University since Oct. 1998 for their use of clinical research with positron emitters like 11 C, 13 N, 15 O and 18 F. We got many technical data of HM12 Cyclotron on the clinical base. The data was enough to establish the reliability of HM12 system operation under the clinical condition. The first commercial product of HM12 Cyclotron was delivered to National Cancer Center in March 2000. The final performance test will be finished by the end of June 2000. (author)

  14. Lower-hybrid absorption at the ion cyclotron harmonics

    International Nuclear Information System (INIS)

    Puri, S.

    1975-01-01

    In the presence of magnetic field gradients, the lower-hybrid wave can be absorbed through linear collisionless damping at the location of cyclotron or cyclotron harmonic resonances acting as singular turning points in the path of the advancing wave-front. (Auth.)

  15. SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-04-01

    The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

  16. Escribiendo el silencio: la contemplación poética de Sara Pujol

    Directory of Open Access Journals (Sweden)

    Gala, Candelas

    2005-06-01

    Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.

  17. Stability and nonlinear dynamics of gyrotrons at cyclotron harmonics

    International Nuclear Information System (INIS)

    Saraph, G.P.; Nusinovich, G.S.; Antonsen, T.M. Jr.; Levush, B.

    1992-01-01

    Gyrotrons operating at higher harmonics of the cyclotron frequency can overcome the frequency limitations caused by achievable strength of the magnetic field. However, the excitation of modes at the fundamental frequency exhibit a major problem for stable operation of harmonic gyrotron at high power with high efficiency. Therefore the issues of stability of gyrotron operation at the cyclotron harmonics and nonlinear dynamics of mode interaction are of great importance. The results of the authors stability analysis and multimode simulation are presented here. A detailed nonlinear theory of steady state single mode operation at cyclotron harmonics has been presented previously, taking into account beam-wave coupling and nonlinear gain function at cyclotron harmonics. A set of equations describing low gain regime interaction of modes resonant at different cyclotron harmonics was studied before. The multifrequency time-dependent nonlinear analysis presented here is based on previous gyrotron studies and beam-wave interaction at cyclotron harmonics. The authors have determined the parameter space for stable single mode operation at the second harmonic. The nonlinear dynamics of mode evolution and mode interaction for a harmonic gyrotron is presented. A new nonlinear effect in which the parasite at the fundamental harmonic helps excite the operating mode at the second harmonic has been demonstrated

  18. A mobile superconducting cyclotron for PET and neutron radiography

    International Nuclear Information System (INIS)

    Griffiths, R.

    1988-01-01

    The report addresses the development of a mobile superconducting cyclotron for PET (positron emission tomography) and neutron radiography. Proposals for an ultralight cyclotron were made by Finlan et al., who suggested a novel technique of utilising a superconducting magnet with RF acceleration and iron sectors contained within the room temperature bore of the magnet. Detailed design of a cyclotron based on this concept has progressed well at Oxford Instruments. The main design priorities were to minimise the weight and power consumption of the cyclotron. The cyclotron required a large amount of shielding to reduce either radiation background levels or stray magnetic field. Thus low background levels of radiation and magnetic field are key design criteria. The superconducting magnet has a mean field of 2.35 Tesla and a room temperature bore diameter of 500 mm. Three pairs of profiled iron sectors placed in the center of the warm bore of the magnet provide an azimuthally varying magnetic field. This permits the use of high beam currents with low background. A novel technique is incorporated to reduce the stray magnetic field and radiation from the cyclotron. The RF system consists of three pairs of resonators mounted within the warm bore of the magnet between the iron sectors. (Nogami, K.)

  19. Fabrication of beam diagnostic components for Superconducting Cyclotron at Kolkata

    International Nuclear Information System (INIS)

    Roy, S.; Bhattacharya, S.; Das, T.; Bhattacharyya, T.K.; Pal, S.; Pal, G.; Mallik, C.; Bhandari, R.K.

    2009-01-01

    The viewer probe and main probe are used for determining the position and current of charged particles as it is accelerated inside the superconducting cyclotron. The viewer probe is used to visually observe the shape of the charged particle beam inside the cyclotron with the help of a borescope. The main probe measures the distribution of charged particles. The viewer probe and main probe are bellow sealed. They can be positioned with an accuracy of 0.5 mm at different radii within the superconducting cyclotron. M9 slit is placed after the exit flange of the cyclotron. It determines the position of the beam leaving the cyclotron. The beam line has slits, faraday cup, beam viewers, collimators, etc. for beam diagnostics. This paper presents the mechanical design and details of beam diagnostic components. (author)

  20. Neutron radiography by using JSW baby cyclotron

    International Nuclear Information System (INIS)

    Toda, Yojiro

    1995-01-01

    At present, JSW baby cyclotrons are mostly used for the production of the radioisotopes for medical use. The attempt to use this baby cyclotron for neutron radiography began already in 1981. The feasibility of the neutron radiography for the explosives in metallic cases which are used for H1 rockets was investigated. In 1983, it was shown that the neutron radiography by using the baby cyclotron in Muroran Works, Japan Steel Works, Ltd. was able to be carried out as a routine work. Since then, the nondestructive inspection by neutron radiography has been performed for rocket pyrotechnic articles, and contributed to heighten their reliability. Further, the radiography by using fast neutrons was developed and put to practical use for recent large H2 rockets. The JSW baby cyclotron BC 168 which has been used for neutron radiography can accelerate 16 MeV protons or 8 MeV deuterons up to 50 μA. The principle of thermal neutron radiography is the generation of fast neutrons by irradiating a Be target with the proton beam accelerated by a baby cyclotron, the moderation of the fast neutrons, the formation of the thermal neutron flux of uniform distribution with a collimator, the thermal neutron flux hitting the Gd plate in a film cassette through an object, and the exposure of an X-ray film to electrons from the Gd plate. Fast neutron radiography apparatus, and commercial neutron radiography are described. (K.I.)

  1. MC-50 AVF cyclotron operation

    Energy Technology Data Exchange (ETDEWEB)

    Chae, Jong Seo; Lee, Dong Hoon; Kim, You Seok; Park, Chan Won; Lee, Yong Min; Hong, Sung Seok; Lee, Min Yong

    1995-12-01

    The first cyclotron in Korea, MC-59 cyclotron is used for neutron irradiation, radionuclide development, production and material and biomedical research. 50.5MeV and 35MeV proton beam have been extracted with 20-70 .mu.A. A total of beam extraction time are 1095.7 hours. 206.5 hours are used for the developments and 663.8 hours are for radionuclide production and development and 225.4 hours for application researches. The shutdown days are 23days. Fundamental data for failure decrement and efficient beam extraction were composed and maintenance technologies were developed. (author). 8 tabs., 17 figs., 10 refs.

  2. MC-50 AVF cyclotron operation

    International Nuclear Information System (INIS)

    Kim, Yu Seok; Chai, Jong Seo; Bak, Seong Ki; Park, Chan Won; Jo, Young Ho; Hong, Seong Seok; Lee, Min Yong; Jang Ho Ha

    2000-01-01

    The first cyclotron in Korea, MC-50 cyclotron is used for neutron irradiation, radionuclide development, production and material and biomedical research. 50.5MeV and 35MeV proton beam have been extracted with 20-60μA. A total of beam extraction time are 1095.7 hours. 206.5 hours are used for the developments and 663.8 hours are for radionuclide production and development and 225.4 hours for application researches. The shutdown days are 23 days. Fundamental data for failure decrement and efficient beam extraction were composed and maintenance technologies were developed

  3. MC-50 AVF cyclotron operation

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Yu Seok; Chai, Jong Seo; Bak, Seong Ki; Park, Chan Won; Jo, Young Ho; Hong, Seong Seok; Lee, Min Yong; Jang Ho Ha

    2000-01-01

    The first cyclotron in Korea, MC-50 cyclotron is used for neutron irradiation, radionuclide development, production and material and biomedical research. 50.5MeV and 35MeV proton beam have been extracted with 20-60{mu}A. A total of beam extraction time are 1095.7 hours. 206.5 hours are used for the developments and 663.8 hours are for radionuclide production and development and 225.4 hours for application researches. The shutdown days are 23 days. Fundamental data for failure decrement and efficient beam extraction were composed and maintenance technologies were developed.

  4. MC-50 AVF cyclotron operation

    International Nuclear Information System (INIS)

    Chae, Jong Seo; Lee, Dong Hoon; Kim, You Seok; Park, Chan Won; Lee, Yong Min; Hong, Sung Seok; Lee, Min Yong.

    1995-12-01

    The first cyclotron in Korea, MC-59 cyclotron is used for neutron irradiation, radionuclide development, production and material and biomedical research. 50.5MeV and 35MeV proton beam have been extracted with 20-70 .mu.A. A total of beam extraction time are 1095.7 hours. 206.5 hours are used for the developments and 663.8 hours are for radionuclide production and development and 225.4 hours for application researches. The shutdown days are 23days. Fundamental data for failure decrement and efficient beam extraction were composed and maintenance technologies were developed. (author). 8 tabs., 17 figs., 10 refs

  5. Building 211 cyclotron characterization survey report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-30

    The Building 211 Cyclotron Characterization Survey includes an assessment of the radioactive and chemical inventory of materials stored within the facility; an evaluation of the relative distribution of accelerator-produced activation products within various cyclotron components and adjacent structures; measurement of the radiation fields throughout the facility; measurement and assessment of internal and external radioactive surface contamination on various equipment, facility structures, and air-handling systems; and an assessment of lead (Pb) paint and asbestos hazards within the facility.

  6. Cyclotron beam dynamic simulations in MATLAB

    International Nuclear Information System (INIS)

    Karamysheva, G.A.; Karamyshev, O.V.; Lepkina, O.E.

    2008-01-01

    MATLAB is useful for beam dynamic simulations in cyclotrons. Programming in an easy-to-use environment permits creation of models in a short space of time. Advanced graphical tools of MATLAB give good visualization features to created models. The beam dynamic modeling results with an example of two different cyclotron designs are presented. Programming with MATLAB opens wide possibilities of the development of the complex program, able to perform complete block of calculations for the design of the accelerators

  7. Magnet design and test of positron emission tomography cyclotron

    International Nuclear Information System (INIS)

    Wei Tao; Yang Guojun; He Xiaozhong; Pang Jian; Zhao Liangchao; Zhang Kaizhi

    2012-01-01

    An 11 MeV H - compact cyclotron used for medical radioactive isotope production is under construction in Institute of Fluid Physics, CAEP. The cyclotron magnet adopts the design of small valley gaps and coulee structure which can provide high average magnetic field and strong focus ability. To achieve 5 × 10 -4 measuring accuracy, a magnetic field mapping system has been developed. After iterative correction using field measurement data, the total phase excursion of the cyclotron is within ± 9° and the first harmonic is less than 10 -3 T, which are all acceptable. Furthermore, the beam testing declares the successful construction of the cyclotron magnet. Besides, some magnetic field influence factors were discussed, including the magnetic field distortion and measurement error. (authors)

  8. Studies of electron cyclotron emission on text

    International Nuclear Information System (INIS)

    Gandy, R.F.

    1990-07-01

    The Auburn University electron cyclotron emission (ECE) system has made many significant contributions to the TEXT experimental program during the past five years. Contributions include electron temperature information used in the following areas of study: electron cyclotron heating (ECH), pellet injection, and impurity/energy transport. Details of the role which the Auburn ECE system has played will now be discussed

  9. Cyclotrons for the production of radioactive beams

    International Nuclear Information System (INIS)

    Clark, D.J.

    1990-01-01

    This paper describes the characteristics and design choices for modern cyclotrons. Cyclotrons can be used in 3 areas in the radioactive beam field: the production of high energy heavy ion beams for use in fragmentation, the spallation of targets with high energy protons, and the acceleration of radioactive beams from low energy to the MeV/u range. 16 refs., 6 figs

  10. Wave fronts of electromagnetic cyclotron harmonic waves

    International Nuclear Information System (INIS)

    Ohnuma, T.; Watanabe, T.

    1982-01-01

    In an inhomogeneous high-density magnetized plasma, the spatial properties of the wave fronts and ray trajectories of electromagnetic ordinary and extraordinary cyclotron harmonic waves are investigated. Those waves which are radiated from a local source are found to have wave fronts which are almost parallel to the magnetic field. Also, the reflective properties of the electromagnetic cyclotron harmonic waves are confirmed

  11. JSW's baby cyclotron

    International Nuclear Information System (INIS)

    Toda, Y.; Kaneda, Y.; Satoh, Y.; Suzukawa, I.; Yamada, T.

    1983-01-01

    Designed by The Japan Steel Works, Ltd., specially for installation in a hospital's medical department and nuclear research laboratory, '' JSW BABY CYCLOTRON '' has been developed to produce short-lived radioisotopes such as 11C, 13N, 15O and 18F. JSW's Baby Cyclotron has some design features. 1) Fixed energy and four sector azimuthally varying field. 2) Compact figure desired for hospital's nuclear medical department 3) A bitter type magnet yoke shielding activity 4) Simple control and operation 5) Easy maintenance without skilled personnel. Type BC105 (P:10MeV, d:5MeV), BC107 (P:10MeV, d:7MeV), BC168 (P:16MeV, d:8MeV) and BC1710 (P:17MeV, d:10MeV) are available according to required amount of radioisotopes. In our radioisotope production test, yield and purity of 11C, 13N, 15O and 18F are usable to clinical diagnosis

  12. Cyclotron produced radiopharmaceuticals

    International Nuclear Information System (INIS)

    Kopicka, K.; Fiser, M.; Hradilek, P.; Hanc, P.; Lebeda, O.

    2003-01-01

    Some of the cyclotron-produced radionuclides may serve as important materials for the production of radiopharmaceuticals. This lecture deals with basic information relating to various aspects of these compounds. In comparison with radionuclides /compounds used for non-medical purposes, radiopharmaceuticals are subject to a broader scale of regulations, both from the safety and efficacy point of view; besides that, there are both radioactive and medical aspects that must be taken into account for any radiopharmaceutical. According to the regulations and in compliance with general rules of work with radioactivity, radiopharmaceuticals should only be prepared/manufactured under special conditions, using special areas and special equipment and applying special procedures (e.g. sterilisation, disinfection, aseptic work). Also, there are special procedures for cleaning and maintenance. Sometimes the requirements for the product safety clash with those for the safety of the personnel; several examples of solutions pertaining to these cases are given in the lecture. Also, the specific role of cyclotron radiopharmaceuticals is discussed. (author)

  13. Os suínos da raça Bísara – oportunidades e desafios

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...

  14. Emergency situation in a medical cyclotron facility

    International Nuclear Information System (INIS)

    Kumar, Rajeev; Bhat, M.K.; Singh, D.K.; Pthania, B.S.; Pandit, A.G.; Jacob, M.J.

    2010-01-01

    Full text: Medical cyclotron is a particle accelerator used in producing short lived radioisotopes such as 18 F, 11 C, 15 O, 13 N, 18 F-2 gas etc. Positron Emission Tomography (PET) is a nuclear imaging modality that has rapidly gained favour. 18 F-FDG is the most widely used radiopharmaceutical with a half-life of 109.8 min. Having more than five years experience in this field we face lots of emergency conditions in the medical cyclotron facility. On the basis of harm we have divided in to three categories i.e. Harm of (a) working personnel, (b) Equipment and (c) environment. Radioactive gas leak and Target foil rupture is considered as the major emergency situations during medical cyclotron operations because there is a potential of over exposure to the working personnel. Radiation protection survey of a self-shielded medical cyclotron installation was carried out during normal and emergency conditions. It is found that the induced activity in the target foil increases with its successive usages. Recommendations have also been made to reduce personal exposure while handling the radioactive gas leak and target foil rupture conditions

  15. Status report on the cyclotron

    International Nuclear Information System (INIS)

    Kormany, Z.

    2002-01-01

    Complete text of publication follows. The operation of the cyclotron in 2001 was again concentrated to the usual 9 months; January, July and August were reserved for maintenance and holidays. The overall working time of the accelerator was 4300 hours, the breakdown periods amounted to 66 hours last year. The cyclotron was available for users during 3751 hours, the effectively used beam-on-target time is summarized in Table 1. The total time required for machine setup and beam tuning or spent waiting for the start of an irradiation was 272 hours. The control of the adjustable collimators applied in the beam transport system of the cyclotron was renewed during the winter maintenance period. They have been connected to the programmable logic controllers (PLC) and their new control code frees the operators from the long and slow manual setting process. The successful renewal of the control of this and other subsystems (cyclotron and beam transport power supplies) made lots of adjusting and measuring elements on the original control desk needless. To provide more space for the control PCs and remove all unnecessary devices, the unused part of the control desk has been dismantled. The short beam line used mainly for radiation hardness studies was equipped with a new oil-diffusion vacuum system during the summer maintenance. Its components are also connected to the PLC and the same automatic control has been provided like for the other vacuum stands of- the beam transport system. Another short beam line - basically a mirror image of the first one - has also been installed and successfully tested by trial irradiations. (R.P.)

  16. Statistical fluctuations in cooperative cyclotron radiation

    Science.gov (United States)

    Anishchenko, S. V.; Baryshevsky, V. G.

    2018-01-01

    Shot noise is the cause of statistical fluctuations in cooperative cyclotron radiation generated by an ensemble of electrons oscillating in magnetic field. Autophasing time - the time required for the cooperative cyclotron radiation power to peak - is the critical parameter characterizing the dynamics of electron-oscillators interacting via the radiation field. It is shown that premodulation of charged particles leads to a considerable narrowing of the autophasing time distribution function for which the analytic expression is obtained. When the number of particles Ne exceeds a certain value that depends on the degree to which the particles have been premodulated, the relative root-mean-square deviation (RMSD) of the autophasing time δT changes from a logarithmic dependence on Ne (δT ∼ 1 / lnNe) to square-root (δT ∼ 1 /√{Ne }). A slight energy spread (∼4%) results in a twofold drop of the maximum attainable power of cooperative cyclotron radiation.

  17. Decommissioning analyzis of a university cyclotron

    International Nuclear Information System (INIS)

    Eggermont, G.X.; Buls, N.; Hermanne, A.

    1996-01-01

    In the widespread use of some medical nuclear facilities, such as cyclotrons for isotope production, Life cycle analyzis, including decommissioning, was not taken into account. The structural materials of an accelerator and the concrete shielding of the bunker are activated by neutrons. This could yield a considerable volume of nuclear waste and needs radiation protection concern for occupational workers and the environment during some decennia. At the university of Brussels (WB) a prospective radiation protection and waste analyzis is being made for the later decommissioning of their cyclotron. Only few similar studies have been published. In Belgium future nuclear dismantling operations will be submitted to a radiation protection authorization procedure. Meanwhile the nuclear waste authorities insist on dismantling planning, including financial provisioning. An optimization exercise was made at the VUB-cyclotron, taking into account international trends to clearance levels for low level nuclear waste. Conceptual prevention opportunities e.g. selective material choice could be identified for future accelerator constructions. (author)

  18. Cyclotron resonance cooling by strong laser field

    International Nuclear Information System (INIS)

    Tagcuhi, Toshihiro; Mima, Kunioka

    1995-01-01

    Reduction of energy spread of electron beam is very important to increase a total output radiation power in free electron lasers. Although several cooling systems of particle beams such as a stochastic cooling are successfully operated in the accelerator physics, these cooling mechanisms are very slow and they are only applicable to high energy charged particle beams of ring accelerators. We propose here a new concept of laser cooling system by means of cyclotron resonance. Electrons being in cyclotron motion under a strong magnetic field can resonate with circular polarized electromagnetic field, and the resonance take place selectively depending on the velocity of the electrons. If cyclotron frequency of electrons is equal to the frequency of the electromagnetic field, they absorb the electromagnetic field energy strongly, but the other electrons remain unchanged. The absorbed energy will be converted to transverse kinetic energy, and the energy will be dumped into the radiation energy through bremastrahlung. To build a cooling system, we must use two laser beams, where one of them is counter-propagating and the other is co-propagating with electron beam. When the frequency of the counter-propagating laser is tuned with the cyclotron frequency of fast electrons and the co-propagating laser is tuned with the cyclotron frequency of slow electrons, the energy of two groups will approach and the cooling will be achieved. We solve relativistic motions of electrons with relativistic radiation dumping force, and estimate the cooling rate of this mechanism. We will report optimum parameters for the electron beam cooling system for free electron lasers

  19. Ion source and injection line for high intensity medical cyclotron

    Science.gov (United States)

    Jia, XianLu; Guan, Fengping; Yao, Hongjuan; Zhang, TianJue; Yang, Jianjun; Song, Guofang; Ge, Tao; Qin, Jiuchang

    2014-02-01

    A 14 MeV high intensity compact cyclotron, CYCIAE-14, was built at China Institute of Atomic Energy (CIAE). An injection system based on the external H- ion source was used on CYCIAE-14 so as to provide high intensity beam, while most positron emission tomography cyclotrons adopt internal ion source. A beam intensity of 100 μA/14 MeV was extracted from the cyclotron with a small multi-cusp H- ion source (CIAE-CH-I type) and a short injection line, which the H- ion source of 3 mA/25 keV H- beam with emittance of 0.3π mm mrad and the injection line of with only 1.2 m from the extraction of ion source to the medial plane of the cyclotron. To increase the extracted beam intensity of the cyclotron, a new ion source (CIAE-CH-II type) of 9.1 mA was used, with maximum of 500 μA was achieved from the cyclotron. The design and test results of the ion source and injection line optimized for high intensity acceleration will be given in this paper.

  20. Cyclotron will not survive yet this year without state support

    International Nuclear Information System (INIS)

    Marcan, P.

    2005-01-01

    In this paper the project of the Cyclotron Center of the Slovak republic is described. On the basis of this project the state joint-stock company Biont was constituted. Small cyclotron is in operation; big cyclotron is in process of manufacture and it will be put in operation in 2007. Small cyclotron will be used for production of radiopharmaceuticals. Positron emission tomograph (PET) in Oncological Institute of St. Elizabeth (in Bratislava) and gamma camera in Central Military Hospital (in Ruzomberok) are constituents of the Biont. The PET will be also in Biont. The hadron therapy of ophthalmic tumors is planned. Financial plans of the Biont up to 2009 are presented

  1. The problems of high efficient extraction from the isochronous cyclotron

    International Nuclear Information System (INIS)

    Schwabe, J.

    1994-06-01

    The problem of high efficient extraction (η ≥ 50%) from isochronous cyclotrons (with the exception of the stripping method) is not completely solved up to this day. This problem is specifically important, because these cyclotrons are being also applied in the production of medical radioisotopes, labeled pharmaceuticals as well as in neutron therapy (oncology), machine industry, agriculture (plant mutagenesis), etc. The aim of the proposed topic is to solve this problem on the AIC-144 isochronous cyclotron in the INP (Institute of Nuclear Physics). Lately, a beam of 20 MeV deuterons with an efficiency of ca. 15% was extracted from this cyclotron. (author). 25 refs, 14 figs

  2. Thermal Stabilization of Cryogenic System in Superconducting Cyclotron

    International Nuclear Information System (INIS)

    Shin, Seung Jae; Kim, Kyung Min; Cho, Hyung Hee; Hong, Bong Hwan; Kang, Joon Sun; Ahn, Dong Hyun

    2011-01-01

    Radiology has some useful applications for medical purpose. For cancer therapy, the superconducting cyclotron should generate heavy ion beams. It radiates heavy ion beams to cancer patients. In order to make cyclotron system stable, the cryogenic system which makes superconducting state should work constantly. However, radiation heat transfer of cryogenic system should be considered because liquid helium's boiling point is extremely low and there is huge temperature difference between the cryogenic system and ambient temperature. Accordingly, thermal analysis should be carried out. In this paper, the numerical analysis of the cryogenic system in practical superconducting cyclotron show temperature distribution and suggest the number of coolers using ANSYS Workbench program

  3. The Cyclotron Center of the Slovak Republic

    International Nuclear Information System (INIS)

    Podhorsky, D.; Ruzicka, J.; Macasek, F.; Makaiova, I.; Saro, S.; Kristiak, J.; Fulup, M.

    2001-01-01

    The Cyclotron Center of the Slovak Republic was established at the beginning of August 1999 - within the Slovak-Office of Standards, Metrology and Testing (SOSMT), in Bratislava, Slovak Republic. It will have two cyclotrons - a large heavy and light cyclotron DC-72, which will be constructed by the Joint Institute for Nuclear Research (JINR), Dubna, Russian Federation, and a small commercial light ion cyclotron IBA 18/9. The heavy ion source of the electron resonance type (DECRS-2M) will be used for low and medium energy experiments in physics. The small electron accelerator is planned for different applications, including improving the properties of plastics, increasing the resistance of cables to fire and temperature, the sterilization of medical disposables in the CC SR. The main purpose of the Cyclotron Center of the Slovak Republic (CC SR) is to catch the present approach and trends in the area of improving of inhabitants life and health quality using the progressive technology, which is introduced by bringing into practice of the physical equipment - accelerators, producing beams of high energy particles. Experts of nuclear physics and of the related branches have no experimental basis in Slovakia, as after dissolution of the former the Czech and Slovak Federal Republic all bigger nuclear equipment were left in the Czech Republic. The Slovak Republic is one of the European countries where cancer and cardiovascular diseases have a rapidly increasing tendency (the rate of new oncological cases is approximately 20,000/year at the population of 5 million inhabitants) - early diagnostics of population is necessary to be updated urgently. The Slovak Republic use a great part of electricity (about 60 %) from its own nuclear power stations and thus it is in need of education of rising generations of experts from different nuclear fields. The Government of the Slovak republic on June 18, 1996 approved the strategic aim of building up the Cyclotron Laboratory at the

  4. A radioisotope production cyclotron designed to minimize dose

    International Nuclear Information System (INIS)

    Szlavik, F.F.; Moritz, L.E.

    1992-01-01

    This paper describes a radioisotope production cyclotron which has been designed to minimize the dose to personnel during operation and maintenance. The design incorporates lessons learned from the operation of a CP42 cyclotron and has resulted in a reduction of the dose by a factor of more than 10. (author)

  5. Cyclotron based nuclear science. Progress report, April 1, 1985-March 31, 1986

    International Nuclear Information System (INIS)

    Youngblood, D.H.

    1986-08-01

    Progress report for cyclotron based nuclear science cyclotron facility are summarized. Research is described under the headings heavy ion reactions, nuclear theory, atomic studies and activation analysis, superconducting cyclotron and instrumentation. Publications are listed

  6. Health physics aspects of the 1.5M cyclotron

    International Nuclear Information System (INIS)

    Song, W.J.; Du, H.L.; Wei, Z.Q.; Xia, X.S.; Zheng, H.Z.; Jiang, G.F.; Liu, Y.Y.

    1987-01-01

    The 1.5m cyclotron in Institute of Modern Physics, Academia Sinica had operated for about 20 years until 1984 then converted to 1.7m sector focusing cyclotron. In this period it mainly used for fast neutron physics, light ion induced nucleus reactions, radioisotope production and heavy ion reactions. The health physics performed on this cyclotron including personnel dose monitoring, area monitoring (radiation field, radioactive aerosol, surface contamination and activated components etc.), maintenance inspection, environment survey and waste disposal is presented in this paper

  7. Electromagnetic Ion Cyclotron Waves in the Helium Branch Induced by Multiple Electromagnetic Ion Cyclotron Triggered Emissions

    Science.gov (United States)

    Shoji, M.; Omura, Y.; Grison, B.; Pickett, J. S.; Dandouras, I. S.; Engebretson, M. J.

    2011-12-01

    Electromagnetic ion cyclotron (EMIC) triggered emissions with rising tones between the H+ and He+ cyclotron frequencies were found in the inner magnetosphere by the recent Cluster observations. Another type of EMIC wave with a constant frequency is occasionally observed below the He+ cyclotron frequency after the multiple EMIC triggered emissions. We performed a self-consistent hybrid simulation with a one-dimensional cylindrical magnetic flux model approximating the dipole magnetic field of the Earth's inner magnetosphere. In the presence of energetic protons with a sufficient density and temperature anisotropy, multiple EMIC triggered emissions are reproduced due to the nonlinear wave growth mechanism of rising-tone chorus emissions, and a constant frequency wave in the He+ EMIC branch is subsequently generated. Through interaction with the multiple EMIC rising-tone emissions, the velocity distribution function of the energetic protons is strongly modified. Because of the pitch angle scattering of the protons, the gradient of the distribution in velocity phase space is enhanced along the diffusion curve of the He+ branch wave, resulting in the linear growth of the EMIC wave in the He+ branch.

  8. Risk assessment of 30 MeV cyclotron facilities

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Gyo Seong; Lee, Jin Woo [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup (Korea, Republic of); Kim, Chong Yeal [Dept. of Radiation Science and Technology, Chonbuk National University, Jeonju (Korea, Republic of)

    2017-03-15

    A cyclotron is a kind of particle accelerator that produces a beam of charged particles for the production of medical, industrial, and research radioisotopes. More than 30 cyclotrons are operated in Korea to produce 18F, an FDG synthesis at hospitals. A 30-MeV cyclotron was installed at ARTI (Advanced Radiation Technology Institute, KAERI) mainly for research regarding isotope production. In this study, we analyze and estimate the items of risk such as the problems in the main components of the cyclotron, the loss of radioactive materials, the leakage of coolant, and the malfunction of utilities, fres and earthquakes. To estimate the occurrence frequency in an accident risk assessment, five levels, i.e., Almost certain, Likely, Possible, Unlikely, and Rare, are applied. The accident consequence level is classified under four grades based on the annual permissible dose for radiation workers and the public in the nuclear safety law. The analysis of the accident effect is focused on the radioactive contamination caused by radioisotope leakage and radioactive material leakage of a ventilation filter due to a free. To analyze the risks, Occupation Safety and Health Acts is applied. In addition, action plans against an accident were prepared after a deep discussion among relevant researchers. In this acts, we will search for hazard and introduce the risk assessment for the research 30-MeV cyclotron facilities of ARTI.

  9. Risk assessment of 30 MeV cyclotron facilities

    International Nuclear Information System (INIS)

    Jeong, Gyo Seong; Lee, Jin Woo; Kim, Chong Yeal

    2017-01-01

    A cyclotron is a kind of particle accelerator that produces a beam of charged particles for the production of medical, industrial, and research radioisotopes. More than 30 cyclotrons are operated in Korea to produce 18F, an FDG synthesis at hospitals. A 30-MeV cyclotron was installed at ARTI (Advanced Radiation Technology Institute, KAERI) mainly for research regarding isotope production. In this study, we analyze and estimate the items of risk such as the problems in the main components of the cyclotron, the loss of radioactive materials, the leakage of coolant, and the malfunction of utilities, fres and earthquakes. To estimate the occurrence frequency in an accident risk assessment, five levels, i.e., Almost certain, Likely, Possible, Unlikely, and Rare, are applied. The accident consequence level is classified under four grades based on the annual permissible dose for radiation workers and the public in the nuclear safety law. The analysis of the accident effect is focused on the radioactive contamination caused by radioisotope leakage and radioactive material leakage of a ventilation filter due to a free. To analyze the risks, Occupation Safety and Health Acts is applied. In addition, action plans against an accident were prepared after a deep discussion among relevant researchers. In this acts, we will search for hazard and introduce the risk assessment for the research 30-MeV cyclotron facilities of ARTI

  10. Radiation protection problems by the operation of the cyclotron facility

    International Nuclear Information System (INIS)

    Durcik, M.; Nikodemova, D.

    1998-01-01

    The Cyclotron Center in Bratislava will consist of two cyclotrons. First - cyclotron DC-72 with maximal energy of 72 MV for protons for making experiments, for teaching process, for radioisotope production as 123 I and for neutron and proton therapy. Second - compact cyclotron with maximal proton energy of 18 MeV will be used for radioisotopes production for medical diagnosis as 1 *F (fluorodeoxyglucose), 81 Rb/ 81 Kr generator. This paper deals with the radiation protection problems by the operation of tis cyclotron facility as radiation protection of workers, monitoring plan, ventilation, safety lock and limitation and radiation monitoring. For proposed and continuing practices at the accelerator facility, the following general principles have to be fulfilled: (1) practices should produce sufficient benefit to offset the radiation detriment they case (justification); (2) the magnitude of the individual doses should be kept as low as achievable (optimization of protection); (3) individual exposures are subject to dose limits and some control of risk from potential exposures (dose and risk limits)

  11. A 30 MeV H- cyclotron for isotope production

    International Nuclear Information System (INIS)

    Milton, B.F.; Dawson, R.; Erdman, K.L.

    1989-05-01

    Because of an expanding market for radioisotopes there is a need for a new generation of cyclotrons designed specifically for this purpose. TRIUMF is cooperating with a local industrial company in designing and constructing such a cyclotron. It will be a four sector H - cyclotron, exploiting the newly developed high brightness multicusp ion source. This source with H - current capability in excess of 5 mA makes feasible accelerated H - beam intensities of up to 500 μA. Beam extraction is by stripping to H + in a thin graphite foil. Extraction of two high-intensity beams, with energy variable from 15 to 30 MeV is planned. The use of an external ion source, provision of a good vacuum in the acceleration region, and the careful choice of materials for components in the median plane leads to a cyclotron that will have low activation and can be easily serviced in spite of the very high operating beam intensities. A design extension to 70 MeV using many of the design features of the 30 MeV cyclotron can be easily made. Such a machine with a good quality variable energy beam is a highly desirable source of protons for isotope production, injection into higher energy high intensity acceleration, injection into higher energy high intensity accelerators, and as an irradiation facility for ocular melanomas. Design of the 30 MeV cyclotron is well advanced and construction is in progress

  12. Ion-Beam-Excited Electrostatic Ion Cyclotron Waves

    DEFF Research Database (Denmark)

    Michelsen, Poul; Pécseli, Hans; Juul Rasmussen, Jens

    1976-01-01

    Self-excited electrostatic ion cyclotron waves were observed in an ion-beam-plasma system produced in a DP-operated Q-machine. The frequency of the waves showed the theoretically predicted variation with the magnetic field.......Self-excited electrostatic ion cyclotron waves were observed in an ion-beam-plasma system produced in a DP-operated Q-machine. The frequency of the waves showed the theoretically predicted variation with the magnetic field....

  13. Calculation of particle dynamics in CI-10 cyclotron

    International Nuclear Information System (INIS)

    Samsonov, E.V.; Karamysheva, G.A.; Vorozhtsov, S.B.

    1999-01-01

    The calculations of beam dynamic characteristics of High-Intensity Cyclotron-Injector CI-10 for deuteron beam of 15 MeV energy are presented. Analytical estimations of space charge effects are given. In order to increase the intensity of the accelerator beam some ideas about the cyclotron design modification are given too. (author)

  14. Design of RF system for CYCIAE-230 superconducting cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Yin, Zhiguo, E-mail: bitbearAT@hotmail.com; Ji, Bin; Fu, Xiaoliang; Cao, Xuelong; Zhao, Zhenlu; Zhang, Tinajue

    2017-05-11

    The CYCIAE230 is a low-current, compact superconducting cyclotron designed for proton therapy. The Radio Frequency system consists of four RF cavities and applies second harmonic to accelerate beams. The driving power for the cavity system is estimated to be approximately 150 kW. The LLRF controller is a self-made device developed and tested at low power using a small-scale cavity model. In this paper, the resonator systems of an S.C. cyclotron in history are reviewed. Contrary to those RF systems, the cavities of the CYCIAE230 cyclotron connect two opposite dees. Two high-power RF windows are included in the system. Each window carries approximately 75 kW RF power from the driver to the cavities. Thus, the RF system for the CY-CIAE230 cyclotron is operated in driven push–pull mode. The two-way amplifier-coupler-cavity systems are operated with approximately the same amount of RF power but 180° out of phase compared with each other. The design, as well as the technical advantage and limitations of this operating mode, of the CYCIAE230 cyclotron RF system is analyzed.

  15. Design of RF system for CYCIAE-230 superconducting cyclotron

    Science.gov (United States)

    Yin, Zhiguo; Ji, Bin; Fu, Xiaoliang; Cao, Xuelong; Zhao, Zhenlu; Zhang, Tinajue

    2017-05-01

    The CYCIAE230 is a low-current, compact superconducting cyclotron designed for proton therapy. The Radio Frequency system consists of four RF cavities and applies second harmonic to accelerate beams. The driving power for the cavity system is estimated to be approximately 150 kW. The LLRF controller is a self-made device developed and tested at low power using a small-scale cavity model. In this paper, the resonator systems of an S.C. cyclotron in history are reviewed. Contrary to those RF systems, the cavities of the CYCIAE230 cyclotron connect two opposite dees. Two high-power RF windows are included in the system. Each window carries approximately 75 kW RF power from the driver to the cavities. Thus, the RF system for the CY-CIAE230 cyclotron is operated in driven push-pull mode. The two-way amplifier-coupler-cavity systems are operated with approximately the same amount of RF power but 180° out of phase compared with each other. The design, as well as the technical advantage and limitations of this operating mode, of the CYCIAE230 cyclotron RF system is analyzed.

  16. Biomedical cyclotron facility

    International Nuclear Information System (INIS)

    MacDonald, N.S.; Birdsall, R.; Takahaski, J.; McConnel, L.; Wood, R.; Wakakuwa, S.

    1976-01-01

    During the fifth year of operation the mechanical performance of the cyclotron and accessory equipment was excellent. Major items put into operation were a small computer system interfaced with Ge-Li gamma spectrometer and a pneumatic-tube system for fast delivery of short-lived radionuclides. A table is presented listing the radionuclides produced

  17. Proceedings of eighth joint workshop on electron cyclotron emission and electron cyclotron resonance heating. Vol. 1

    International Nuclear Information System (INIS)

    1993-03-01

    The theory of electron cyclotron resonance phenomena is highly developed. The main theoretical tools are well established, generally accepted and able to give a satisfactory description of the main results obtained in electron cyclotron emission, absorption and current drive experiments. In this workshop some advanced theoretical and numerical tools have been presented (e.g., 3-D Fokker-Planck codes, treatment of the r.f. beam as a whole, description of non-linear and finite-beam effects) together with the proposal for new scenarios for ECE and ECA measurements (e.g., for diagnosing suprathermal populations and their radial transport). (orig.)

  18. Proceedings of eighth joint workshop on electron cyclotron emission and electron cyclotron resonance heating. Vol. 2

    International Nuclear Information System (INIS)

    1993-03-01

    The theory of electron cyclotron resonance phenomena is highly developed. The main theoretical tools are well established, generally accepted and able to give a satisfactory description of the main results obtained in electron cyclotron emission, absorption and current drive experiments. In this workshop some advanced theoretical and numerical tools have been presented (e.g., 3-D Fokker-Planck codes, treatment of the r.f. beam as a whole, description of non-linear and finite-beam effects) together with the proposal for new scenarios for ECE and ECA measurements (e.g., for diagnosing suprathermal populations and their radial transport). (orig.)

  19. Automated cyclotron tuning using beam phase measurements

    International Nuclear Information System (INIS)

    Timmer, J.H.; Roecken, H.; Stephani, T.; Baumgarten, C.; Geisler, A.

    2006-01-01

    The ACCEL K250 superconducting cyclotron is specifically designed for the use in proton therapy systems. The compact medical 250 MeV proton accelerator fulfils all present and future beam requirements for fast scanning treatment systems and is delivered as a turn key system; no operator is routinely required. During operation of the cyclotron heat dissipation of the RF system induces a small drift in iron temperature. This temperature drift slightly detunes the magnetic field and small corrections must be made. A non-destructive beam phase detector has been developed to measure and quantify the effect of a magnetic field drift. Signal calculations were made and the design of the capacitive pickup probe was optimised to cover the desired beam current range. Measurements showed a very good agreement with the calculated signals and beam phase can be measured with currents down to 3 nA. The measured phase values are used as input for a feedback loop controlling the current in the superconducting coil. The magnetic field of the cyclotron is tuned automatically and online to maintain a fixed beam phase. Extraction efficiency is thereby optimised continuously and activation of the cyclotron is minimised. The energy and position stability of the extracted beam are well within specification

  20. A visual assistance environment for cyclotron operation

    International Nuclear Information System (INIS)

    Okamura, Tetsuya; Murakami, Tohru; Agematsu, Takashi; Okumura, Susumu; Arakawa, Kazuo.

    1993-01-01

    A computer-based operation system for a cyclotron which assists inexperienced operators has been developed. Cyclotron start-up operations require dozens of adjustable parameters to be finely tuned to maximize extracted beam current. The human interfaces of the system provide a visual environment designed to enhance beam parameter adjustments. First, the mental model of operators is analyzed. It is supposed to be composed of five partial mental models: beam behavior model, feasible setting regions model, parameter sensitivity model, parameter mutual relation model, and status map model. Next, based on these models, three visual interfaces are developed, i.e., (1) Beam trajectory is rapidly calculated and graphically displayed whenever the operators change the cyclotron parameters. (2) Feasible setting regions (FSR) of the parameters that satisfy the cyclotron's beam acceptance criteria are indicated. (3) Search traces, being a historical visual map of beam current values, are superimposed on the FSRs. Finally, to evaluate system effectiveness, the search time required to reach maximum beam current conditions was measured. In addition, system operability was evaluated using written questionnaires. Results of the experiment showed that the search time to reach specific beam conditions was reduced by approximately 65% using these interfaces. The written questionnaires survey showed the operators highly evaluate system operability. (author)

  1. Radiation safety and operational health physics of hospital based medical cyclotrons

    International Nuclear Information System (INIS)

    Mukherjee, B.

    2002-01-01

    Full text: Compact, low energy, high current Medical Cyclotrons are now primarily used to produce large activities of short lived, neutron deficient, positron- emitting radioisotopes. These isotopes constitute the key ingredients of important PET (Positron Emission Tomography) radiopharmaceuticals used in diagnostic nuclear medicine. The PET-radioisotope producing Medical Cyclotrons are now increasingly installed in modern urban hospitals in many countries of the world. Modern Medical Cyclotrons run at a very high beam current (∼100-200 micro Amp) level and thereby produce intense fields of parasitic gamma rays and neutrons, causing the activation of cyclotron components, ambient air and radiation exposure to patients and members of the public. This report highlights the important operational aspects and the characteristics of the radiation fields produced by Medical Cyclotrons. The pathways of personnel radiation exposure are also analyzed. The above information constitutes the scientific basis of a sound operational health physics service, which is manifested in an effective dose reduction and an enhanced radiological safety of the Medical Cyclotron facility within the framework of ALARA

  2. Radiation shielding analysis of medical cyclotron at Radiation Medicine Centre, Parel

    International Nuclear Information System (INIS)

    Gathibandhe, M.V.; Agrawal, R.A.; Utge, C.G.

    2003-01-01

    Full text: PET (Positron Emission Tomography) is a diagnostic method to obtain 3-D functional images of the distribution of radio-nuclides introduced in the human body as tracers for specific biological processes. Tracers are produced by bombardment of different target nuclides by protons and deuterons of high energy produced in the cyclotron. A Wipro-GE medical cyclotron was installed in the basement of RMC, Parel. Shielding around the cyclotron is provided in the form of borated concrete walls of required thickness to limit dose rates to design values as per AERB criteria. The roof of the cyclotron room is made of heavy concrete. Entry in to the room is through a maze. Shielding analysis for the cyclotron room has been carried out using computer code ANISN. The maze has been analyzed using code MCNP. Based on the analysis carried out additional shielding was recommended to meet the design requirements. The paper discusses the shielding analysis carried out for the cyclotron room and the maze. Dose rate estimated at various locations are highlighted

  3. Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.

    1994-11-01

    The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)

  4. Calculation of proton beam initial orbit at cyclotron central region

    International Nuclear Information System (INIS)

    Pramudita Anggraita

    2012-01-01

    A calculation of proton beam initial orbits at cyclotron central region was carried out using Scilab 5.2.0. The calculation was done in 2 dimensions in a homogeneous magnetic field of 1.66 tesla at frequency of fourth harmonics. The positions of ion source, dees, and dummy dees follow those of GE Minitrace cyclotron, peak dee voltage 30 kV. The calculation yields result comparable to those simulated at KIRAMS-13 cyclotron. (author)

  5. The development of cyclotron radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Seung Dae; Chun, K. W.; Suh, Y. S.; Lee, J. D.; Ahn, S. H. and others

    1999-03-01

    The purpose of this project is to developthe radiopharmaceuticals and automatic synthetic unit for labelled compounds, and to establish mass production system of radiopharmaceuticals. These will contribute to the early diagnosis of the disease hard to cure. The contents of this project are as follows, the development of the radiopharmaceutical for imaging of cancer, the development of automatic synthesizer for the synthesis of radio-pharmaceuticals, the development of hormone derivatives labelled with {sup 12}'3I, the development of the radiopharmaceuticals for therapy of cancer labelled with cyclotron produced radionuclides, the development of radiopharmaceuticals for therapy of cancer labelled with cyclotron produced radionuclides, the development of radiopharmaceuticals for imaging of myocardial metabolism.

  6. The development of cyclotron radiopharmaceuticals

    International Nuclear Information System (INIS)

    Yang, Seung Dae; Chun, K. W.; Suh, Y. S.; Lee, J. D.; Ahn, S. H. and others

    1999-03-01

    The purpose of this project is to develop the radiopharmaceuticals and automatic synthetic unit for labelled compounds, and to establish mass production system of radiopharmaceuticals. These will contribute to the early diagnosis of the disease hard to cure. The contents of this project are as follows, the development of the radiopharmaceutical for imaging of cancer, the development of automatic synthesizer for the synthesis of radio-pharmaceuticals, the development of hormone derivatives labelled with 12 '3I, the development of the radiopharmaceuticals for therapy of cancer labelled with cyclotron produced radionuclides, the development of radiopharmaceuticals for therapy of cancer labelled with cyclotron produced radionuclides, the development of radiopharmaceuticals for imaging of myocardial metabolism

  7. Electromagnetic ion cyclotron waves observed near the oxygen cyclotron frequency by ISEE 1 and 2

    International Nuclear Information System (INIS)

    Fraser, B.J.; Samson, J.C.; Hu, Y.D.; McPherron, R.L.; Russell, C.T.

    1992-01-01

    Pc 2 electromagnetic ion cyclotron waves at 0.1 waves at 0.1 Hz, near the oxygen cyclotron frequency, have been observed by ISEE 1 and 2 between L = 7.6 and 5.8 on an inbound near-equatorial pass in the dusk sector. The waves occurred in a thick plasmapause of width ∼ 1.5 R E and penetrated ∼1 R E into the plasmasphere. Wave onset was accompanied by significant increases in the thermal (0-100 eV) He + and the warm (0.1-16 keV/e) O + and He + heavy ion populations. The most intense waves (8 nT) were observed in the outer plasmasphere where convection drift velocities (E x B)/B 2 were largest and the Alfven velocity was a minimum. Wave polarization is predominantly left-handed with propagation almost parallel to the ambient magnetic field, and the spectral slot and polarization reversal predicted by cold plasma propagation theory are identified in the wave data. Poynting fluxes calculated during the first 15 min of the event show wave energy propagation directions both parallel and antiparallel to the field. Computations of the experimental wave spectra during the passage through the plasmapause show that the spectral slots relate to local plasma parameters, possibly suggesting an ion cyclotron wave growth source near the spacecraft. A regular wave packet structure seen over the first 30 min of the event may be attributed to the modulation of this energy source by the Pc 5 waves seen at the same time. Overall, the results are considered an example of an electromagnetic ion cyclotron wave-particle interaction occurring during the outer plasmasphere refilling process at the time of the substorm recovery phase

  8. Heating tokamaks via the ion-cyclotron and ion-ion hybrid resonances

    International Nuclear Information System (INIS)

    Perkins, F.W.

    1977-04-01

    For the ion-ion hybrid resonance it is shown that: (1) the energy absorption occurs via a sequence of mode conversions; (2) a poloidal field component normal to the ion-ion hybrid mode conversion surface strongly influences the mode conversion process so that roughly equal electron and ion heating occurs in the present proton-deuterium experiments, while solely electron heating is predicted to prevail in deuterium-tritium reactors; (3) the ion-ion hybrid resonance suppresses toroidal eigenmodes; and (4) wave absorption in minority fundamental ion-cyclotron heating experiments will be dominated by ion-ion hybrid mode conversion absorption for minority concentrations exceeding roughly 1 percent. For the ion-cyclotron resonance, it is shown that: (1) ion-cyclotron mode conversion leads to surface electron heating; and (2) ion-cyclotron mode conversion absorption dominates fundamental ion-cyclotron absorption thereby preventing efficient ion heating

  9. Ion Cyclotron Resonance Facility (ICR)

    Data.gov (United States)

    Federal Laboratory Consortium — his facility is charged with developing and exploiting the unique capabilities of Fourier Transform Ion Cyclotron Resonance (FT-ICR) mass spectrometry, and leads the...

  10. Present status of device controls and hardware interfaces for the RCNP ring cyclotron

    International Nuclear Information System (INIS)

    Yamazaki, T.; Tamura, K.; Hosono, K.

    1994-01-01

    Since the first proton beam from the injector AVF cyclotron was injected to the ring cyclotron in 1991, the computer control system has been used for the beam acceleration of the ring cyclotron. Some device control modules have been updated, and computer configuration has been changed in 1992. Total control system performs basic facilities almost satisfactory under actual cyclotron operation. (author)

  11. Cyclotron based nuclear science: Progress report, April 1, 1987-March 31, 1988

    International Nuclear Information System (INIS)

    1988-08-01

    This report discusses experiment run on the K500 cyclotron and 88 in cyclotron at Texas AandM University. The main topics of these experiments are: Heavy ion reactions; Nuclear structure and fundamental interactions; Atomic and material science; Nuclear theory; and Superconducting cyclotron and instrumentation

  12. The PET / cyclotron facility at Putrajaya Hospital - an update

    International Nuclear Information System (INIS)

    Siti Najila Mohd Janib; Suzilawati Muhd Sarowi; Munira Shaikh Nasir; Zulkifli Mohamed Hashim

    2006-01-01

    Malaysia desire to have a cyclotron for nuclear medical use came into realisation recently with the establishment of a PET/Cyclotron Facility at Putrajaya Hospital. The testing and commissioning of the cyclotron, hot cells, QC equipment and PET/CT started on March 27, culminating in the first patient to be injected on May 10 2006. Three other patients were to be followed on May 15. The patients from both the Kuala Lumpur and Putrajaya Hospital were pre-selected by physicians from these hospitals. The 18 MeV cyclotron is capable of generating 16.4 MeV protons and 8.4 MeV deuterons. The cyclotron at Putrajaya has three targets (2 liquid and 1 gas) and is capable of producing 18 F-FDG and 18 F-DOPA. To complement this, the facility has 2 modules for FDG synthesis, 1 for F-DOPA and 1 for nucleophilic synthesis. The facility will be GMP compliant. For the first production for human use, the water-18 target was irradiated for 50 minutes at 20 mA to produce 1.3 Ci of F-18. At the end of synthesis, the activity of the FDG obtained was 600 mCi. The product was then injected to a 26-year-old female, with a suspected adenocarcinoma. (Author)

  13. Progress report on the Milan superconducting cyclotron

    International Nuclear Information System (INIS)

    Acerbi, E.; Alessandria, F.; Baccaglioni, G.; Bellomo, G.; Birattari, C.; Bosotti, A.; Broggi, F.; Cortesi, G.; DeMartinis, C.; Fabrici, E.; Ferrari, A.; Giove, D.; Giussani, A.; Giussani, W.; Michelato, P.; Pagani, C.; Rivoltella, G.; Rossi, L.; Serafini, L.; Sussetto, A.; Torri, V.; Varisco, G.; Cuttone, G.; Raia, G.; Kai, L.

    1988-01-01

    This paper reports on the construction of the K800 superconducting cyclotron at the University of Milan underway since February 1981. The delay in the construction of the new building and a defect of the weldings of the helium vessel have caused a shift in the project schedule of about two years. Currently, the cyclotron magnet and the cryogenic plant have been completed and installed. First operation of the magnet and magnetic field mapping are to begin shortly

  14. Scientific instruments, scientific progress and the cyclotron

    International Nuclear Information System (INIS)

    Baird, David; Faust, Thomas

    1990-01-01

    Philosophers speak of science in terms of theory and experiment, yet when they speak of the progress of scientific knowledge they speak in terms of theory alone. In this article it is claimed that scientific knowledge consists of, among other things, scientific instruments and instrumental techniques and not simply of some kind of justified beliefs. It is argued that one aspect of scientific progress can be characterized relatively straightforwardly - the accumulation of new scientific instruments. The development of the cyclotron is taken to illustrate this point. Eight different activities which promoted the successful completion of the cyclotron are recognised. The importance is in the machine rather than the experiments which could be run on it and the focus is on how the cyclotron came into being, not how it was subsequently used. The completed instrument is seen as a useful unit of scientific progress in its own right. (UK)

  15. Cyclotrons at the Institute of Physical and Chemical Research

    International Nuclear Information System (INIS)

    Imamura, Masashi.

    1989-01-01

    In this article the destruction by American forces, during World War II, of the Japanese cyclotrons and the subsequent construction of new cyclotrons at the Institute of Physical and Chemical Research, Japan is described. Their use for biological and medical radiation chemistry studies is summarized. (UK)

  16. Dynamic effects on cyclotron scattering in pulsar accretion columns

    International Nuclear Information System (INIS)

    Brainerd, J.J.; Meszaros, P.

    1991-01-01

    A resonant scattering model for photon reprocessing in a pulsar accretion column is presented. The accretion column is optically thin to Thomson scattering and optically thick to resonant scattering at the cyclotron frequency. Radiation from the neutron star surface propagates freely through the column until the photon energy equals the local cyclotron frequency, at which point the radiation is scattered, much of it back toward the star. The radiation pressure in this regime is insufficient to stop the infall. Some of the scattered radiation heats the stellar surface around the base of the column, which adds a softer component to the spectrum. The partial blocking by the accretion column of X-rays from the surface produces a fan beam emission pattern. X-rays above the surface cyclotron frequency freely escape and are characterized by a pencil beam. Gravitational light bending produces a pencil beam pattern of column-scattered radiation in the antipodal direction, resulting in a strongly angle-dependent cyclotron feature. 31 refs

  17. Ion cyclotron resonance heating

    International Nuclear Information System (INIS)

    Tajima, T.

    1982-01-01

    Ion cyclotron resonance heating of plasmas in tokamak and EBT configurations has been studied using 1-2/2 and 2-1/2 dimensional fully self-consistent electromagnetic particle codes. We have tested two major antenna configurations; we have also compared heating efficiencies for one and two ion species plasmas. We model a tokamak plasma with a uniform poloidal field and 1/R toroidal field on a particular q surface. Ion cyclotron waves are excited on the low field side by antennas parallel either to the poloidal direction or to the toroidal direction with different phase velocities. In 2D, minority ion heating (vsub(perpendicular)) and electron heating (vsub(parallel),vsub(perpendicular)) are observed. The exponential electron heating seems due to the decay instability. The minority heating is consistent with mode conversion of fast Alfven waves and heating by electrostatic ion cyclotron modes. Minority heating is stronger with a poloidal antenna. The strong electron heating is accompanied by toroidal current generation. In 1D, no thermal instability was observed and only strong minority heating resulted. For an EBT plasma we model it by a multiple mirror. We have tested heating efficiency with various minority concentrations, temperatures, mirror ratios, and phase velocities. In this geometry we have beach or inverse beach heating associated with the mode conversion layer perpendicular to the toroidal field. No appreciable electron heating is observed. Heating of ions is linear in time. For both tokamak and EBT slight majority heating above the collisional rate is observed due to the second harmonic heating. (author)

  18. Intelligent CAE system of CYCLONE type cyclotron main magnet and its applications

    International Nuclear Information System (INIS)

    Zhang Tianjue; Chen Yong; Fan Mingwu

    1993-01-01

    The main magnet that features the cyclotron is the most important part in a cyclotron construction. Though there are many codes devoted to solving magnetic field computation problems, the results depend on the user's skill and experience very much. To help a cyclotron magnet designer get acceptable results, an intelligent CAE system for CYCLONE type cyclotron magnet design and machining has been developed. Reasonable good results could be got even the designer with the help from an expert knowledge library installed in the program

  19. Passive cyclotron current drive for fusion plasmas

    International Nuclear Information System (INIS)

    Kernbichler, W.

    1995-01-01

    The creation of toroidal current using cyclotron radiation in a passive way is, together with the well known bootstrap current, an interesting method for stationary current drive in high-temperature fusion reactors. Here, instead of externally applied RF-waves, fish-scale like structures at the first wall help to create enough asymmetry in the self generated cyclotron radiation intensity to drive a current within the plasma. The problem of computing passive cyclotron current drive consists of actually two linked problems, which are the computation of the electron equilibrium under the presence of self-generated radiation, and the computation of the photon equilibrium in a bounded system with a distorted electron distribution. This system of integro-differential equations cannot be solved directly in an efficient way. Therefore a linearization procedure was developed to decouple both sets of equations, finally linked through a generalized local current drive efficiency. The problem of the exact accounting for the wall profile effects was reduced to the solution of a Fredholm-type integral equation of the 2 nd -kind. Based on all this an extensive computer code was developed to compute the passively driven current as well as radiation losses, radiation transport and overall efficiencies. The results therefrom give an interesting and very detailed insight into the problems related to passive cyclotron current drive

  20. Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

    Science.gov (United States)

    Godwin, Allison; Potvin, Geoff

    2017-01-01

    This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…

  1. On the coupling of cyclotron motion to ion internal degrees of freedom

    International Nuclear Information System (INIS)

    Dunbar, R.C.

    1979-01-01

    A possibility of significant coupling between gas-phase ion cyclotron motion and two internal angular momentum terms is explored. The first case, coupling with ion spin, is treated via the relativistic Hamiltonian, and found to produce only relativistic perturbations which are entirely negligible. The second case, coupling with ion rotation, is developed via its equivalence to a Stark effect. Small shifts in the cyclotron resonances frequency , ωsub(c) and the appearance of a weak cyclotron resonance at 2ωsub(c) are predicted, but these effects are negligible in general. If the cyclotron frequency is near an ion rotational transition, however, a shift of 10 -5 in cyclotron frequency may be observed, and could provide a means of investigating low-frequency rotational transitions of ions. (Auth.)

  2. ECR heavy-ion source for the LBL 88-inch cyclotron

    International Nuclear Information System (INIS)

    Clark, D.J.; Kalnins, J.G.; Lyneis, C.M.

    1983-03-01

    An Electron Cyclotron Resonance (ECR) heavy-ion source is under construction at the LBL 88-Inch Cyclotron. This source will produce very-high-charge-state heavy ions, such as 0 8 + and Ar 12 + , which will increase cyclotron energies by a factor of 2-4, up to A = 80. It is a two-stage source using room-temperature coils, a permanent-magnet sextupole, and a 6-9 GHz microwave system. Design features include adjustable first-to-second-stage plasma coupling, a variable second-stage mirror ratio, high-conductance radial pumping of the second stage, and a beam-diagnostic system. A remotely movable extraction electrode will optimize extraction efficiency. The project includes construction of a transport line and improvements to the cyclotron axial-injection system. The construction period is expected to be two years

  3. Review of Cyclotrons for the Production of Radioactive Isotopes for Medical and Industrial Applications

    Science.gov (United States)

    Schmor, Paul

    2011-02-01

    Radioactive isotopes are used in a wide range of medical, biological, environmental and industrial applications. Cyclotrons are the primary tool for producing the shorter-lived, proton-rich radioisotopes currently used in a variety of medical applications. Although the primary use of the cyclotron-produced short-lived radioisotopes is in PET/CT (positron emission tomography/computed tomography) and SPECT (single photon emission computed tomography) diagnostic medical procedures, cyclotrons are also producing longer-lived isotopes for therapeutic procedures as well as for other industrial and applied science applications. Commercial suppliers of cyclotrons are responding by providing a range of cyclotrons in the energy range of 3-70MeV for the differing needs of the various applications. These cyclotrons generally have multiple beams servicing multiple targets. This review article presents some of the applications of the radioisotopes and provides a comparison of some of the capabilities of the various current cyclotrons. The use of nuclear medicine and the number of cyclotrons supplying the needed isotopes are increasing. It is expected that there will soon be a new generation of small "tabletop" cyclotrons providing patient doses on demand.

  4. Study of axial injection of polarized protons into the grenoble cyclotron; Contribution a l'etude de l'injection axiale pour protons polarises sur le cyclotron de Grenoble

    Energy Technology Data Exchange (ETDEWEB)

    Pabot, J [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1969-07-01

    By injecting ions axially into a cyclotron, it is possible to accelerate particles (polarized particles, heavy ions, etc...) obtainable only with difficulty when an internal ion source is used. In this work, after justifying the choice of an axial injection device equipped with a 'pseudo-cylindrical' deflector for the Grenoble cyclotron, we study theoretically the principle of such a detector, the choice of its parameters, and the effect of this choice on the conditions of acceleration of the beam by the cyclotron. From the experimental point of view, this report describes two operations which made it possible to check that the chosen injection device operated satisfactorily, qualitatively initially (electron model), then quantitatively (proton model). In conclusion, we believe that the Grenoble cyclotron thus equipped will be able to provide a relatively dense beam of polarized protons. (author) [French] L'injection axiale d'ions dans un cyclotron permet d'accelerer des particules (particules polarisees, ions lourds... ) difficiles a obtenir avec une source interne d'ions. Dans ce travail, apres avoir justifie le choix d'un dispositif d'injection axiale equipe d'un deflecteur 'pseudo-cylindrique' pour le cyclotron de Grenoble, nous avons etudie, du point de vue theorique, le principe d'un tel deflecteur, le choix de ses parametres, et l'incidence de ce choix sur les conditions d'acceleration du faisceau par le cyclotron. Du point de vue experimental, ce rapport decrit deux manipulations qui ont permis de verifier le bon fonctionnement du dispositif d'injection retenu, qualitativement d'abord (modele a electrons), quantitativement ensuite (maquette a protons). En conclusion, nous estimons que le cyclotron de Grenoble ainsi equipe, peut fournir un faisceau relativement intense de protons polarises. (auteur)

  5. Operation of the Karlsruhe Isochronous Cyclotron in 1976

    International Nuclear Information System (INIS)

    Schulz, F.; Schweickert, H.

    1977-08-01

    The operation of the Karlsruhe Isochronous Cyclotron in 1976 is briefly surveyed. The status and the results of the following technical developments are briefly described: 1) Computer aided cyclotron operation; 2) New correction coils for the cyclotron; 3) Non-intercepting measurement of the extraction rate; 4) Lambshift source for polarized deuterons; 5) Improvements of the 6 Li 3+ -Penning ion source; 6) New beam line to an irradiation room for machine parts; 7) Nova 2 computer system for nuclear physics experiments; 8) Routine production of Iodine-123 for nuclear medicine. - In the annual report 1975 we have included a section consisting of a series of brief reports on applied research in progress. This year we give a compilation of the current basic nuclear physics work at our cyclotron. The short papers prepared by the experimental groups are arranged according to the following topics: 1) Experiments using the 156 MeV 6 Li 3+ -beam; 2) Experiments using the 52 MeV polarized deuteron beam; 3) Further nuclear reactions; 4) Nuclear spectroscopy; 5) Measurements of nuclear magnetic moments; 6) Measurements with the neutron time-of-flight spectrometer. (orig.) [de

  6. Directory of cyclotrons used for radionuclide production in Member States [2006 update

    International Nuclear Information System (INIS)

    2006-10-01

    The present directory of cyclotron facilities used for the production of radionuclides in Member States is an update of the one compiled by the International Atomic Energy Agency (IAEA) in late 2001 and published in 2002. This directory was prepared through information collected by questionnaires that the IAEA sent to known institutions operating cyclotrons for radionuclide production. Technical as well as administrative data supplied to the IAEA as of November 2005 were taken into account. The directory is considered to include most of the cyclotrons of the world that are used at least partially for radionuclide production. There are 262 entries for cyclotrons operating in 39 Member States of the IAEA. This is an increase of 7% over the 246 reported in the 2002 cyclotron directory. This can be compared to the 350 or so cyclotrons believed to be presently operating in the world, which are involved in some aspects of radionuclide production. The increase has been in the number of cyclotrons in developed countries, but even more so in the developing countries. The increase in number during the last four years was driven by several factors, i.e. advent of advances in medical imaging, introduction of compact, user friendly medical cyclotron, and a recent decision that costs for 15 O-oxygen position emission tomography (PET) studies in Japan and 18 F-FDG PET studies in Germany and the United States of America are eligible for reimbursement by government or health insurance companies. There is no doubt that the fastest growing segment of the market is in the commercial distribution of FDG to local hospitals. The IAEA is promoting cyclotron technology as applied to nuclear medicine. Requests for cyclotron technology is steadily increasing; many developing Member States are interested in this technology. There is need to stimulate, build and maintain consulting capability in interested developing Member States. There are good reasons to believe that the number of cyclotron

  7. Next customers to cyclotron center meanwhile are not entered

    International Nuclear Information System (INIS)

    Bato, R.; Zackova, K.

    2004-01-01

    In this paper the financial aspects of construction of the Cyclotron Centre of the Slovak Republic (CC SR) are analysed. This building represents the problems of exploitation of commodity deblocation of Russian Federation debt to Slovakia. The estimated expenses have risen from original planned 2 billion Slovak crowns to 6 billion Slovak crowns. Devices which should be part of centre - a cyclotron used for radiopharmaceuticals production for oncological purposes and a big cyclotron for industrial purposes, a centre of positron emissive tomography (PET), a laboratory of nano-technologies, a source of heavy ions - they indicates that the oncological institutes, departments of health service, of education, of economy, of defence, of environment, also Nuclear Regulatory Authority of Slovak Republic and Slovak Academy of Sciences should become the customers principally. Around 2.2 billion of Slovak crowns from deblocation have been spent for a construction of Cyclotron Centre of SR yet. The national budget has contributed by 95 million Slovak crowns; 90.5 million USD will be obtained from deblocation of Russian debt yet. IAEA has supported this centre by grant of almost 800 thousand USD. Budget of Cyclotron Centre of SR is still rising also because of rising of VAT from 10 percent to 19 percent. VAT will be paid also for goods imported within the framework of deblocation after integration of Slovak Republic to European Union; besides also 10 percent duty is paid. Project of CC SR has not passed the state expert opinion. Agreement for construction of Cyclotron Centre of SR was issued by State Health Institute of Bratislava, therefore it was confirmed also by the main hygienist of Slovak Republic

  8. Mass measurements with the CIME cyclotron at GANIL

    International Nuclear Information System (INIS)

    Hornillos, M B Gomez; Chartier, M; Mittig, W; Blank, B; Chautard, F; Demonchy, C E; Gillibert, A; Jacquot, B; Jurado, B; Lecesne, N; Lepine-Szily, A; Orr, N A; Roussel-Chomaz, P; Savajols, H; Villari, A C C

    2005-01-01

    A new direct technique using the CIME cyclotron as a high-resolution mass spectrometer is being developed in order to measure the masses of exotic nuclei. Tests have been performed to check the feasibility of the method with a mixed beam of stable ions extracted from the SPIRAL ion source and injected into the CIME cyclotron. Preliminary results obtained with this new technique are presented and discussed

  9. Improving cancer treatment with cyclotron produced radionuclides. Progress report

    Energy Technology Data Exchange (ETDEWEB)

    Larson, S.M.; Finn, R.D.

    1993-11-01

    This report describes our continuing long term goal of promoting nuclear medicine applications by improving the scientific basis for tumor diagnosis, treatment and treatment follow-up based on the use of cyclotron produced radiotracers in oncology. The program includes 3 interactive components: Radiochemistry/Cyclotron; Pharmacology; and Immunology. An essential strategy is as follows: novel radionuclides and radiotracers developed in the Radiochemistry/Cyclotron section will be employed in the Pharmacology and Immunology sections during the next year. The development of novel radionuclides and tracers is of course useful in and of itself, but their utility is greatly enhanced by the interaction with the immunology and pharmacology components of the program.

  10. Relativistic nonlinear waves of cyclotron in electron and electron-ion plasmas

    International Nuclear Information System (INIS)

    Bruno, R.

    1981-12-01

    Dispersion relations for electron-cyclotron and ion-cyclotron waves are examined in two models of plasmas, the first propagating in fluent electronic plasmas (''streaming'') as well as in fluent electron-ionic plasmas, and the last in fluent electron-ionic plasmas. The identification of the propagation modes is realized with the aid of a special technique of polinomial expantion of the dispersion relation in the limit of large frequencies and short wavelenghts. The analisys so developed on these dispersion relations for fluent plasmas show that: (i) the wave amplitudes are frequency dependent; (ii) the ''resonances'' frequencies of the respective estationary plasmas must be re-examined with the relations between wave amplitudes and the propagation frequencies near these frequencies; (iii) the electric field amplitudes for the non-linear waves of electron-cyclotron and ion-cyclotron go to zero in the limits of the respective cyclotron frequencies in both fluent plasma models. (M.W.O.) [pt

  11. Medical isotope production experience at the V.G. Khlopin Radium Institute cyclotron

    International Nuclear Information System (INIS)

    Solin, L.M.

    2000-01-01

    Radium Institute cyclotron MGC-20 is used since 1990. There are four cyclotrons of such type in Russia and four abroad: in Finland, in Hungary, in North Korea and in Egypt. The Radium institute cyclotron was used in different fields, such as radioisotope production, nuclear physics, physics and engineering. For ten years some improvements of the Radium Institute cyclotron operation have been made. Those are: creation of the automatic control system based on IBM PC, development of a new power supply for the ion source, creation of the deflector electronic protection from discharges, change of the main elements of the cyclotron with high induced radioactivity. Moreover we investigated the possibility of the negative ions acceleration at the MGC-20 cyclotron without ion source exchange. The maximum value of the proton beam current reached was about 30 μA for 10 MeV H - beam energy. To extract the proton beam from the cyclotron after the stripping foil we made an additional output beam line. It was used for determination of the horizontal and vertical emittance. A special device was constructed and used for measurements of emittance. The latter amounted 30 π mm mrad for horizontal direction and 16 π mm mrad for vertical direction

  12. Transparency of Magnetized Plasma at Cyclotron Frequency

    International Nuclear Information System (INIS)

    G. Shvets; J.S. Wurtele

    2002-03-01

    Electromagnetic radiation is strongly absorbed by a magnetized plasma if the radiation frequency equals the cyclotron frequency of plasma electrons. It is demonstrated that absorption can be completely canceled in the presence of a magnetostatic field of an undulator or a second radiation beam, resulting in plasma transparency at the cyclotron frequency. This effect is reminiscent of the electromagnetically induced transparency (EIT) of the three-level atomic systems, except that it occurs in a completely classical plasma. Unlike the atomic systems, where all the excited levels required for EIT exist in each atom, this classical EIT requires the excitation of the nonlocal plasma oscillation. The complexity of the plasma system results in an index of refraction at the cyclotron frequency that differs from unity. Lagrangian description was used to elucidate the physics and enable numerical simulation of the plasma transparency and control of group and phase velocity. This control naturally leads to applications for electromagnetic pulse compression in the plasma and electron/ion acceleration

  13. Important radiation protection aspects of the operation of a commercial medical cyclotron

    International Nuclear Information System (INIS)

    Mukherjee, B.

    1997-01-01

    Since July 1991 the Radiopharmaceutical Division of the Australian Nuclear Science and Technology Organisation (ANSTO) operates a 30 MeV H'- ion Medical Cyclotron (Model; CYCLONE 30, Manufacturer: Ion Beam Applications, Louvain La Neuve, Belgium). During routine isotope production operations at the cyclotron a thick copper substrate plate electroplated with thin layer of selected enriched target material are bombarded with 30 MeV proton beam current up to 450 μA. The nuclear reaction of protons with the copper atoms result in the reduction of prompt evaporation neutrons with a peak energy of ∼ 1.8 MeV. These evaporation neutrons slow down via multiple collisions with the concrete shielding walls of the target cave, bounce back to the,interior space of the cave activating the cyclotron parts, beam tube components and other utilities installed in the irradiation cave. After the completion of 60 hour isotope production run, gamma dose equivalent rates of ∼10 5 μSvh -1 were measured at contact with the target irradiation stations and beam collimators. Evidently, these gamma rays emitted from the activated cyclotron components impose crucial radiation exposure hazard problems for the cyclotron maintenance technicians. Experiments had been carried out in order to identify the specific pathways of cyclotron component activation and to assess the probable personnel radiation exposure during handling of the activated cyclotron parts. The cool-down (radioactive decay) of the activated cyclotron components was estimated experimentally at different target bombardment conditions using the wall mounted gamma area monitors interfaced to the Health Physics Data Acquisition System. The gamma dose equivalent rates at contact with various locations of interest at the target irradiation station and at the typical work areas of the maintenance personnel were carefully recorded with a radiation (gamma) survey instrument during the three years operation period of the cyclotron. A

  14. Potential of cyclotron based accelerators for energy production and transmutation

    Energy Technology Data Exchange (ETDEWEB)

    Stammbach, T.; Adam, S.; Fitze, H.R. [Paul Scherrer Institute, Villigen (Switzerland)] [and others

    1995-10-01

    PSI operates a 590 MeV-cyclotron facility for high intensity proton beams for the production of intense beams of pions and muons. The facility, commissioned in 1974, has been partially upgraded and is now operated routinely at a beam current of 1 mA, which corresponds to a beam power of 0.6 MW. At this current, the beam losses in the cyclotron are about 0.02%. By the end of 1995 the authors expect to have 1.5 mA of protons. Extensive theoretical investigations on beam current limitations in isochronous cyclotrons were undertaken. They show that the longitudinal space charge effects dominate. Based on their experience the authors present a preliminary design of a cyclotron scheme that could produce a 10 MW beam as a driver for an {open_quotes}energy amplifier{close_quotes} as proposed by C. Rubbia and his collaborators. The expected efficiency for the conversion of AC into beam power would be about 50% (for the RF-systems only). The beam losses in the cyclotron are expected to be a few {mu}A, leading to a tolerable activation level.

  15. Development and application of intelligent CAE system for cyclotron main magnet

    International Nuclear Information System (INIS)

    Zhang Tianjue; Chen Yong; Fan Mingwu

    1993-01-01

    The main magnet that represents the feature of the cyclotron is the most important part in a cyclotron construction. Though there are many codes devoted to solve magnetic field computation problems, the results from them are depended on user's skill and experience very much. To help cyclotron magnet designer get acceptable result an intelligent CAE system for cyclotron main magnet design and machining has been developed. A reasonable good results in design could be get even the designer is a beginner with the help from an expert knowledge library installed in the program. The codes include following functions: 1. Intelligent CAD; 2. 2D and 3D magnetic field computation; 3. Beam dynamics analysis; 4. CAM for main magnet

  16. Cyclotron-Resonance-Maser Arrays

    International Nuclear Information System (INIS)

    Kesar, A.; Lei, L.; Dikhtyar, V.; Korol, M.; Jerby, E.

    1999-01-01

    The cyclotron-resonance-maser (CRM) array [1] is a radiation source which consists of CRM elements coupled together under a common magnetic field. Each CRM-element employs a low-energy electron-beam which performs a cyclotron interaction with the local electromagnetic wave. These waves can be coupled together among the CRM elements, hence the interaction is coherently synchronized in the entire array. The implementation of the CRM-array approach may alleviate several technological difficulties which impede the development of single-beam gyro-devices. Furthermore, it proposes new features, such as the phased-array antenna incorporated in the CRM-array itself. The CRM-array studies may lead to the development of compact, high-power radiation sources operating at low-voltages. This paper introduces new conceptual schemes of CRM-arrays, and presents the progress in related theoretical and experimental studies in our laboratory. These include a multi-mode analysis of a CRM-array, and a first operation of this device with five carbon-fiber cathodes

  17. A conceptual design of high-temperature superconducting isochronous cyclotron magnet

    International Nuclear Information System (INIS)

    Jiao, F.; Tang, Y.; Li, J.; Ren, L.; Shi, J.

    2011-01-01

    A design of High-temperature superconducting (HTS) isochronous cyclotron magnet is proposed. The maximum magnetic field of cyclotron main magnet reaches 3 T. Laying the HTS coil aboard the magnetic pole will raise the availability of the magnetic Field. Super-iron structure can provide a high uniformity and high gradient magnetic field. Super-iron structure can raise the availability of the HTS materials. Along with the development of High-temperature superconducting (HTS) materials, the technology of HTS magnet is becoming increasingly important in the Cyclotron, which catches growing numbers of scholars' attentions. Based on the analysis of the problems met in the process of marrying superconducting materials with ferromagnetic materials, this article proposes a design of HTS isochronous cyclotron magnet. The process of optimization of magnet and the methods of realizing target parameters are introduced after taking finite element software as analyzing tools.

  18. Magnetic field optimisation and orbit calculation for VEC superconducting cyclotron

    International Nuclear Information System (INIS)

    Debnath, J.; Dey, M.K.; Mallik, C.; Bhandari, R.K.

    2003-01-01

    At VECC, Kolkata preparations are underway to measure the magnetic field of the cyclotron. Also once the superconducting cyclotron is assembled prediction of beam related parameters will be a very important exercise to carry out. Considering this the beam behaviour in the cyclotron will be crucial to achieve these goals. The present paper deals with the efforts in this direction and using a test beam of He 1+ 20 MeV/n the trim coil currents, the tune variation and the (r,Pr) behaviour of the central trajectory

  19. On 'conflict of conservation laws in cyclotron radiation'

    International Nuclear Information System (INIS)

    White, S.M.; Parle, A.J.

    1985-01-01

    The authors reconsider the apparent conflict of conservation laws in cyclotron radiation, and show that earlier workers in this field did not correctly include the effects of radiation reaction in their calculations. When a 'recoil' term, calculated using relativistic quantum theory, is included in the angular momentum of the particle the conflict disappears. It is found that the guiding centre of the particle drifts outwards during cyclotron radiation. (author)

  20. Channel of Axial Injection of DC-60 Cyclotron

    CERN Document Server

    Gikal, B N; Bogomolov, S L; Borisenko, A N; Borisov, O N; Gulbekyan, G G; Ivanenko, I A; Kalagin, I V; Kazacha, V I; Kazarinov, N Yu; Khabarov, M V; Lysukhin, S N; Melnikov, V N; Paschenko, S V; Tikhomirov, A V

    2006-01-01

    The design study and realization of the axial injection beam line of DC-60 cyclotron constructed at the Flerov Laboratory of Nuclear Reactions of the Joint Institute for Nuclear Research are given. The channel allows one to transport and to inject into the cyclotron ions with mass-to-charge ratio $A/Z$ being within interval A/Z=6-12 and kinetic energy up to 17 $Z/A$ keV/m.u.

  1. Goodbye Synchro-Cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1990-12-15

    On 17 December, after having seen many other physics machines come and go during its 33-year career, CERN's 600 MeV SynchroCyclotron (SC) is being shut down. Judged simply by its length (to say nothing of its quality), the research career of this machine testifies to the wisdom and imagination of the CERN pioneers who proposed it in the early 1950s.

  2. Goodbye Synchro-Cyclotron

    International Nuclear Information System (INIS)

    Anon.

    1990-01-01

    On 17 December, after having seen many other physics machines come and go during its 33-year career, CERN's 600 MeV SynchroCyclotron (SC) is being shut down. Judged simply by its length (to say nothing of its quality), the research career of this machine testifies to the wisdom and imagination of the CERN pioneers who proposed it in the early 1950s

  3. 40. anniversary of cyclotron of Institute of Nuclear Physics, Tashkent

    International Nuclear Information System (INIS)

    Umerov, R.A.; Uzakov, J.M.; Gulamov, I.R.

    2004-01-01

    Full text: The Cyclotron U-150-II of Institute of Nuclear Physics was projected in middle of the last century for nuclear-physical researches in a scientific research institute of electro physical equipment in Leningrad. The Cyclotron can accelerate positive ions with beam energy of the protons 18 MeV, deuterons 20 MeV, alpha particles 40 MeV. Intensity of a beam a little some microampere. The building of a Cyclotron represents an impressive three-floor construction in volume of 2000 m 3 . The capital equipment, the high-frequency generator, sources of power supplies, vacuum pumps and other technological units are placed on the first and socle floors of a building. The second and third floors served for accommodation of scientific laboratories. A building of a Cyclotron has three experimental halls, where it was possible to carry out physical researches. They have divided from each other, and the main thing from the accelerator, concrete walls with the purpose of reduction of the big radiating background at the working accelerator, preventing realization of experiments. It provided also biological protection of the on duty personnel. The first some years of operation of the Cyclotron have revealed a line of lacks of this machine. For example, for change of energy of a beam of a Cyclotron it took 2-3 weeks. Also, for transition of acceleration of one particles to others it take same time. Time parameters of a beam were unstable. In 1968 reconstruction of the Cyclotron has been started that has allowed to bring in basic changes to parameters U-150-II. The time took on change of an operating mode of a Cyclotron was sharply reduced, and it was possible to reduce it till 10-20 hours, to improve the energy and time resolution of a beam many times over, to reduce angular straggling of particles in a beam. And, all this enormous amount of works was spent by forces of institute. In 70 th years the big development was received with works on radiating stability of materials

  4. Intelligent CAE system of CYCLONE type cyclotron main magnet and its applications

    International Nuclear Information System (INIS)

    Zhang Tianjue; Chen Yong; Fan Mingwu

    1992-07-01

    The main magnet that represents the feature of the cyclotron is the most important part in a cyclotron construction. Though there are many codes devoted to solve magnetic field computation problems, the results from them depend on the user's skill and experience very much. To help cyclotron magnet designer to get acceptable results, an intelligent CAE (computer aided engineering) system for CYCLONE type cyclotron magnet design and machining has been developed. A reasonable good results in the design could be got even if the designer is a beginner, because of the help from an expert knowledge library installed in the program

  5. Radiation safety and quality control in the cyclotron laboratory

    International Nuclear Information System (INIS)

    Sharma, S.; Krause, G.; Ebadi, M.

    2006-01-01

    Radiation safety was determined to maintain quality control in the cyclotron laboratory. Based on the results of 438 runs in the Faraday cup (20 μA for 10 min), 20 runs on 18 O-water target (40 μA for 2 h) and 10 runs on 18 O-gas targets (30 μA for 45 min), we have established that occupationally exposed workers remain 10 ± 5 times below federal regulatory limits (FRLs) in the cyclotron vault, 30 ± 8 times below FRL in the radiochemistry laboratory and 200 ± 10 times below the FRL outside the cyclotron laboratory during beam operation. (The FRL for unrestricted area are <20 μSv in 1 h.) The non-occupationally exposed workers serving in offices in the vicinity of the cyclotron vault within 100 m distance remained 200 times below the FRL irrespective of beam being on or off, suggesting that routine beam operation of 40 μA for 2 h once a day during office hours is safe provided quality control and system performance measures as discussed in this report are strictly maintained. (authors)

  6. New irradiation facilities at the Australian national medical cyclotron

    International Nuclear Information System (INIS)

    Parcell, S.K.; Arnott, D.W.; Conard, E.M.

    1999-01-01

    Two new irradiation facilities have been developed at the National Medical Cyclotron for radionuclide production. The first relocates PET irradiations from the cyclotron vault to a dedicated PET beam room, to improve accessibility and reduce radiation exposures associated with target maintenance. This new facility consists of a beam line to transport 16-30 MeV proton beams from the cyclotron to 1 of 8 PET targets mounted on a target rack. The target rack has increased the number of targets available for production and experimentation. The second is a completely independent solid target irradiation facility for SPECT. This facility consists of a beam line to transport 26-30 MeV proton beams from the cyclotron to a dedicated beam room containing one solid target station. A new pneumatic target transfer system was also developed to transport the solid target to and from the existing chemistry hot cells. The beam line and target components are operated under the control of a dedicated PLC with a PC based user interface. The development and some technical aspects of these new irradiation facilities are discussed here. (author)

  7. Proceedings of the 12. Joint Workshop on Electron Cyclotron Emission and Electron Cyclotron Heating

    International Nuclear Information System (INIS)

    Giruzzi, Gerardo

    2003-01-01

    The 12. Joint Workshop on Electron Cyclotron Emission and Electron Cyclotron Heating was held in Aix-en-Provence (France) from 13 to 16 May 2002. The meeting was hosted by the Association Euratom-CEA sur la Fusion (CEA/Cadarache, France), with additional financial support from: - Region Provence-Alpes Cote d'Azur - The City of Aix-en-Provence - Communaute de l'Agglomeration du Pays d'Aix - Thales Electron Devices (France) - Alstom Magnets and Superconductors (France) - Spinner GmbH (Germany). The members of the local organizing committee were: G. Giruzzi, M. Lennholm, R. Magne and V. Poli, from CEA/Cadarache. The composition of the International Programme Committee was the following: M. Bornatici (Italy), A. Costley (ITER), E. de la Luna (Spain), G. Giruzzi (France), W. Kasparek (Germany), B. Lloyd (UK), J. Lohr (USA), K. Sakamoto (Japan). The subjects of the meeting were classified in four main topics: Electron Cyclotron Theory; Electron Cyclotron Emission; Electron Cyclotron Heating and Current Drive Experiments; Electron Cyclotron Technology. The results presented in these topics have been summarised in the closing session by E. Westerhof, A. Kraemer-Flecken, T. Goodman and G. Bosia, respectively. The workshop was attended by 85 participants from 18 countries, providing 10 invited talks, 30 oral presentations and 50 posters. The success of the workshop is mainly due to the amount and quality of their work and of their presentations. The generosity of the sponsors, the selection and advice work of the International Programme Committee, as well as the contribution of the chairmen and of the summary speakers should also be warmly acknowledged. The papers in this collection have been reproduced directly from the authors' manuscripts, provided either as camera-ready texts or as pdf files. The constraints on the papers lengths and formats have been kept to a minimum, on purpose. This series of workshops has now reached a good level of maturity, with well established

  8. Reading Sara Pujol Russell’s Poetry of Contemplation and Connection

    Directory of Open Access Journals (Sweden)

    Anita M. Hart

    2012-06-01

    Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.

  9. Nonlinear cyclotron-resonance accelerations by a generalized EM wave

    International Nuclear Information System (INIS)

    Akimoto, K.; Hojo, H.

    2004-01-01

    Particle accelerations by a one-dimensional, electromagnetic, dispersive pulse in an external magnetic field are investigated. It is found that the well-known cyclotron resonance may be classified into three regimes as the length and/or the amplitude of the pulse are varied. Namely, as the pulse amplitude increases, the transit-time cyclotron-resonance acceleration (CRA) evolves to phase trapping, and reflect particles. The amplitude and wave dispersion as well as the pulse length strongly affect those accelerations. The interesting phenomena of quantization of resonance velocities in between the two regimes are also investigated. This new mechanism may lead to wave amplification at some discrete frequencies other than the cyclotron frequency. (authors)

  10. ECR ion source for variable energy cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Bose, D K; Taki, G S; Nabhiraj, P Y; Pal, G; Dasgupta, B; Mallik, C; Das, S K; Bandopadhaya, D K; Bhandari, R K [Variable Energy Cyclotron Centre, Calcutta (India)

    1995-09-01

    Some performance characteristics of 6.4 GHz two stage ECR ion source which was under development at this centre is presented. The present ion source will facilitate acceleration of light heavy ions with the existing k=130 variable energy cyclotron. Multiply charged heavy ion (MCHI) beam from the source will also be utilized for atomic physics studies. Oxygen beam has already been used for ion implantation studies. The external injection system under development is nearing completion. Heavy ion beam from cyclotron is expected by end of 1995. (author).

  11. Radiation monitoring in a self-shielded cyclotron installation

    International Nuclear Information System (INIS)

    Capaccioli, L.; Gori, C.; Mazzocchi, S.; Spano, G.

    2002-01-01

    As nuclear medicine is approaching a new era with the spectacular growth of PET diagnosis, the number of medical cyclotrons installed within the major hospitals is increasing accordingly. Therefore modern medical cyclotron are highly engineered and highly reliable apparatus, characterised with reduced accelerating energies (as the major goal is the production of fluorine 18) and often self-shielded. However specific dedicated monitors are still necessary in order to assure the proper radioprotection. At the Careggi University Hospital in Florence a Mini trace 10 MeV self-shielded cyclotron produced by General Electric has been installed in 2000. In a contiguous radiochemistry laboratory, the preparation and quality control of 1 8F DG and other radiopharmaceuticals takes place. Aim of this work is the characterisation and the proper calibration of the above mentioned monitors and control devices

  12. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    OpenAIRE

    Abdullah K. Shehabat

    2016-01-01

    This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...

  13. Process of a cyclotron modeling with SNOP program

    International Nuclear Information System (INIS)

    Smirnov, V.L.

    2015-01-01

    The description of the SNOP program developed in JINR and intended for numerical modeling of a beam dynamics in accelerating setups of cyclotron type is presented. The main methods of work with program components, and also stages of numerical modeling of a cyclotron, the analysis of the main characteristics of the accelerated bunch by means of the SNOP are given. The explanation of some algorithms and procedures used in the program is given. [ru

  14. Support vector machine based fault detection approach for RFT-30 cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Kong, Young Bae, E-mail: ybkong@kaeri.re.kr; Lee, Eun Je; Hur, Min Goo; Park, Jeong Hoon; Park, Yong Dae; Yang, Seung Dae

    2016-10-21

    An RFT-30 is a 30 MeV cyclotron used for radioisotope applications and radiopharmaceutical researches. The RFT-30 cyclotron is highly complex and includes many signals for control and monitoring of the system. It is quite difficult to detect and monitor the system failure in real time. Moreover, continuous monitoring of the system is hard and time-consuming work for human operators. In this paper, we propose a support vector machine (SVM) based fault detection approach for the RFT-30 cyclotron. The proposed approach performs SVM learning with training samples to construct the classification model. To compensate the system complexity due to the large-scale accelerator, we utilize the principal component analysis (PCA) for transformation of the original data. After training procedure, the proposed approach detects the system faults in real time. We analyzed the performance of the proposed approach utilizing the experimental data of the RFT-30 cyclotron. The performance results show that the proposed SVM approach can provide an efficient way to control the cyclotron system.

  15. Power deposition for ion cyclotron heating in large tokamaks

    International Nuclear Information System (INIS)

    Hellsten, T.; Villard, L.

    1988-01-01

    The power deposition profiles during minority ion cyclotron heating are analysed in large tokamaks by using the global, toroidal wave code LION. For tokamaks with large aspect ratio and with circular cross-section, the wave is focused on the magnetic axis and can be absorbed there by cyclotron absorption when the cyclotron resonance passes through the magnetic axis. The power deposition profile is then essentially determined by the Doppler broadening of the ion cyclotron resonance. For equilibria either non-circular or with a small aspect ratio the power deposition profile depends also on the strength of the damping. In this case the power deposition profile can be expressed as a sum of two power deposition profiles. One is related to the power absorbed in a single pass, and its shape is similar to that obtained for large aspect ratio and circular cross-section. The other profile is obtained by calculating the power deposition in the limit of weak damping, in which case the wave electric field is almost constant along the cyclotron resonance layer. A heuristic formula for the power deposition is given. The formula includes a number of calibration curves and functions which has been calculated with the LION code for JET relevant equilibria. The formula enables calculation of the power deposition profile in a simple way when the launched wave spectrum and damping coefficients are known. (author). 7 refs, 11 figs

  16. Preparation and procedures of pre-commissioning on DECY-13 cyclotron

    International Nuclear Information System (INIS)

    Silakhuddin

    2016-01-01

    A preparation and procedures for pre-commissioning of DECY-13 Cyclotron have been discussed and the steps for these have been arranged. Pre-commissioning is a testing stage of individual subsystems when all subsystems have been integrated into a cyclotron system. The discussion was taken from references, the next the readiness of devices was studied and then the preparation and procedures of the pre-commissioning were arranged. The results of the discussion are that for doing the pre-commissioning of the cyclotron DECY-13 still requires the completion of RF-dee subsystem and some components for testing are still to be completed. (author)

  17. Design features and operating characteristics of the MC-50 cyclotron

    International Nuclear Information System (INIS)

    Bak, Hae Ill; Bak, Joo Shik

    1989-01-01

    The MC-50 cyclotron at Korean Cancer Center Hospital is now operational for neutron therapy and medical radioisotope production. Design features, mechanical structures and operating characteristics of the MC-50 are described in this paper. Optimum operating condition for this cyclotron has been determined by the repetitive running, and the performances of the internal beam have been investigated through the measurements of intensity and spatial distribution of the internal beam as a function of the radius of the cyclotron. Routinely, the 40 μA of 50 MeV protons have been obtained at first Faraday cup with a extraction efficiency of 61%. (Author)

  18. Use of maze in cyclotron hoppers

    International Nuclear Information System (INIS)

    Fernandes, Fernando A.; Alves, Juliano S.; Fochesatto, Cintia; Cerioli, Luciane; Borges, Joao Alfredo; Gonzalez, Delfin; Silva, Daniel C.

    2013-01-01

    Introduction: the increasing number of cyclotrons in Brazil due to constitutional amendment 49 /06 that enabled the production of radiopharmaceuticals with a short half - life by private companies. The radionuclides used for PET - CT require production centers near or within the diagnostic centers. In order to minimize maintenance and operating risks, gaining efficiency, our facility was the first in Brazil to use the access to a cyclotron bunker via maze, rather than armored door stopper type. Materials: the design calculations were based on the Monte Carlo method (MCNP5 - Monte Carlo N-Particletransportcode version 5). At the ends of the labyrinth are installed a door of polyethylene, for thermalization of neutrons, and other of wood for limiting access. Both legs of the maze have wall thickness of 100cm. In inspection Brazilian CNEN realize measures of dose rate for neutrons and gamma 9 points: 7 around the bunker, 1 over the bunker and 1 in the exhaust with the cyclotron operating with maximum load, double beam of 50uA for 2 hours. After commissioning were carried out around the bunker, the following measures: cumulative dose in three months with dosimeters for neutron rate dose with a gas proportional detector type filled with 3 He and polyethylene neutron moderator and dose rate with a Geiger - Mueller detector for gamma radiation. Readings with neutron detectors were classified as background radiation and dose rates were always below the limits established in standard EN 3.01, and the calculation of the predicted regardless of the intensity of irradiation inside the bunker. Conclusion: the use of labyrinths as a way to access the bunkers cyclotron has been shown to be effective as the radiation shielding and efficient by allowing quick and easy access, virtually eliminating the maintenance

  19. Cyclotron/PET project in Uruguay

    International Nuclear Information System (INIS)

    Engler, H.

    2006-01-01

    The Positron Computed Tomography (PET) is a tri dimensional image technique which shows biochemical information. PET is used in neurology and cardiology diseases. The National Center Cyclotron PET has been found to research, development and health science applications.

  20. Static harmonization of dynamically harmonized Fourier transform ion cyclotron resonance cell.

    Science.gov (United States)

    Zhdanova, Ekaterina; Kostyukevich, Yury; Nikolaev, Eugene

    2017-08-01

    Static harmonization in the Fourier transform ion cyclotron resonance cell improves the resolving power of the cell and prevents dephasing of the ion cloud in the case of any trajectory of the charged particle, not necessarily axisymmetric cyclotron (as opposed to dynamic harmonization). We reveal that the Fourier transform ion cyclotron resonance cell with dynamic harmonization (paracell) is proved to be statically harmonized. The volume of the statically harmonized potential distribution increases with an increase in the number of trap segments.

  1. Modern compact cyclotrons for nuclear medicine designed and manufactured in NIIEFA

    International Nuclear Information System (INIS)

    Bogdanov, P.V.; Vasilchenko, I.N.; Gavrish, Yu.N.; Galchuk, A.V.; Grigorenko, S.V.; Kuzhlev, A.N.; Menshov, Yu.D.; Mudroyubov, V.G.; Ponomarenko, V.I.; Strokach, A.P.

    2012-01-01

    A series of compact cyclotrons, the CC-12, CC-18/9 and MCC-30/15, intended for the production of radionuclides for diagnostics and therapy directly in medical institutions has been designed and manufactured in NIIEFA. These cyclotrons provide the acceleration of negative hydrogen and deuterium ions injected from external sources. Beams of accelerated particles are extracted by stripping negative ions to protons and deuterons by carbon foils. Shielding-type electromagnets with the vertically located median plane are applied in these cyclotrons.

  2. Modular beam diagnostics instrument design for Cyclotrons

    International Nuclear Information System (INIS)

    Chaddha, N.; Bhole, R.B.; Sahoo, S.; Nandy, P.P.; Pal, S.

    2012-01-01

    The Cyclotrons at VECC, Kolkata i.e. Room Temperature Cyclotron (RTC) and Superconducting Cyclotron (SCC) comprise of internal and external Beam Diagnostic systems. These systems provide the beam developer with position, intensity, beam profile, a visual impression of the size and shape of ion beam, and operational control over diagnostic components like 3-finger probe, Beam Viewer probe, Deflector probe, Faraday cup, X-Y slit, Beam viewer etc. Automation of these components was initially done using customised modules for individual sub-system. An expansion of this facility and various levels of complexity demand modular design to cater easy modification and upgradation. The overall requirements are analysed and modular cards are developed based on basic functionalities like valve operation, probe/slit/viewer control, position read-out, Interlock, aperture control of beam line and communication. A 32-bit Advanced RISC Machine (ARM) based card with embedded EPICS is chosen as the master controller and FPGA/microcontroller is used for functional modules. The paper gives a comprehensive description of all modules and their integration with the control system. (author)

  3. Technical Note: Building a combined cyclotron and MRI facility: Implications for interference

    Energy Technology Data Exchange (ETDEWEB)

    Hofman, Mark B. M.; Kuijer, Joost P. A.; Ridder, Jan Willem de; Perk, Lars R.; Verdaasdonk, Rudolf M. [Physics and Medical Technology, VU University Medical Center, Amsterdam 1007 MB (Netherlands) and BV Cyclotron VU, Amsterdam 1081HV (Netherlands)

    2013-01-15

    Purpose: With the introduction of hybrid PET/MRI systems, it has become more likely that the cyclotron and MRI systems will be located close to each other. This study considered the interference between a cyclotron and a superconducting MRI system. Methods: Interactions between cyclotrons and MRIs are theoretically considered. The main interference is expected to be the perturbation of the magnetic field in the MRI due to switching on or off the magnetic field of the cyclotron. MR imaging is distorted by a dynamic spatial gradient of an external inplane magnetic field larger than 0.5-0.04 {mu}T/m, depending on the specific MR application. From the design of a cyclotron, it is expected that the magnetic fringe field at large distances behaves as a magnetic dipolar field. This allows estimation of the full dipolar field and its spatial gradients from a single measurement. Around an 18 MeV cyclotron (Cyclone, IBA), magnetic field measurements were performed on 5 locations and compared with calculations based upon a dipolar field model. Results: At the measurement locations the estimated and measured values of the magnetic field component and its spatial gradients of the inplane component were compared, and found to agree within a factor 1.1 for the magnetic field and within a factor of 1.5 for the spatial gradients of the field. In the specific case of the 18 MeV cyclotron with a vertical magnetic field and a 3T superconducting whole body MR system, a minimum distance of 20 m has to be considered to prevent interference. Conclusions: This study showed that a dipole model is sufficiently accurate to predict the interference of a cyclotron on a MRI scanner, for site planning purposes. The cyclotron and a whole body MRI system considered in this study need to be placed more than 20 m apart, or magnetic shielding should be utilized.

  4. Computer modeling of magnetic structure for IC-35 cyclotron

    International Nuclear Information System (INIS)

    Alenitskij, Yu.G.; Morozov, N.A.

    1998-01-01

    An extensive series of calculations has been carried out in order to design the magnetic structure of the IC-35 cyclotron for radioisotope production. The calculations were carried out by 2-D POISCR code. The average magnetic field and its variation were produced with the help of two different calculation models. The parameters of the cyclotron magnetic system are presented

  5. Electron cyclotron waves, transport and instabilities in hot plasmas

    International Nuclear Information System (INIS)

    Westerhof, E.

    1987-01-01

    A number of topics relevant to the magnetic confinement approach to the thermonuclear fusion is addressed. The absorption and emission of electron cyclotron waves in a thermal plasma with a small population of supra-thermal, streaming electrons is examined and the properties of electron cyclotron waves in a plasma with a pure loss-cone distribution are studied. A report is given on the 1-D transport code simulations that were performed to assist the interpretation of the electron cyclotron heating experiments on the TFR tokamak. Transport code simulations of sawteeth discharges in the T-10 tokamak are discussed in order to compare the predictions of different models for the sawtooth oscillations with the experimental findings. 149 refs.; 69 figs.; 7 tabs

  6. The Medical Cyclotron Facility in RMC, Parel, BARC

    International Nuclear Information System (INIS)

    Gopalakrishna, Arjun; Banerjee, Sharmila

    2017-01-01

    The Medical Cyclotron Facility in Radiation Medicine Centre (RMC) is the first one of its kind, installed in 2002. "1"8F based radiotracers are produced in this facility on a routine basis for Positron Emission Tomography (PET), of in-house patients, as well as for supply to other nuclear medicine centers in Mumbai as well as Pune. The facility consists of the following sub parts - Cyclotron and support equipment; Radiochemistry synthesis laboratory; Quality control (QC) laboratory

  7. Parameters of the eigenellipsoid for separated sector cyclotrons

    International Nuclear Information System (INIS)

    Ferme, J.

    1989-01-01

    The analytical expressions of the elements of the beam matrix corresponding to the eigenellipsoid for a beam injected on an equilibrium orbit of a cyclotron are presented. The four dimensional phase space of the horizontal plane is only considered. Some restrictive hypotheses are made: there is no acceleration, and space charge effects are not taken into account. The beam matrix has been computed for the general case of spiraled sectors cyclotrons, and is valid for any given azimuth

  8. Electromagnetic Cyclotron Waves in the Solar Wind: Wind Observation and Wave Dispersion Analysis

    Science.gov (United States)

    Jian, L. K.; Moya, P. S.; Vinas, A. F.; Stevens, M.

    2016-01-01

    Wind observed long-lasting electromagnetic cyclotron waves near the proton cyclotron frequency on 11 March 2005, in the descending part of a fast wind stream. Bi-Maxwellian velocity distributions are fitted for core protons, beam protons, and alpha-particles. Using the fitted plasma parameters we conduct kinetic linear dispersion analysis and find ion cyclotron and/or firehose instabilities grow in six of 10 wave intervals. After Doppler shift, some of the waves have frequency and polarization consistent with observation, thus may be correspondence to the cyclotron waves observed.

  9. Summary of EC-17: the 17th Joint Workshop on Electron Cyclotron Emission and Electron Cyclotron Resonance Heating (Deurne, The Netherlands, 7-10 May 2012)

    NARCIS (Netherlands)

    Westerhof, E.; Austin, M. E.; Kubo, S.; Lin-Liu, Y. R.; Plaum, B.

    2013-01-01

    An overview is given of the papers presented at the 17th Joint Workshop on Electron Cyclotron Emission (ECE) and Electron Cyclotron Resonance Heating (ECRH). The meeting covered all aspects of the research field ranging from theory to enabling technologies. From the workshop, advanced control by

  10. Magnetic phenomena in F.F.A.G. cyclotrons; Phenomenes magnetiques dans les cyclotrons F.F.A.G

    Energy Technology Data Exchange (ETDEWEB)

    Beurtey, R [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1957-07-01

    This study regroups and develops some experimental and theoretical results obtained with spiral tract cyclotrons. The method used has been studied previously by C. BLOCH, whom we thank for his helpful advice. We have tried to give the main useful results, which are also in accordance with the rather scarce experimental results obtained on spiral pole pieces. (author) [French] Cette etude regroupe et developpe des resultats experimentaux et theoriques sur les cyclotrons 'spirales'. La methode employee est celle etudiee par C. BLOCH, que nous remercions vivement pour sa bienveillance et ses conseils. Nous avons essaye de donner les resultats essentiels a la fois utilisables et compatibles avec les resultats experimentaux peu nombreux sur les pieces polaires spiralees. (auteur)

  11. Nonlinear analysis of a relativistic beam-plasma cyclotron instability

    Science.gov (United States)

    Sprangle, P.; Vlahos, L.

    1986-01-01

    A self-consistent set of nonlinear and relativistic wave-particle equations are derived for a magnetized beam-plasma system interacting with electromagnetic cyclotron waves. In particular, the high-frequency cyclotron mode interacting with a streaming and gyrating electron beam within a background plasma is considered in some detail. This interaction mode may possibly find application as a high-power source of coherent short-wavelength radiation for laboratory devices. The background plasma, although passive, plays a central role in this mechanism by modifying the dielectric properties in which the magnetized electron beam propagates. For a particular choice of the transverse beam velocity (i.e., the speed of light divided by the relativistic mass factor), the interaction frequency equals the nonrelativistic electron cyclotron frequency times the relativistic mass factor. For this choice of transverse beam velocity the detrimental effects of a longitudinal beam velocity spread is virtually removed. Power conversion efficiencies in excess of 18 percent are both analytically calculated and obtained through numerical simulations of the wave-particle equations. The quality of the electron beam, degree of energy and pitch angle spread, and its effect on the beam-plasma cyclotron instability is studied.

  12. Digital control in LLRF system for CYCIAE-100 cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Yin, Zhiguo, E-mail: bitbearAT@hotmail.com; Fu, Xiaoliang; Ji, Bin; Zhang, Tianjue; Wang, Chuan

    2016-05-21

    As a driven accelerator, the CYCIAE-100 cyclotron is designed by China Institute of Atomic Energy for the Beijing Radio Ion-beam Facility project. The cyclotron RF system is designed to use two RF power sources of 100 kW to drive two half-wavelength cavities respectively. Two Dee accelerating electrodes are kept separately from each other inside the cyclotron, while their accelerating voltages are maintained in phase by the efforts of LLRF control. An analog–digital hybrid LLRF system has been developed to achieve cavity tuning control, dee voltage amplitude and phase stabilization etc. The analog subsystems designs are focused on RF signal up/down conversion, tuning control, and dee voltage regulation. The digital system provides an RF signal source, aligns the cavity phases and maintains a Finite State Machine. The digital parts combine with the analog functions to provide the LLRF control. A brief system hardware introduction will be given in this paper, followed by the review of several major characteristics of the digital control in the 100 MeV cyclotron LLRF system. The commissioning is also introduced, and most of the optimization during the process was done by changing the digital parts.

  13. New development of neutron radiography with a small cyclotron

    International Nuclear Information System (INIS)

    Ikeda, Yasushi; Ohkubo, Kohei; Kato, Toshihiko; Nakamura, Tomihisa; Fuji, Takayoshi.

    1990-01-01

    A series of neutron radiography testing has been performed for several years by using a small accelerator called 'Baby Cyclotron' manufactured by Japan Steel Works, Ltd. The Baby Cyclotron produces fast neutrons at the rate of 4x10 12 n/cm 2 s, and enables to perform neutron radiography imaging by various techniques. The most important application of this Baby Cyclotron radiography system is the non-destructive testing (NDT) of various explosive devices prepared for space launch vehicles. It is assured that thermal neutron radiography testing is a very useful means for the NDT. Also fast neutron radiography testing is in progress. The fast neutron radiography with a CR39 track-etch image recorder was developed, and it was shown to be the very useful NDT means when the thicker objects used for new H-2 launch vehicles had to be examined. Because thermal neutron radiography has the high detectability of hydrogenous materials, organic elastomers such as O-rings and explosive powder are clearly observable through the opaque steel walls of containers. The Baby Cyclotron and the neutron radiography facility, thermal neutron and fast neutron radiography testings and so on are reported. (K.I.)

  14. Calculation of the neutrons shielding in cyclotron accelerator

    International Nuclear Information System (INIS)

    Ribeiro, Martha S.; Sanches, Matias P.; Rodrigues, Demerval L.

    2000-01-01

    The objective of radioprotection in cyclotron facilities is to reduce the dose levels in the workplaces to classify them like supervised areas. In this way, the radiation dose rates in areas occupied by workers during cyclotron operations should not exceed 7,5 μSv/h. In controlled areas these levels are not observed and some rigorous controls must be exerted by administrative procedures or protection mechanisms. The Cyclotron Laboratory at IPEN-CNEN/SP has a cyclotron model Cyclone 30, 30 MeV, used for research and it is also used for radioisotopes production for medical diagnosis and therapeutical applications. Among them, 123 I, 67 Ga and 18 F can be pointed. When accelerator is operating, failures in perforations and paths that conduce to room accelerator can be occur and thus, the dose levels are higher than that established by law. For this reason, a review for shielding structure was necessary in order to optimize radiation dose. The purpose of this work was to determine the shielding thickness and adequate material to diminish the dose rates in workplaces to a value below 7,5 μSv/h. It was used a method to employ the equivalent dose value in the facility areas for neutrons fluency rate for the principal reactions in target irradiation processes. The purposed shielding for the vault doors ensures dose levels lower than established limits to supervised areas. (author)

  15. An investigation into the technical feasibility of cyclotron production of technetium-99m

    International Nuclear Information System (INIS)

    Egan, G.F.; Lagunas-Solar, M.C.

    1994-01-01

    The role of technetium-99m in nuclear medicine is well established with 80 per cent to 90 per cent of all nuclear medicine studies utilising this isotope. Technetium-99m is currently produced from nuclear reactors via production of the parent radionuclide molybdenum-99. The reactor production of 99m Tc has both significant financial and environmental costs, with unresolved problems in the areas of radioactive waste disposal and reactor decommissioning. Recent scientific publications have indicated that medical quality 99m Tc may be produced using cyclotrons without having the associated problems of waste disposal and decommissioning. Further scientific research is now required to demonstrate the feasibility of this cyclotron production technique. A collaboration between the Cyclotron and PET Centre, Austin Hospital, the National Medical Cyclotron, ANSTO, Sydney, and the Crocker Nuclear Laboratory, University of California, Davis, USA has been proposed. The general objective of the proposed collaboration is to acquire additional scientific data to evaluate the 99m Tc cyclotron production method and to determine the feasibility of cyclotron technology for Australian nuclear medicine. 16 refs., 2 tabs

  16. First results of beam generation test for JAERI AVF cyclotron

    International Nuclear Information System (INIS)

    Tachikawa, T.; Hayashi, Y.; Ishii, K.

    1992-01-01

    The performance of JAERI AVF cyclotron was investigated with several kinds of ions in the wide energy range. The 90 MeV protons of 10 μA intensity was successfully extracted for the first time by the model 930 cyclotron. The feature of beam chopping system is also presented. (author)

  17. Optimisation of the radiation shielding of medical cyclotrons using a genetic algorithm

    International Nuclear Information System (INIS)

    Mukherjee, Bhaskar

    2000-01-01

    Effective radiation shielding is imperative for safe operation of modern Medical Cyclotrons producing large activities of short-lived radioisotopes on a commercial basis. The optimal cyclotron shielding design demands a careful balance between the radiological, economical and often the sociopolitical factors. One is required to optimize the cost of radiation protection and the cost of radiological-health detriment. The cost of radiation protection depends explicitly on a) the nature of the radiation field produced by the cyclotron, b) the cyclotron operation condition, c) the cost of shielding material, d) the level of dose reduction, e) the projected net revenue from the sale of the radioisotopes, and f) the depreciation rate of the cyclotron facility. The Genetic Algorithm (GA) is used for a cost -benefit analysis of this problem. The GA is a mathematical technique that emulates the Darwinian Evolution paradigm. It is ideally suited to search for a global optimum in a large multi-dimensional solution space, having demonstrated strength compared to the classical analytical methods. Furthermore the GA method runs on a PC in a Windows environment. This paper highlights an interactive spreadsheet macro program for the cost benefit analysis of the optimize Medical Cyclotron shielding using a GA search engine. (author)

  18. Study of axial injection of polarized protons into the grenoble cyclotron

    International Nuclear Information System (INIS)

    Pabot, J.

    1969-01-01

    By injecting ions axially into a cyclotron, it is possible to accelerate particles (polarized particles, heavy ions, etc...) obtainable only with difficulty when an internal ion source is used. In this work, after justifying the choice of an axial injection device equipped with a 'pseudo-cylindrical' deflector for the Grenoble cyclotron, we study theoretically the principle of such a detector, the choice of its parameters, and the effect of this choice on the conditions of acceleration of the beam by the cyclotron. From the experimental point of view, this report describes two operations which made it possible to check that the chosen injection device operated satisfactorily, qualitatively initially (electron model), then quantitatively (proton model). In conclusion, we believe that the Grenoble cyclotron thus equipped will be able to provide a relatively dense beam of polarized protons. (author) [fr

  19. Atmospheric tracer study of the emissions from the University of Michigan Cyclotron/PET Facility

    International Nuclear Information System (INIS)

    Scofield, P.A.

    1986-01-01

    The University of Michigan (U of M) Cyclotron/Positron Emission Tomography (PET) facility consists of a cyclotron (Model CS-30, The Cyclotron Corporation), radiochemistry laboratory, and Pet scanner. Accelerator-produced radioactive materials, such as, carbon-11 and oxygen-15 are typically emitted from the Cyclotron/PET facility through short stacks located on the roof. This project studied the dispersion of emissions from the facility within the medical complex. To achieve this purpose, the research project had three phases: a physical modeling study; a preliminary field smoke release study; and, a field study using a tracer gas to simulate emission dispersion from the U of M Cyclotron/PET facility vault stack. The objective was to determine normalized concentrations, under selected wind directions and speeds, for use in establishing radionuclide concentrations at the air intakes of the Cyclotron/PET facility and surrounding buildings and at selected ground-level locations

  20. Damage by the Great East Japan Earthquake and current status of the Sendai cyclotron

    International Nuclear Information System (INIS)

    Wakui, Takashi; Itoh, Masatoshi; Shimada, Kenzi; Yoshida, Hidetomo; Shinozuka, Tsutomu; Sakemi, Yasuhiro

    2012-01-01

    The Great East Japan Earthquake has inflicted damages on the accelerator facility of the Cyclotron and Radioisotope Center (CYRIC), Tohoku University. The K=110 MeV cyclotron was slanted due to the damage of props supporting the cyclotron. The cyclotron building has also been slightly inclined. This situation requires the re-alignment of all the beam transport line and the cyclotron. Some of the shield doors at experimental rooms were broken and blocked the entrance. The earthquake caused also a lot of damages to some components of the cyclotron as well as the beam transport lines, such as beam ducts, magnets, vacuum pumps and power supplies. Fortunately, no one was injured at CYRIC. The restoration work was started on July 2011 and will be completed by July 2012. This report describes the situation of damages and the current status of the restoration work. (author)

  1. Princeton Cyclotron QDDD spectrograph system

    International Nuclear Information System (INIS)

    Kouzes, R.T.

    1985-01-01

    A review of experiments involving the Princeton Quadrupole-Dipole-Dipole- Dipole (QDDD) spectrograph is given. The QDDD is a high resolution, large solid angle device which is combined with the azymuthally varying field (AVF) cyclotron. Some reactions involving 3 He beams are discussed

  2. Neutron radiography with the cyclotron

    International Nuclear Information System (INIS)

    Tazawa, Shuichi; Asada, Yorihisa; Yano, Munehiko; Nakanii, Takehiko.

    1985-01-01

    Neutron radiography is well recognized as a powerful tool in nondestructive testing, but not widely used yet owing to lack of high intense thermal neutron source convenient for practical use. This article presents a new neutron radiograph facility, utilizing a sub-compact cyclotron as neutron source and is equipped with vertical and horizontal irradiation ports. The article describes a series of experiments, we conducted using beams of a variable energy cyclotron at Tohoku University to investigate the characteristics of thermal neutron obtained from 9 Be(p, n) reaction and thermalized by elastic scattering process. The article also describes a computer simulation of neutron moderator to analyze conditions getting maximal thermal neutron flux. Further, some of practical neutron radiograph examinations of aero-space components and museum art objects of classic bronze mirror and an attempt realizing real time imaging technique, are introduced in the article. (author)

  3. Cyclotron radiation from hot plasmas

    International Nuclear Information System (INIS)

    Pohl, F.; Henning, J.; Duechs, D.

    1975-11-01

    In calculating the energy transport and losses due to cyclotron radiation there are two major requirements: the absorption coefficient has to be known and the proper geometry of the plasma has to be taken into account. In this report Trubnikov's integral formulae for the absorption coefficient have been evaluated numerically and compared with the approximative formulas of previous authors. Deviations by a factor of 2 - 10 in various frequency regimes are not unusual. With these coefficients the rate of change of the energy density due to cyclotron radiation in a plasma as well as the radiation density at a plasma surface are computed for plasma slab and plasma cylinder. Sometimes considerable differences to the results of previons papers can found. Many simple formulae interpolating the numerical results are given in the text, and the FORTRAN computer programs have been reproduced in the appendices. (orig.) [de

  4. Radioisotope production by reactors and cyclotrons in Japan

    International Nuclear Information System (INIS)

    Murakami, Yukio

    1978-01-01

    Present status of radioisotope production in Japan and the increasing demand from various fields are generally reviewed. Future problems associated with the shortage of economical supply are also discussed. The first half of this report is devoted to general review of the increasing demand for various radioisotopes from increasing number of users. The present status and future trends of the distribution of users of specific radioisotopes and their demands are shown. The remaining half of this report reviews the production with reactors and cyclotrons. The Japanese reactors producing radioisotopes are limited to low flux (10 13 ) research reactors at JAERI. Some problems associated with the improvement of availability and with the organizational structure are discussed. As for the production with cyclotrons, available facilities and the method of production are explained in detail. For clinical use, especially for the production of short lived radioisotopes, the advantage of a small special purpose cyclotron at each medical organization is emphasized. (Aoki, K.)

  5. Transparency of Magnetized Plasma at Cyclotron Frequency; TOPICAL

    International Nuclear Information System (INIS)

    G. Shvets; J.S. Wurtele

    2002-01-01

    Electromagnetic radiation is strongly absorbed by a magnetized plasma if the radiation frequency equals the cyclotron frequency of plasma electrons. It is demonstrated that absorption can be completely canceled in the presence of a magnetostatic field of an undulator or a second radiation beam, resulting in plasma transparency at the cyclotron frequency. This effect is reminiscent of the electromagnetically induced transparency (EIT) of the three-level atomic systems, except that it occurs in a completely classical plasma. Unlike the atomic systems, where all the excited levels required for EIT exist in each atom, this classical EIT requires the excitation of the nonlocal plasma oscillation. The complexity of the plasma system results in an index of refraction at the cyclotron frequency that differs from unity. Lagrangian description was used to elucidate the physics and enable numerical simulation of the plasma transparency and control of group and phase velocity. This control naturally leads to applications for electromagnetic pulse compression in the plasma and electron/ion acceleration

  6. Wave propagation through an electron cyclotron resonance layer

    International Nuclear Information System (INIS)

    Westerhof, E.

    1997-01-01

    The propagation of a wave beam through an electron cyclotron resonance layer is analysed in two-dimensional slab geometry in order to assess the deviation from cold plasma propagation due to resonant, warm plasma changes in wave dispersion. For quasi-perpendicular propagation, N ' 'parallel to'' ≅ v t /c, an O-mode beam is shown to exhibit a strong wiggle in the trajectory of the centre of the beam when passing through the fundamental electron cyclotron resonance. The effects are largest for low temperatures and close to perpendicular propagation. Predictions from standard dielectric wave energy fluxes are inconsistent with the trajectory of the beam. Qualitatively identical results are obtained for the X-mode second harmonic. In contrast, the X-mode at the fundamental resonance shows significant deviations form cold plasma propagation only for strongly oblique propagation and/or high temperatures. On the basis of the obtained results a practical suggestion is made for ray tracing near electron cyclotron resonance. (Author)

  7. Control philosophy and diagnostic systems of Superconducting Cyclotron

    International Nuclear Information System (INIS)

    Roy, Anindya; Bhattacharjee, Tanushyam; Chaddha, N.; Bhole, R.B.; Pal, Sarbajit; Samanta, N.C.; Dutta, C.D.; Mukhopadhyay, B.; Panda, U.S.; Sarkar, B.; Nabhiraj, P.Y.; Sarkar, D.

    2009-01-01

    The control system has the primary task of monitoring and control of all the important parameters of a machine comprises of various sub-systems. The paper describes the philosophy of the distributed control system of Superconducting Cyclotron implemented with the support of reliable and fast control network. The paper also describes the field hardware interfaced with various software platforms at different levels of individual sub-systems e.g. Main Magnet Power Supply, Trim-coil Power Supplies, He Liquefier/Refrigerator Plant, Cryogen Delivery System, RF System, ECR Ion source, Vacuum System, Radiation Monitoring System, Alarm Annunciation System, LCW System of SC Cyclotron. The database management system facilitating the exchange of control data among the sub-systems, serving as primary source of information to understand the behavior of the cyclotron, is also discussed. A brief description of various beam diagnostic instruments and their respective control systems e.g. Main Probe, Borescope, Beam viewer, Magnetic channel control system, Beam line slit control system, are briefly described. (author)

  8. Ernest Orlando Lawrence (1901-1958), Cyclotron and Medicine

    Energy Technology Data Exchange (ETDEWEB)

    Chu, William T.

    2005-09-01

    On August 8, 2001, Lawrence Berkeley National Laboratory celebrated the centennial of the birth of its founder (and namesake), Ernest Orlando Lawrence. For the occasion, many speeches were given and old speeches were remembered. We recall the words of the late Luis Alvarez, a Nobel Laureate and one of the Lawrence's closest colleagues: ''Lawrence will always be remembered as the inventor of the cyclotron, but more importantly, he should be remembered as the inventor of the modern way of doing science''. J. L. Heilbron and R. W. Seidel, in the introduction of their book, ''Lawrence and His Laboratory'' stated, ''The motives and mechanisms that shaped the growth of the Laboratory helped to force deep changes in the scientific estate and in the wider society. In the entrepreneurship of its founder, Ernest Orlando Lawrence, these motives, mechanisms, and changes came together in a tight focus. He mobilized great and small philanthropists, state and local governments, corporations, and plutocrats, volunteers and virtuosos. The work they supported, from astrophysics and atomic bombs, from radiochemistry to nuclear medicine, shaped the way we observe, control, and manipulate our environment.'' Indeed, all over the civilized world, the ways we do science changed forever after Lawrence built his famed Radiation Laboratory. In this editorial, we epitomize his legacy of changing the way we do medicine, thereby affecting the health and well being of all humanity. This year marks the 75th anniversary of the invention of the cyclotron by Ernest Orlando Lawrence at the University of California at Berkeley. Lawrence conceived the idea of the cyclotron early in 1929 after reading an article by Rolf Wideroe on high-energy accelerators. In the spring of 1930 one of his students, Nels Edlefsen, constructed two crude models of a cyclotron. Later in the fall of the same year, another student, M. Stanley Livingston

  9. sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

    DEFF Research Database (Denmark)

    Christner, Martin; Heinze, Constanze; Busch, Michael

    2012-01-01

    to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...

  10. Electromagnetic ion cyclotron waves observed near the oxygen cyclotron frequency by ISEE 1 and 2

    Science.gov (United States)

    Fraser, B. J.; Samson, J. C.; Hu, Y. D.; Mcpherron, R. L.; Russell, C. T.

    1992-01-01

    The first results of observations of ion cyclotron waves by the elliptically orbiting ISEE 1 and 2 pair of spacecraft are reported. The most intense waves (8 nT) were observed in the outer plasmasphere where convection drift velocities were largest and the Alfven velocity was a minimum. Wave polarization is predominantly left-handed with propagation almost parallel to the ambient magnetic field, and the spectral slot and polarization reversal predicted by cold plasma propagation theory are identified in the wave data. Computations of the experimental wave spectra during the passage through the plasmapause show that the spectral slots relate to the local plasma parameters, possibly suggesting an ion cyclotron wave growth source near the spacecraft. A regular wave packet structure seen over the first 30 min of the event is attributed to the modulation of this energy source by the Pc 5 waves seen at the same time.

  11. The Ion Cyclotron, Lower Hybrid, and Alfven Wave Heating Methods

    International Nuclear Information System (INIS)

    Koch, R.

    2004-01-01

    This lecture covers the practical features and experimental results of the three heating methods. The emphasis is on ion cyclotron heating. First, we briefly come back to the main non-collisional heating mechanisms and to the particular features of the quasilinear coefficient in the ion cyclotron range of frequencies (ICRF). The specific case of the ion-ion hybrid resonance is treated, as well as the polarisation issue and minority heating scheme. The various ICRF scenarios are reviewed. The experimental applications of ion cyclotron resonance heating (ICRH) systems are outlined. Then, the lower hybrid and Alfven wave heating and current drive experimental results are covered more briefly. Where applicable, the prospects for ITER are commented

  12. Stochasticity of the energy absorption in the electron cyclotron resonance

    International Nuclear Information System (INIS)

    Gutierrez T, C.; Hernandez A, O.

    1998-01-01

    The energy absorption mechanism in cyclotron resonance of the electrons is a present problem, since it could be considered from the stochastic point of view or this related with a non-homogeneous but periodical of plasma spatial structure. In this work using the Bogoliubov average method for a multi periodical system in presence of resonances, the drift equations were obtained in presence of a RF field for the case of electron cyclotron resonance until first order terms with respect to inverse of its cyclotron frequency. The absorbed energy equation is obtained on part of electrons in a simple model and by drift method. It is showed the stochastic character of the energy absorption. (Author)

  13. Ion Cyclotron Heating on Proto-MPEX

    Science.gov (United States)

    Goulding, R. H.; Caughman, J. B. O.; Rapp, J.; Biewer, T. M.; Campbell, I. H.; Caneses, J. F.; Kafle, N.; Ray, H. B.; Showers, M. A.; Piotrowicz, P. A.

    2016-10-01

    Ion cyclotron heating will be used on Proto-MPEX (Prototype Material Plasma Exposure eXperiment) to increase heat flux to the target, to produce varying ion energies without substrate biasing, and to vary the extent of the magnetic pre-sheath for the case of a tilted target. A 25 cm long, 9 cm diameter dual half-turn helical ion cyclotron antenna has been installed in the device located at the magnetic field maximum. It couples power to ions via single pass damping of the slow wave at the fundamental resonance, and operates with ω 0.8ωci at the antenna location. It is designed to operate at power levels up to 30 kW, with a later 200 kW upgrade planned. Near term experiments include measuring RF loading at low power as a function of frequency and antenna gap. The plasma is generated by a helicon plasma source that has achieved ne > 5 ×1019m-3 operating with deuterium, as measured downstream from the ion cyclotron antenna location. Measurements will be compared with 1-D and 2-D models of RF coupling. The latest results will be presented. This manuscript has been authored by UT-Battelle, LLC, under Contract No. DE-AC05-00OR22725 with the U.S. Department of Energy.

  14. Cyclotron Lines in Accreting Neutron Star Spectra

    Science.gov (United States)

    Wilms, Jörn; Schönherr, Gabriele; Schmid, Julia; Dauser, Thomas; Kreykenbohm, Ingo

    2009-05-01

    Cyclotron lines are formed through transitions of electrons between discrete Landau levels in the accretion columns of accreting neutron stars with strong (1012 G) magnetic fields. We summarize recent results on the formation of the spectral continuum of such systems, describe recent advances in the modeling of the lines based on a modification of the commonly used Monte Carlo approach, and discuss new results on the dependence of the measured cyclotron line energy from the luminosity of transient neutron star systems. Finally, we show that Simbol-X will be ideally suited to build and improve the observational database of accreting and strongly magnetized neutron stars.

  15. Use of cyclotrons in medical research: Past, present, future

    Science.gov (United States)

    Smathers, James B.; Myers, Lee T.

    1985-05-01

    The use of cyclotrons in medical research started in the late 1930s with the most prominent use being neutron irradiation in cancer therapy. Due to a lack of understanding of the biological effect of neutrons, the results were less than encouraging. In the 1940s and 1950s, small cyclotrons were used for isotope production and in the mid 60s, the biological effect of neutrons was more thoroughly studied, with the result that a second trial of neutron therapy was initiated at Hammersmith Hospital, England. Concurrent with this, work on the use of high energy charged particles, initially protons and alphas, was initiated in Sweden and Russia and at Harvard and Berkeley. The English success in neutron therapy led to some pilot studies in the USA using physics cyclotrons of various energies and targets. These results in turn lead to the present series of machines presently being installed at M.D. Anderson Hospital (42 MeV), Seattle (50 MeV) and UCLA (46 MeV). The future probably bodes well for cyclotrons at the two extremes of the energy range. For nuclear medicine the shift is away from the use of multiple isotopes, which requires a large range of particles and energies to 11C, 13N, 15O, and 18F, which can be incorporated in metabolic specific compounds and be made with small 8-10 MeV p+ "table top" cyclotrons. For tumor therapy machines of 60 MeV or so will probably be the choice for the future, as they allow the treatment of deep seated tumors with neutrons and the charged particles have sufficient range to allow the treatment of ocular tumors.

  16. Resonance cones below the ion cyclotron frequency: theory and experiment

    International Nuclear Information System (INIS)

    Bellan, P.

    1976-03-01

    The resonance cones existing below the ion cyclotron frequency, ω/sub c/sub i//, are shown, theoretically and experimentally, to be the asymptotes of hyperbolic constant-phase surfaces of low-frequency ion acoustic waves. Above ω/sub c/sub i// the surfaces transform into ellipses that are related to the electrostatic ion cyclotron waves and ion acoustic waves

  17. Electron Cyclotron Resonance Heating of a High-Density Plasma

    DEFF Research Database (Denmark)

    Hansen, F. Ramskov

    1986-01-01

    Various schemes for electron cyclotron resonance heating of tokamak plasmas with the ratio of electron plasma frequency to electron cyclotron frequency, "»pe/^ce* larger than 1 on axis, are investigated. In particular, a mode conversion scheme is investigated using ordinary waves at the fundamental...... of the electron cyclotron frequency. These are injected obliquely from the outside of the tokamak near an optimal angle to the magnetic field lines. This method involves two mode conversions. The ordinary waves are converted into extraordinary waves near the plasma cut-off layer. The extraordinary waves...... are subsequently converted into electrostatic electron Bernstein waves at the upper hybrid resonance layer, and the Bernstein waves are completely absorbed close to the plasma centre. Results are presented from ray-tracinq calculations in full three-dimensional geometry using the dispersion function for a hot non...

  18. Isochronous variable energy cyclotron of IPEN-CNEN/SP (Brazil)

    International Nuclear Information System (INIS)

    Lucki, G.; Zanchetta, A.A.; Gouveia, S.; Klein, H.

    1984-01-01

    The cyclotron CV-28 installed at the Radiation Damage Division of IPEN-CNEN/SP is a multi-particle radiation source where protons, deuterons, 3 He ions and alpha particles can be accelerated with variable energy up to 24, 14, 36 and 28 MeV, respectively. The cyclotron is a versatile machine that can be applied in research and development of : radioisotope production - materials science - nuclear physics - activation analysis and others. First internal beam with 24 MeV protons has been obtained in April 23, 1981. First irradiation of Cu sample, at the external beam (beam current 1.5 μA), with 28 MeV alpha particles was performed in December 29, 1983. Main characteristics of the cyclotron are given together with a description of peripheral systems and experimental capability. Presently the accelerator is being optimized for cpontinuous running. (Author) [pt

  19. Reduction of the beam pulse repetition rate of the Hamburg Isochronous Cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Krause, H; Langkau, R; Schirm, N [Hamburg Univ. (F.R. Germany). 1. Inst. fuer Experimentalphysik

    1976-04-01

    A system for the reduction of the beam pulse repetition rate of the energy-variable Hamburg Isochronous Cyclotron comprising beam pulse supression in the cyclotron center and in the external beam is described.

  20. ROKCY-12 (KCCH PET-dedicated cyclotron): main features and improvements

    International Nuclear Information System (INIS)

    Chai, J. S.; Kim, Y. S.; Yang, Y. T.; Jung, I. S.; Hong, S. S.; Lee, M. Y.; Jang, H. S.; Kim, J. H.

    2002-01-01

    In this paper, we describe the development of 13 MeV cyclotron (ROKCY-12) that can be used for a Position Emission Tomography(PET) purpose. This cyclotron with a maximum beam energy of 13 MeV can produce radio isotopes especially 18 F which has a relatively short half lifetime of 110 minutes. First, we show the beam characteristics can be used to carry out the operation of ROCKY-12. Based on this, a computer program has been developed to determine main cyclotron parameters such as cyclotron magnet, RF system, ion source, vacuum system and other cyclotron operation parameters. And then we show the result of design and manufacturing feature of ROKCY-12. By using this design program, one can determines magnet yoke geometry and the average magnetic fields etc. And then the three-dimensional computer program OPERA-3D has been invoked to determine magnet pole tips. Validity of the design can be seen by investigating magnetic fields, radial and vertical focusing frequencies as a function of the beam energy. In this paper, we show the results of cyclotron beam by ROCKY-12. We designed 77.3 MHz RF system and ion source system. We tested RF resonance each coupling methods. We show the result of RF design and prototype operation. Developed ion source is PIG type. We described our design methods and implementation. We report the result of getting negative hydrogen ion. Cyclotron controller asks inputs of every sensor and output of every instrument for notifying current condition to operator. It has independent controllers, for example DC power supply, vacuum system, beam profile system, beam extraction system, RF system, ion source, cooling unit and so on. Basically, each control system uses RS-485 for communication to main control computer. Consumers reward products and services that feature quality, originality, a distinct personality and charm. The International Standardization Organization (ISO) requires, as its mission, that we achieve competitive superiority by

  1. Superconducting conversion of the Oak Ridge Isochronous Cyclotron

    International Nuclear Information System (INIS)

    Martin, J.A.; Ball, J.B.; Cleary, E.D.

    1981-01-01

    The superconducting conversion of the Oak Ridge Isochronous Cyclotron (ORIC) will replace the existing aluminum main magnet coils with a NbTi superconducting coil system to provide an increase in magnetic field from 1.9 to 3.3 T. The higher magnetic field will provide a three-fold increase in maximum energy capability of the cyclotron for high mass ions. The conversion will include a new beam extraction system, magnet yoke stiffening to counteract the increased magnetic forces, and minor modifications to the beam transport systems and shielding

  2. Solid targets for production of radioisotopes with cyclotron

    International Nuclear Information System (INIS)

    Paredes G, L.; Balcazar G, M.

    1999-01-01

    The design of targets for production of radioisotopes and radiopharmaceuticals of cyclotron to medical applications requires a detailed analysis of several variables such as: cyclotron operation conditions, choice of used materials as target and their physicochemical characteristics, activity calculation, the yielding of each radioisotope by irradiation, the competition of nuclear reactions in function of the projectiles energy and the collision processes amongst others. The objective of this work is to determine the equations for the calculation for yielding of solid targets at the end of the proton irradiation. (Author)

  3. Operational health and physics service during the maintenance of the Australian National Medical Cyclotron

    International Nuclear Information System (INIS)

    Mukherjee, B.

    1994-01-01

    Modern Medical Cyclotrons use intense beams of high energy protons or deuterons to produce large activities of short and medium lived radionuclides. After continuous operation for prolonged periods the Cyclotron components become activated through various nuclear interactions therefore, the risk of personal radiation hazard while handling such activated cyclotron components is high. This paper describes all operational aspects of the Health Physics service evolved during the first preventative maintenance program of the Australian National Medical Cyclotron, which took place in June 1993. 5 refs., 3 tabs., 2 figs

  4. Wave trajectory and electron cyclotron heating in toroidal plasmas

    International Nuclear Information System (INIS)

    Maekawa, T.; Tanaka, S.; Terumichi, Y.; Hamada, Y.

    1977-12-01

    Wave trajectories propagating obliquely to magnetic field in toroidal plasmas are studied theoretically. Results show that the ordinary wave at appropriate incident angle is mode-converted to the extraordinary wave at first turning point and is further converted to the electron Bernstein wave during passing a loop or a hooked nail curve near second turning point and is cyclotron-damped away, resulting in local electron heating, before arriving at cyclotron resonance layer. (auth.)

  5. TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

    Energy Technology Data Exchange (ETDEWEB)

    1989-03-01

    This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.

  6. Benchmarking of codes for electron cyclotron heating and electron cyclotron current drive under ITER conditions

    NARCIS (Netherlands)

    Prater, R.; Farina, D.; Gribov, Y.; Harvey, R. W.; Ram, A. K.; Lin-Liu, Y. R.; Poli, E.; Smirnov, A. P.; Volpe, F.; Westerhof, E.; Zvonkovo, A.

    2008-01-01

    Optimal design and use of electron cyclotron heating requires that accurate and relatively quick computer codes be available for prediction of wave coupling, propagation, damping and current drive at realistic levels of EC power. To this end, a number of codes have been developed in laboratories

  7. Pumping system of 30,000 l/sec for CIME cyclotron

    International Nuclear Information System (INIS)

    Horbowa, A.; Buhler, S.; Blache, Ph.; Chevrollier, R.; Grolet, D.; Pilot, A.; Szott, Ph.; Languiller, J.; Gallardo, Ph.

    1999-01-01

    The cyclotron CIME (SPIRAL facilities) has to accelerate radioactive ions produced from primary heavy beams delivered by GANIL. To avoid beam losses by charge exchange on the residual gas, the ultimate pressure in the cyclotron is expected to be better than 5.10 -8 mbar. In order to reach such a low pressure, a system of 30.000 l/sec twin cryo-panels has been designed for being installed inside the cyclotron. Each cryo-panel will be individually cooled by a separate set of two cryo-generators. From cryo-generators to cryo-panels, the cooling power is transferred through heat-pipes over several meters. The complete system designed and constructed in the IPN and GANIL laboratories, is presently under testing at the GANIL location. (authors)

  8. Small-sized cyclotron for studies of physical processes in accelerators

    International Nuclear Information System (INIS)

    Arzumanov, A.A.; Voronin, A.M.; Gerasimov, V.I.; Gor'kovets, M.S.; Gromov, D.D.; Zavezionov, V.P.; Kruglov, V.G.

    1979-01-01

    A description is given of a cyclotron intended for studying physical processes taking place in the accelerator central part, for investigating various ion sources and also for optimizing the elements and systems of the U-150M isochronous cyclotron. The accelerator uses a hot-cathode slit ion source. The resonance system constitutes a quarter-wave nonaxial resonator excited at a frequency of 11.2 MHz. Investigations of beam time characteristics showed that the beam axial size constituted 11 mm, its radial size 5 mm. Displacement of the beam with respect to the median plane does not exceed 2 mm. In the cyclotron H + ions have been accelerated to an energy of 1 MeV. The integrated beam current constituted 250 μA

  9. Medical radioisotopes production at the isochronous cyclotron in Alma-Ata

    International Nuclear Information System (INIS)

    Arzumanov, A.A.; Batischev, V.N.; Gladun, V.K.; Kochetkov, V.L.

    1988-01-01

    High efficiency cyclotron operations (up to 5200 hours of beam time a year) considerably increased the possibility to perform both fundamental and applied scientific work. There appeared possibility to accelerate protons in a wide energy range from 6 to 30 MeV and realize correspondingly the nuclear reactions up to (A, 3n). This paper reports that among different applied tasks performed at the cyclotron the special program of cyclotron production of short-lived medical radioisotopes iodine-123, thallium-201, cadmium-109 in the first place and some others to satisfy clinic needs of Alma-Ata and its region has special importance. In accordance with this program the preparation to produce iodine-123 is being held and regular production of Thallium chloride, thallium-201 pharmaceptical is started

  10. A permanent magnet system for a cyclotron used as a mass spectrometer

    International Nuclear Information System (INIS)

    Li, C.Y.; Cooper, M.; Halbach, K.; Kunkel, W.B.; Leung, K.N.; Wells, R.P.; Young, A.T.

    1992-07-01

    The design of a compact, low energy cyclotron used as a mass spectrometer is presented. The instrument is designed for high resolution, high sensitivity detection of trace. It features the use of permanent magnets to excite the soft iron pole pieces which provide the magnetic field of the cyclotron. Tuning magnets are used to enable the field to be varied. This significantly improves the operational requirements of the instrument when compared to one which uses electromagnets. The cyclotron will use a spiral reflector for axial injection

  11. Social humanoid robot SARA: development of the wrist mechanism

    Science.gov (United States)

    Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.

    2018-01-01

    This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.

  12. The importance of plasma effects on electron-cyclotron maser-emission from flaring loops

    Science.gov (United States)

    Sharma, R. R.; Vlahos, L.; Papadopoulos, K.

    1982-01-01

    Electron cyclotron maser instability has been suggested as the cause of the observed short (10-20 msec), intense (an approximate brightness temperature of 10 to the 15th K) and up to 100% polarized microwave solar emission. It is shown that plasma effects and thermal cyclotron damping, ignored in previous theories, play an important role in controlling the frequency range of the emission. The radio emission is suppressed for ratios of the plasma frequency to the cyclotron frequency smaller than 0.4. An examination of the cyclotron damping, reveals that the maser action is suppressed unless a large fraction (i.e., over 10%) of the accelerated electrons participates in the emission process.

  13. Foil changer for the Chalk River superconducting cyclotron

    International Nuclear Information System (INIS)

    Hoffmann, C.R.; Kilborn, R.I.; Mouris, J.E.; Proulx, D.R.; Weaver, J.F.

    1985-01-01

    Capture of an injected beam in the Chalk River superconducting cyclotron requires that a carbon stripping foil be accurately placed in a dee to intercept the incoming beam. Foil radial position must be precisely adjustable and foils must be easily replaced. A foil changing apparatus has been designed, built and tested to meet these requirements. The main components are a supply magazine, a transport system, and unloading and loading mechanisms. The magazine is on top of the cyclotron. It holds 300 foils and can be isolated from machine vacuum for refilling. Each foil is mounted on a stainless steel frame. A stainless steel roller chain fitted with 33 copper sleeves (shrouds) carries foils, one per shroud, down a dee stem to the midplane. A 12-bit absolute optical shaft encoder senses foil position. To replace a foil a shroud is positioned at the top of the cyclotron, a foil is removed, and another is transferred from the magazine to the empty shroud. Three stepping motors and associated electronics provide mechanical drive and are interfaced with a CAMAC control system

  14. NIRS report concerning the cyclotron usages. FY 2000

    International Nuclear Information System (INIS)

    2001-07-01

    This report describes the National Institute of Radiological Sciences (NIRS) cyclotron usages concerning of: Operation and improvement-development of the cyclotrons in 2000 (total 1,302 hr operation, development of the insulating septum, renewal of the magnetic channel and radiofrequency (RF) pre-amplifier, and improvement of the magnetic interference); Development of neutron detectors in the cosmic environment (the phoswich detector, low-pressure proportional counter, bubble dosimeter and new type phoswich detector); Development of detectors of charged particle components in the cosmic radiation (Liulin-4J and position sensitive silicon detector); Measurement of the energy and angular distribution of secondary electrons from water vapor with heavy-ion impact; Phase II clinical trials of proton beam therapy for ophthalmological tumors (34 patients in 1996-2000 and survival rate 100% within 3 years); Application of cyclotrons for RI production (mainly, 11 C, 13 N, 15 O and 18 F for basic and clinical PET); Studies on the spread-out peak of proton beam (for radiotherapy); and Related materials to above (details). (N.I.)

  15. Design study of the KIRAMS-430 superconducting cyclotron magnet

    International Nuclear Information System (INIS)

    Kim, Hyun Wook; Kang, Joonsun; Hong, Bong Hwan; Jung, In Su

    2016-01-01

    Design study of superconducting cyclotron magnet for the carbon therapy was performed at the Korea Institute of Radiological and Medical Science (KIRAMS). The name of this project is The Korea Heavy Ion Medical Accelerator (KHIMA) project and a fixed frequency cyclotron with four spiral sector magnet was one of the candidate for the accelerator type. Basic parameters of the cyclotron magnet and its characteristics were studied. The isochronous magnetic field which can guide the "1"2C"6"+ ions up to 430 MeV/u was designed and used for the single particle tracking simulation. The isochronous condition of magnetic field was achieved by optimization of sector gap and width along the radius. Operating range of superconducting coil current was calculated and changing of the magnetic field caused by mechanical deformations of yokes was considered. From the result of magnetic field design, structure of the magnet yoke was planned.

  16. Design study of the KIRAMS-430 superconducting cyclotron magnet

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyun Wook; Kang, Joonsun, E-mail: genuinei@kirams.re.kr; Hong, Bong Hwan; Jung, In Su

    2016-07-01

    Design study of superconducting cyclotron magnet for the carbon therapy was performed at the Korea Institute of Radiological and Medical Science (KIRAMS). The name of this project is The Korea Heavy Ion Medical Accelerator (KHIMA) project and a fixed frequency cyclotron with four spiral sector magnet was one of the candidate for the accelerator type. Basic parameters of the cyclotron magnet and its characteristics were studied. The isochronous magnetic field which can guide the {sup 12}C{sup 6+} ions up to 430 MeV/u was designed and used for the single particle tracking simulation. The isochronous condition of magnetic field was achieved by optimization of sector gap and width along the radius. Operating range of superconducting coil current was calculated and changing of the magnetic field caused by mechanical deformations of yokes was considered. From the result of magnetic field design, structure of the magnet yoke was planned.

  17. Applied research with cyclotrons

    International Nuclear Information System (INIS)

    Apel, P.; Dmitriev, S.; Gulbekian, G.; Gikal, B.; Ivanov, O.; Reutov, V.; Skuratov, V.

    2005-01-01

    During the past three decades the Flerov laboratory carried out research and development of a number of applications that have found or may find use in modern technologies. One of the applications is the so-called ion track technology enabling us to create micro- and nano-structured materials. Accelerated heavy ion beams are the unique tools for structuring insulating solids in a controllable manner. At FLNR JINR the U-400 cyclotron and the IC-100 cyclotron are employed for irradiation of materials to be modified by the track-etch technique. For practical applications, U-400 delivers the 86 Kr ion beams with total energies of 250, 350, 430 and 750 MeV, and the 136 Xe ion beams with the energy of 430 MeV. The cyclotron is equipped with a specialized channel for irradiation of polymer foils. IC-100 is a compact accelerator specially designed for the technological uses. High-intensity krypton ion beams with the energy of ∼ 1 MeV/u are available now at IC-100. Production of track-etch membranes is an example of mature technology based on irradiation with accelerated ions. The track-etch membranes offer distinct advantages over other types of membranes due to their precisely determined structure. One-pore, oligo-pore and multi-pore samples can serve as models for studying the transport of liquids, gases, particles, solutes, and electrolytes in narrow channels. Track-etch pores are also used as templates for making nano wires, nano tubes or array of nano rods. The microstructures obtained this way may find use in miniaturized devices such as sensors for biologically important molecules. Bulk and surface modification for the production of new composites and materials with special optical properties can be performed with ion beams. Flexible printed circuits, high-performance heat transfer modules, X-ray filters, and protective signs are examples of products developed in collaboration with research and industrial partners. Some recent achievements and promising ideas that

  18. Computer simulations of upper-hybrid and electron cyclotron resonance heating

    International Nuclear Information System (INIS)

    Lin, A.T.; Lin, C.C.

    1983-01-01

    A 2 1/2 -dimensional relativistic electromagnetic particle code is used to investigate the dynamic behavior of electron heating around the electron cyclotron and upper-hybrid layers when an extraordinary wave is obliquely launched from the high-field side into a magnetized plasma. With a large angle of incidence most of the radiation wave energy converts into electrostatic electron Bernstein waves at the upper-hybrid layer. These mode-converted waves propagate back to the cyclotron layer and deposit their energy in the electrons through resonant interactions dominated first by the Doppler broadening and later by the relativistic mass correction. The line shape for both mechanisms has been observed in the simulations. At a later stage, the relativistic resonance effects shift the peak of the temperature profile to the high-field side. The heating ultimately causes the extraordinary wave to be substantially absorbed by the high-energy electrons. The steep temperature gradient created by the electron cyclotron heating eventually reflects a substantial part of the incident wave energy. The diamagnetic effects due to the gradient of the mode-converted Bernstein wave pressure enhance the spreading of the electron heating from the original electron cyclotron layer

  19. The development of technology for the improvement of cyclotron performance

    Energy Technology Data Exchange (ETDEWEB)

    Chai, Jong Seo; Kim, Y. S.; Ha, J. H.; Lee, M. Y.; Lee, H. S

    1999-05-01

    We show the first-order beam optics theory which is a simplified theory that can be used to carry out the initial design of a cyclotron. Based on this, a computer program has been developed to determine main cyclotron parameters such as number of magnet sectors, sector angle, hill and valley fields, and overall size of the cyclotron etc. We then show the result of two-dimensional magnetic field calculation using POISSON program. By using this program, one can determine magnet yoke geometry and the average magnetic fields etc. Finally, the three-dimensional computer program OPERA-3D had been invoked to determine magnet pole tips (i.e. sector). Validity of the design can be seen by investigating magnetic fields, radial and vertical focusing frequencies as a function of the beam energy. In this report, we show the results of cyclotron magnet design. And we designed 72 MHz RF system and ion source system. We tested RF resonance each coupling methods. We show the result of RF design and prototype operation. Our developed ion source is PIG type. We described our design methods and implementation. We report the result of getting negative hydrogen ion.

  20. Operational experience and recent developments at the National Medical Cyclotron

    International Nuclear Information System (INIS)

    Conard, E.; Pac, B.; Arnott, D.W.

    1994-01-01

    The National Medical Cyclotron is a radioisotope production facility run by ANSTO and located on the grounds of the Royal Prince Alfred Hospital in Sydney, Australia. A CYCLONE 30 (IBA) cyclotron is used in the production of short-lived PET radiopharmaceuticals required by the hospital's PET Scanner and also to produce a number of bulk radiochemicals for processing and distribution throughout Australasia. Following commissioning of the cyclotron and beam lines in October 1991, and the overcoming of a number of early open-quote teething close-quote problems especially relating to the reliability of the r.f. and solid target transport systems, a steady program of improvements has been pursued. These improvements have included development of new beam diagnostics and the design and installation of a new beam line for SPECT radioisotope production. The current operations schedule includes the production of 18 FDG, 13 NH 3 , 15 O 2 and 201 Tl, 67 Ga and 123 I. This paper will discuss the process of development of the cyclotron to ably meet the present demands on it, and the problems resolved in the pursuit of this goal

  1. Improved High Current Liquid and Gas Targets for Cyclotron Produced Radioisotopes (Turkey)

    Energy Technology Data Exchange (ETDEWEB)

    Kivrakdal, Deniz; Ustaoğlu, Özgur; Soylu, Ayfer [Eczacibasi Nuclear Products Inc. (Turkey)

    2009-07-01

    As positron emitting radiopharmaceuticals gain interest in nuclear medicine, more and more baby cyclotrons are installed. The number of cyclotrons in Turkey went up to nine whereas the number of PET or PET/CT cameras increased more than 50% within a year. At the moment there are 65 positron imaging cameras serving a population of around 70 million. Eczacıbası - Monrol Nuclear Products Industry and Trade Inc. has five cyclotrons three of them being of different brands. In this report production data collected with these cyclotrons using high current liquid targets of silver, tantalum and niobium will be presented. The data presented here covers the whole duration of the project. Another topic which will be discussed here is the work carried out about purification and analysis of used O-18 water for re-use purposes. (author)

  2. Improved High Current Liquid and Gas Targets for Cyclotron Produced Radioisotopes (Turkey)

    International Nuclear Information System (INIS)

    Kivrakdal, Deniz; Ustaoğlu, Özgur; Soylu, Ayfer

    2009-01-01

    As positron emitting radiopharmaceuticals gain interest in nuclear medicine, more and more baby cyclotrons are installed. The number of cyclotrons in Turkey went up to nine whereas the number of PET or PET/CT cameras increased more than 50% within a year. At the moment there are 65 positron imaging cameras serving a population of around 70 million. Eczacıbası - Monrol Nuclear Products Industry and Trade Inc. has five cyclotrons three of them being of different brands. In this report production data collected with these cyclotrons using high current liquid targets of silver, tantalum and niobium will be presented. The data presented here covers the whole duration of the project. Another topic which will be discussed here is the work carried out about purification and analysis of used O-18 water for re-use purposes. (author)

  3. Nonlinear cyclotron absorption and stimulated scattering

    International Nuclear Information System (INIS)

    Chung, T.H.

    1986-01-01

    In electron cyclotron resonance heating (ECRH), wave sources heating a plasma linearly with respect to intensity; but as the intensity of ECRH gets larger, there might appear nonlinear effects that would result in cutoff of net absorption. This thesis uses quantum mechanical theory to derive a threshold microwave intensity for nonlinear absorption. The quantum mechanical theory estimates that the threshold microwave intensity for nonlinear absorption is about 10 5 watts/cm 2 for a microwave heating experiment (T/sub e/ = 100 ev, λ = 3,783 cm, B = 2.5 kG). This value seems large considering the present power capabilities of microwave sources (10 2 ∼ 10 3 watts/cm 2 ), but for a low temperature plasma, this threshold will go down. There is another nonlinear phenomenon called stimulated cyclotron scattering that enhances photon scattering by electrons gyrating in a magnetic field. This is expected to prevent incoming photons from arriving at the central region of the fusion plasma, where absorption mainly takes place. Theory based on a photon transport model predicts that the threshold intensity for the stimulated cyclotron scattering is about 10 4 watts/cm 2 for the plasma parameters mentioned above. This value seems large also, but a longer wavelength of microwaves and a larger magnitude magnetic field, which will be the case in reactor type facilities, will lower the threshold intensity to levels comparable with the currently developed microwave sources

  4. Design features of isotope production facility at Inshas cyclotron complex. Vol. 1

    Energy Technology Data Exchange (ETDEWEB)

    Comsan, M N [Nuclear Research Center, Atomic Energy Aurhority, Cairo, (Egypt)

    1996-03-01

    The nuclear research center, AEA, Egypt is erecting at its Inshas campus cyclotron complex for multidisciplinary use for research and application. The complex is to utilize a russian made AVF cyclotron accelerator of the type MGC-20 with MeV protons. Among its applications, the accelerator will be used for the production of short lived cyclotron isotopes. This article presents a concise description of the design features of isotope production facility to be annexed to the complex layout, schemes for radio waste, ventilation, and air conditioning systems. 2 figs., 2 tabs.

  5. TFTR vertically viewing electron cyclotron emission diagnostic

    International Nuclear Information System (INIS)

    Taylor, G.

    1990-01-01

    The Tokamak Fusion Test Reactor (TFTR) Michelson interferometer has a spectral coverage of 75--540 GHz, allowing measurement of the first four electron cyclotron harmonics. Until recently the instrument has been configured to view the TFTR plasma on the horizontal midplane, primarily in order to measure the electron temperature profile. Electron cyclotron emission (ECE) extraordinary mode spectra from TFTR Supershot plasmas exhibit a pronounced, spectrally narrow feature below the second harmonic. A similar feature is seen with the ECE radiometer diagnostic below the electron cyclotron fundamental frequency in the ordinary mode. Analysis of the ECE spectra indicates the possibility of a non-Maxwellian 40--80 keV tail on the electron distribution in or near the core. During 1990 three vertical views with silicon carbide viewing targets will be installed to provide a direct measurement of the electron energy distribution at major radii of 2.54, 2.78, and 3.09 m with an energy resolution of approximately 20% at 100 keV. To provide the maximum flexibility, the optical components for the vertical views will be remotely controlled to allow the Michelson interferometer to be reconfigured to either the midplane horizontal view or one of the three vertical views between plasma shots

  6. Improving cancer treatment with cyclotron produced radionuclides

    International Nuclear Information System (INIS)

    Larson, S.M.; Finn, R.D.

    1992-01-01

    Our goal is to improve the scientific basis for tumor diagnosis, treatment and treatment follow-up based on the use of cyclotron produced radiotracers in oncology. The grant includes 3 interactive components: Radiochemistry/Cyclotron; Pharmacology; and Immunology. The radiochemistry group seeks to develop innovative cyclotron targetry, radiopharmaceuticals, and radiolabeled antibodies, which are then used to assess important unanswered questions in tumor pharmacology and immunology. Examples include selected positron emitting radionuclides, such as Iodine-124, and Ga-66; I-124, I-123, I-131 labeled iododeoxyuridine, C-11 colchicine, and antimetabolites, like C-11 methotrexate; and radiolabeled antibodies, 3F8, M195, A33, and MRK16 for application in the pharmacology and immunology projects. The pharmacology program studies tumor resistance to chemotherapy, particularly the phenomenon of multidrug resistance and the relationship between tumor uptake and retention and the tumor response for anti-metabolite drugs. The immunology program studies the physiology of antibody localization at the tissue level as the basis for novel approaches to improving tumor localization such as through the use of an artificial lymphatic system which mechanically reduces intratumoral pressures in tumors in vivo. Quantitative imaging approaches based on PET and SPECT in radioimmunotherapy are studied to give greater insight into the physiology of tumor localization and dosimetry

  7. High-intensity cyclotrons for radioisotope production and accelerator driven systems

    Energy Technology Data Exchange (ETDEWEB)

    Jongen, Y.; Vandeplassche, D.; Kleeven, W.; Beeckman, W.; Zaremba, S.; Lannoye, G.; Stichelbaut, F

    2002-04-22

    IBA recently proposed a new method to extract high-intensity positive ion beams from a cyclotron based on the concept of auto-extraction. We review the design of a 14 MeV, multi-milliampere cyclotron using this new technology. IBA is also involved in the design of the accelerator system foreseen to drive the MYRRHA facility, a multipurpose neutron source developed jointly by SCK-CEN and IBA.

  8. New design for a medical cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, M

    1985-12-01

    The Oxford Instruments Group PLC, have designed a 30 MeV energy proton cyclotron incorporating a super-conducting magnet and a novel RF accelerating cavity. The energy range is suitable for the production of isotopes such as /sup 67/Ga, /sup 111/In, /sup 123/I and /sup 201/Tl, and the short lived isotopes of carbon, nitrogen, oxygen and fluorine for use in Positron Emmission Tomography (PET). A new magnet and RF cavity design permit a considerable power and weight reduction and a compact size (1.5m dia x 1.9m high), allowing the cyclotron to be transported to a shielded site as an assembly after factory testing. A method of beam extraction has been adopted which minimises activation of the accelerator components and so allows hands on maintenance to be carried out when required.

  9. Superconducting cyclotron deflector conditioning status - an experience with high voltage

    International Nuclear Information System (INIS)

    Ghosh, Subhash; Chattopadhyay, Subrata; Bhattacharjee, Tanushyam; De, Anirban; Paul, Santanu; Pal, Gautam; Saha, Subimal; Mallik, C.; Bhandari, R.K.

    2009-01-01

    In this paper we report about the status of the electrostatic deflector which will be used in K500 superconducting cyclotron at VECC, Kolkata. For extraction of beams from superconducting cyclotron we have to achieve 130 kV/cm. Titanium and tungsten are used for anode and septum respectively. The deflector fits within the median plane of the superconducting magnet. We report here the voltage limit, sparking rates, dark current levels and the effects observed on conditioning. For commissioning of the superconducting cyclotron, the plan is to accelerate Neon beam of 50 MeV/n for which the required extraction voltage is 81 kV/cm and we reached up to 110 kV/cm. The conditioning test chamber is maintained at a pressure of 8.0 x 10 -7 mbar. (author)

  10. Automatized target devices for radioisotope production at the RITs cyclotron

    International Nuclear Information System (INIS)

    Bogdanov, P.V.; Ivanov, V.V.; Karasev, B.G.

    1981-01-01

    An automation target device intended for isotope production on the internal beam of the RITs cyclotron is decribed. The target device comprises the following main units: target head, vacuum lock, charging device, transport system for bringing the target for charging; mechanism of target discharge transport device, control interlocking and signalling control system of target radiation power. The automation target device permits radioisotope production on the cyclotron in commercial scales with automation substitution of irradiated targets. The time of substitution of one of six targets makes up only 5 min. The time of charging a new group of targets to the charge device - 60 min. Contact of the personnel with irradiated targets is practically excluded and the necessity of entering the cyclotron room for maintenance of the plant is reduced to the minimum [ru

  11. CAS CERN Accelerator School: Cyclotrons, linacs and their applications. Proceedings

    International Nuclear Information System (INIS)

    Turner, S.

    1996-01-01

    These proceedings present the lectures given at the eighth specialized course organized by the CERN Accelerator School (CAS), the topic this time being 'Cyclotrons, Linacs and Their Applications'. Following an introductory lecture on linacs, the fundamental features of electron, ion and induction linacs are described together with their RF systems and particle sources. Cyclotrons are then introduced followed by details of their different types, their magnet and RF design, and their injection and extraction systems, with a glance towards exotic and possible future machines. Chapters are then presented on the use of linacs and cyclotrons for medical, fission, fusion and material applications, as well as for isotope production. Finally, descriptions of the design of a radioisotope facility, the matching of accelerators to their task and the computational tools used in their design are included. (orig.)

  12. CAS CERN Accelerator School: Cyclotrons, linacs and their applications. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Turner, S [ed.

    1996-03-04

    These proceedings present the lectures given at the eighth specialized course organized by the CERN Accelerator School (CAS), the topic this time being `Cyclotrons, Linacs and Their Applications`. Following an introductory lecture on linacs, the fundamental features of electron, ion and induction linacs are described together with their RF systems and particle sources. Cyclotrons are then introduced followed by details of their different types, their magnet and RF design, and their injection and extraction systems, with a glance towards exotic and possible future machines. Chapters are then presented on the use of linacs and cyclotrons for medical, fission, fusion and material applications, as well as for isotope production. Finally, descriptions of the design of a radioisotope facility, the matching of accelerators to their task and the computational tools used in their design are included. (orig.).

  13. The Data Cyclotron query processing scheme

    NARCIS (Netherlands)

    Goncalves, R.; Kersten, M.

    2011-01-01

    A grand challenge of distributed query processing is to devise a self-organizing architecture which exploits all hardware resources optimally to manage the database hot set, minimize query response time, and maximize throughput without single point global coordination. The Data Cyclotron

  14. Status report on the operation of the cyclotron and on the programs of its practical applications

    International Nuclear Information System (INIS)

    Tarkanyi, F.; Ander, I.; Ando, L.; Ditroi, F.; Fenyvesi, A.; Kiraly, B.; Kormany, Z.; Kovacs, P.; Kovacs, Z.; Mahunka, I.

    2007-01-01

    The main task of the Cyclotron Department is to operate the ATOMKI MGC-20E cyclotron, to support the research in different scientific fields and to use the accelerator in practice related applications. The Cyclotron Laboratory has been installed in a research institute so research is the most important task. Considering that some results of the basic research can be used in different routine applications, the second important task is to help developing systems for this reason. The capacity of the accelerator usually allows making routine applications to ensure the financial background for the service and for the development of the cyclotron. The cyclotron is applied directly for basic nuclear physics research and it indirectly helps the research in other fields via interdisciplinary studies. It is used in broad scale for different practical applications which have direct results in basic sciences in many cases therefore the classification sometimes is not simple. The irradiations at the cyclotron are dedicated to basic research in the field of nuclear structure and nuclear reaction studies and from other side to the so-called practical applications. The cyclotron has been in operation in ATOMKI since 1985. Since then the cyclotron has been reliably running with very short undesired breakdowns and it has been used for a wide range of research and application programs. This overview gives a short summary of the status of cyclotron operation and the practical applications and gives some indications on the future plans. (author)

  15. Evolution of the axial electron cyclotron maser instability, with applications to solar microwave spikes

    Science.gov (United States)

    Vlahos, Loukas; Sprangle, Phillip

    1987-01-01

    The nonlinear evolution of cyclotron radiation from streaming and gyrating electrons in an external magnetic field is analyzed. The nonlinear dynamics of both the fields and the particles are treated fully relativistically and self-consistently. The model includes a background plasma and electrostatic effects. The analytical and numerical results show that a substantial portion of the beam particle energy can be converted to electromagnetic wave energy at frequencies far above the electron cyclotron frequency. In general, the excited radiation can propagate parallel to the magnetic field and, hence, escape gyrothermal absorption at higher cyclotron harmonics. The high-frequency Doppler-shifted cyclotron instability can have saturation efficiencies far higher than those associated with well-known instabilities of the electron cyclotron maser type. Although the analysis is general, the possibility of using this model to explain the intense radio emission observed from the sun is explored in detail.

  16. Evolution of the axial electron cyclotron maser instability, with applications to solar microwave spikes

    International Nuclear Information System (INIS)

    Vlahos, L.; Sprangle, P.

    1987-01-01

    The nonlinear evolution of cyclotron radiation from streaming and gyrating electrons in an external magnetic field is analyzed. The nonlinear dynamics of both the fields and the particles are treated fully relativistically and self-consistently. The model includes a background plasma and electrostatic effects. The analytical and numerical results show that a substantial portion of the beam particle energy can be converted to electromagnetic wave energy at frequencies far above the electron cyclotron frequency. In general, the excited radiation can propagate parallel to the magnetic field and, hence, escape gyrothermal absorption at higher cyclotron harmonics. The high-frequency Doppler-shifted cyclotron instability can have saturation efficiencies far higher than those associated with well-known instabilities of the electron cyclotron maser type. Although the analysis is general, the possibility of using this model to explain the intense radio emission observed from the sun is explored in detail. 31 references

  17. CACTUS - a multidetector set-up at the Oslo Cyclotron

    International Nuclear Information System (INIS)

    Guttormsen, M.; Bjerke, B.; Messelt, S.; Olsen, E.A.; Ramsoey, T.; Rekstad, J.; Tveter, T.S.; Wikne, J.C.; Kownacki, J.

    1989-06-01

    The design and construction of the multidetector system CACTUS is discussed, and its operation in the context of the Oslo Cyclotron is described. The multidetector system has been initiated to meet the requirements at the Oslo Cyclotron Laboratory in the experimental work on nuclear structure at high intrinsic excitation energy. The laboratory has developed a promising technique based on measuring γ-decay after single nucleon transfer reactions with the use of pγ coincidences. However, a proper interpretation of the experimental results has often been difficult due to low counting rates. One of the most important aims for the new experimental set-up has been to obtain pγ as well as pγγ coincidence spectra with high statistics. The CACTUS detector system which is mounted on the 90 o beam line of the cyclotron, consists of 28 NaI and 2 Ge detectors in combination with 8 Si particle telescopes

  18. A 30 MeV H- cyclotron for isotope production

    International Nuclear Information System (INIS)

    Baartman, R.; Kleevan, W.J.; Laxdal, R.E.; Milton, B.F.; Otter, A.J.; Pearson, J.B.; Poirier, R.L.; Schmor, P.W.; Schneider, H.R.; Erdman, K.L.; Walker, Q.

    1989-01-01

    Because of an expanding market for radioisotopes there is a need for a new generation of cyclotrons designed specifically for this purpose. We describe such a cyclotron currently under construction. It is a 30 MeV H - design that exploits a newly developed high brightness multicusp ion source which is capable of H - currents of up to 5 mA. This together with careful beam matching then makes feasible accelerated H - beam intensities of 500 μA. The cyclotron being built is a four sector radial ridge design with two 45 degree dees in opposite valleys. Beam extraction is by stripping to H + in a thin graphite foil. Two extraction probes will allow simultaneous extraction of two beams, each with an intensity of up to 200 μA. Energy variation from 15 MeV to 30 MeV is achieved by varying the radial position of the extraction foil. 7 refs., 4 figs., 1 tab

  19. Fundamental harmonic electron cyclotron emission for hot, loss-cone type distributions

    International Nuclear Information System (INIS)

    Bornatici, M.; Ruffina, U.; Westerhof, E.

    1988-01-01

    Electron cyclotron emission (ECE) is an important diagnostic tool for the study of hot plasmas. ECE can be used not only to measure the electron temperature but also to obtain information about non-thermal characteristics of the electron distribution function. One such a nonthermal characteristic is a loss-cone anisotropy. Loss-cone anisotropy can give rise to unstable growth of electro-magnetic waves around the harmonics of the electron cyclotron resonance and to increased emissivity of electron cyclotron waves. In case of high electron temperatures, also the dispersion properties of the extraordinary (X-) mode arond the fundamental electron cyclotron resonance are changed due to loss-cone anisotropy. The consequences of these dispersion properties for the emissivity of the fundamental harmonic X-mode are analyzed for perpendicular propagation. The emissivity, is calculated for two types of distribution functions having a loss-cone anisotropy. These distribution functions are a relativistic Dory-Guest-Harris type distribution function and modified relativistic Maxwellian distribution having a loss-cone with rounded edges (author). 9 refs.; 2 figs

  20. Cyclotron Production of Technetium-99m

    Science.gov (United States)

    Gagnon, Katherine M.

    Technetium-99m (99mTc) has emerged as the most widely used radionuclide in medicine and is currently obtained from a 99Mo/ 99mTc generator system. At present, there are only a handful of ageing reactors worldwide capable of producing large quantities of the parent isotope, 99Mo, and owing to the ever growing shutdown periods for maintenance and repair of these ageing reactors, the reliable supply 99mTc has been compromised in recent years. With an interest in alternative strategies for producing this key medical isotope, this thesis focuses on several technical challenges related to the direct cyclotron production of 99mTc via the 100Mo(p,2n)99mTc reaction. In addition to evaluating the 100Mo(p,2n)99mTc and 100Mo(p,x)99Mo reactions, this work presented the first experimental evaluation of the 100Mo(p,2n) 99gTc excitation function in the range of 8-18 MeV. Thick target calculations suggested that large quantities of cyclotron-produced 99mTc may be possible. For example, a 6 hr irradiation at 500 μA with an energy window of 18→10 MeV is expected to yield 1.15 TBq of 99mTc. The level of coproduced 99gTc contaminant was found to be on par with the current 99Mo/99mTc generator standard eluted with a 24 hr frequency. Highly enriched 100Mo was required as the target material for 99mTc production and a process for recycling of this expensive material is presented. An 87% recovery yield is reported, including metallic target preparation, irradiation, 99mTc extraction, molybdate isolation, and finally hydrogen reduction to the metal. Further improvements are expected with additional optimization experiments. A method for forming structurally stable metallic molybdenum targets has also been developed. These targets are capable of withstanding more than a kilowatt of beam power and the reliable production and extraction of Curie quantities of 99mTc has been demonstrated. With the end-goal of using the cyclotron-produced 99mTc clinically, the quality of the cyclotron

  1. Fragment-separator at the U-400 cyclotron. (The Technical proposal)

    International Nuclear Information System (INIS)

    Majdikov, V.Z.; Bashevoj, V.V.

    1998-01-01

    The ion-optical calculations together with graphical modeling show some possibility to create the low-energy fragment-separator for the RIB experiments performed at the Coulomb barrier of interactions at the U-400 cyclotron. Combination of two available magnetic dipoles SP-95 and SP-97 without any additional focussing elements at the cyclotron switchyard permits one to obtain the parameters of the RIB separator adequate for the modern experiments performance

  2. <600> MeV synchro-cyclotron

    CERN Multimedia

    CERN PhotoLab

    1971-01-01

    One of the 14 pancakes of the new magnet coils for the 600 MeV synchro-cyclotron which were wound and coated with epoxy resin on the CERN site. These new coils will replace the present ones which have been in use for more than 14 years but are now showing signs of deteriorations.

  3. Hybrid simulation of electron cyclotron resonance heating

    Energy Technology Data Exchange (ETDEWEB)

    Ropponen, T. [Department of Physics, University of Jyvaeskylae, P.O. Box 35, FI-40014 (Finland)], E-mail: tommi.ropponen@phys.jyu.fi; Tarvainen, O. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Suominen, P. [CERN Geneve 23, CH-1211 (Switzerland); Koponen, T.K. [Department of Physics, University of Jyvaeskylae, Nanoscience Center, P.O. Box 35, FI-40014 (Finland); Kalvas, T.; Koivisto, H. [Department of Physics, University of Jyvaeskylae, P.O. Box 35, FI-40014 (Finland)

    2008-03-11

    Electron Cyclotron Resonance (ECR) heating is a fundamentally important aspect in understanding the physics of Electron Cyclotron Resonance Ion Sources (ECRIS). Absorption of the radio frequency (RF) microwave power by electron heating in the resonance zone depends on many parameters including frequency and electric field strength of the microwave, magnetic field structure and electron and ion density profiles. ECR absorption has been studied in the past by e.g. modelling electric field behaviour in the resonance zone and its near proximity. This paper introduces a new ECR heating code that implements damping of the microwave power in the vicinity of the resonance zone, utilizes electron density profiles and uses right hand circularly polarized (RHCP) electromagnetic waves to simulate electron heating in ECRIS plasma.

  4. A 600 MeV cyclotron for radioactive beam production

    International Nuclear Information System (INIS)

    Clark, D.J.

    1993-01-01

    The magnetic field design for a 600 MeV proton cyclotron is described. The cyclotron has a single stage, a normal conducting magnet coil and a 9.8 m outside yoke diameter. It has 8 sectors, with a transition to 4 sectors in the center region. The magnetic field design was done using 1958 Harwell rectangular ridge system measurements and was compared with recent 3-dimensional field calculations with the program TOSCA at NSCL. The center region 4--8 sector transition focussing was also checked with TOSCA

  5. Polarized electron cyclotron emission in the Tokapole II Tokamak

    International Nuclear Information System (INIS)

    Sengstacke, M.A.; Dexter, R.N.; Prager, S.C.

    1984-06-01

    To examine the effect of wall reflections we have measured the polarization of second harmonic cyclotron emission (at omega = 2 omega/sub ce/) in the Tokapole II tokamak both with and without a microwave absorber installed within the field of view of the receiving antenna. Indeed, the local elimination of wall reflections markedly enhances the polarization, as described in section II. Section III describes observations consistent with right-hand cutoff effects and an attempt to infer the electron temperature from cyclotron emission in an optically thin plasma

  6. The Juelich compact cyclotron - a multi-purpose irradiation facility

    International Nuclear Information System (INIS)

    Hemmerich, J.; Hoelzle, R.; Kogler, W.

    1977-01-01

    A commercially available variable-energy compact cyclotron has been installed at the Kernforschungsanlage Juelich. It is equipped to accelerate protons, deuterons, 3 He- and α-particles. A +- 60 0 switching magnet allows to switch the beam to any of seven external target stations. Three separately shielded target rooms allow a flexible use of the cyclotron for a wide range of applications such as production of short-lived nuclides, activation analysis, radiation damage studies in metals and studies of biological effects of fast neutron irradiation. (orig.) [de

  7. On the parametric cyclotron heating of a toroidal plasma

    International Nuclear Information System (INIS)

    Golovanivsky, K.C.; Punithavelu, A.M.

    1976-01-01

    The possibility of heating the ionic component of a dense plasma at the parametric cyclotron resonance, using a section of the conducting toroidal chamber of a large scale Tokamak as a resonance cavity, is considered. It is suggested to use the mode TE 011 to overcome the difficulties with the penetration of HF fields into such a dense plasma. The experimental investigation of parametric cyclotron heating of electrons in a overdense plasma (n/nsub(cut off)=10 2 ) on such a model has given hopeful results

  8. ELECTRON CYCLOTRON CURRENT DRIVE EFFICIENCY IN GENERAL TOKAMAK GEOMETRY

    International Nuclear Information System (INIS)

    LIN-LUI, Y.R; CHAN, V.S; PRATER, R.

    2003-01-01

    Green's-function techniques are used to calculate electron cyclotron current drive (ECCD) efficiency in general tokamak geometry in the low-collisionality regime. Fully relativistic electron dynamics is employed in the theoretical formulation. The high-velocity collision model is used to model Coulomb collisions and a simplified quasi-linear rf diffusion operator describes wave-particle interactions. The approximate analytic solutions which are benchmarked with a widely used ECCD model, facilitate time-dependent simulations of tokamak operational scenarios using the non-inductive current drive of electron cyclotron waves

  9. Analysis for liquid cryogen spillage in the superconducting cyclotron building at VECC

    CERN Document Server

    Roy S ,; Pal, G; Bhandari, R K

    2009-01-01

    The cryogenic system uses liquid helium and liquid nitrogen to cool the superconducting cyclotron magnet and its cryopanels. In order to assess safety scenarios subsequent to an unusual leakage of cryogens from the system, a deterministic analysis has been carried out to estimate the variation of oxygen concentration with time at several locations of superconducting cyclotron building. The entire process is simulated assuming evaporated cryogens mixes instantaneously with air in the confined space, the ventilation system of the cyclotron building is operational, fresh air continuously enters the confined volume and mixes instantaneously with air in the confined space.

  10. The Data Cyclotron query processing scheme.

    NARCIS (Netherlands)

    R.A. Goncalves (Romulo); M.L. Kersten (Martin)

    2011-01-01

    htmlabstractA grand challenge of distributed query processing is to devise a self-organizing architecture which exploits all hardware resources optimally to manage the database hot set, minimize query response time, and maximize throughput without single point global coordination. The Data Cyclotron

  11. Standardized high current solid targets for cyclotron production of radionuclides

    International Nuclear Information System (INIS)

    Al-Jammaz, Ibrahim

    2000-01-01

    The Cyclotron and Radiopharmaceuticals Department (CRP) is an advanced and modern facility that encompasses two essential components: radioisotope research, and radiopharmaceuticals manufacturing. Radiopharmaceuticals manufacturing program is not only quite unique, but also an essential component of King Faisal Specialist Hospital and Research Center (KFSH and RC) in providing quality patient care for the population of the Kingdom. Accurate diagnosis and therapy with medical imaging equipment requires quality radiopharmaceuticals that are available readily and with reliability. The CRP Department provides that quality and reliability. Research activities of the CRP Department are focused on developing new radiotracers with potential usefulness in biomedical research and clinical applications. Research projects consist of: developing cyclotron targetry for radioisotope production; developing synthesis methods for radiolabeling biomolecules; and developing analytical methods for quality control. The CRP Department operates a semi-commercial radiopharmaceuticals manufacturing program that supplies the diagnostic radioactive products to several hospitals in the Kingdom and neighboring countries. These products for clinical applications are produced according to the international standards of Good Manufacturing Practices of quality and efficacy. At the heart of the radioisotope program is a medium energy cyclotron capable of accelerating a number of particles for transformation of non-radioactive atoms into radionuclides that are the primary sources for research and development activities, and for preparing radiopharmaceuticals. In addition to having the only cyclotron facility in the region, KFSH and RC also has the only Positron Emission Tomography Center (PET) in this part of the world. This combination of cyclotron and the ultra modern PET facility translates into advanced and specialized care for the patients at KFSH and RC

  12. Research activities by INS cyclotron facility

    International Nuclear Information System (INIS)

    1992-06-01

    Research activities made by the cyclotron facility and the related apparatuses at Institute for Nuclear Study (INS), University of Tokyo, have been reviewed in terms of the associated scientific publications. This publication list, which is to be read as a continuation of INS-Rep.-608 (October, 1986), includes experimental works on low-energy nuclear physics, accelerator technology, instrumental developments, radiation physics and other applications in interdisciplinary fields. The publications are classified into the following four categories. (A) : Internal reports published in INS. (B) : Publications in international scientific journals on experimental research works done by the cyclotron facility and the related apparatuses at INS. Those made by outside users are also included. (C) : Publications in international scientific journals on experimental low-energy nuclear physics, which have been done by the staff of INS Nuclear Physics Division using facilities outside INS. (D) : Contributions to international conferences. (author)

  13. Neutron radiography with the cyclotron, 3

    International Nuclear Information System (INIS)

    Hiraoka, Eiichi; Fujishiro, Masatoshi; Tsujii, Yukio

    1985-01-01

    Neutron radiography is well recognized as a powerful tool in nondestructive testing, but not widely used yet owing to lack of high intense thermal neutron source convenient for practical use. A new neutron radiograph facility, utilizing a sub-compact cyclotron as neutron source and equipped with vertical and horizontal irradiation ports, is presented in this article. A series of experiment, prior to its construction, was conducted using beams of a variable energy cyclotron at Tohoku University to investigate the characteristics of thermal neutron obtained, from 9 Be (p, n) reaction and thermalized by elastic scattering process. This article describes a computer simulation of neutron moderator to analyze conditions getting maximal thermal neutron flux. Some of practical neutron radiograph examination of aero-space components and museum art objects of classic bronze mirror are also presented together with an attempt realizing real time imaging technique. (author)

  14. The beam commissioning of BRIF and future cyclotron development at CIAE

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Tianjue, E-mail: tjzhang@ciae.ac.cn; Yang, Jianjun, E-mail: yangjianjun2000@tsinghua.org.cn

    2016-06-01

    As an upgrade project of the existing HI-13 tandem accelerator facility, the Beijing Radioactive Ion-beam Facility (BRIF) is being constructed in China Institute of Atomic Energy (CIAE). This project consists of an 100 MeV proton compact cyclotron, a two-stage ISOL system, a superconducting linac booster and various experimental terminals. The beam commissioning of the cyclotron was launched by the end of 2013 and on July 4, 2014 the first 100 MeV proton beam was received on a temporary target which was positioned at the outlet of the cyclotron. The beam current was stably maintained at above 25 μA for about 9 h on July 25, 2014 and the cyclotron is now ready for providing CW proton beam on target-source for RIB production. The beam current is expected to be increased to 200–500 μA in the coming years. The installation of the ISOL system is finished and the stable ion beam test shows it can reach a mass resolution better than 10,000. It is expected to generate dozens of RIB by 100 MeV proton beam. In addition, this paper also introduces the recent progress of the pre-study of an 800 MeV, 3–4 MW separate-sector proton cyclotron, which is aimed to provide high power proton beam for various applications, such as neutron and neutrino physics, proton radiography and nuclear data measurement and ADS system.

  15. Foil changer for the Chalk River superconducting cyclotron

    International Nuclear Information System (INIS)

    Hoffmann, C.R.; Kilborn, R.I.; Mouris, J.F.; Proulx, D.R.; Weaver, J.F.

    1985-01-01

    Capture of an injected beam in the Chalk River superconducting cyclotron requires that a carbon stripping foil be accurately placed in a dee to intercept the incoming beam. Foil radial position must be precisely adjustable and foils must be easily replaced. A foil changing apparatus has been designed, built and tested to meet these requirements. The main components are a supply magazine, a transport system, and unloading and loading mechanisms. The magazine is on top of the loading mechanisms. The magazine is on top of the cyclotron. It holds 300 foils and can be isolated from machine vacuum for refilling. Each foil is mounted on a stainless steel frame. A stainless steel roller chain fitted with 33 copper sleeves (shrouds) carries foils, one per shroud, down a dee stem to the midplane. A 12-bit absolute optical shaft encoder senses foil position. To replace a foil a shroud is positioned at the top of the cyclotron, a foil is removed, and another is transferred from the magazine to the empty shroud. Three stepping motors and associated electronics provide mechanical drive and are interfaced with a CAMAC control system

  16. Characteristics of possible beam losses in superconducting cyclotron

    International Nuclear Information System (INIS)

    Pradhan, J.; Paul, Santanu; Debnath, Jayanta; Dutta, Atanu; Bhunia, Uttam; Naser, Md. Zamal Abdul; Singh, Vinay; Agrawal, Ankur; Dey, Malay Kanti

    2015-01-01

    In a compact superconducting cyclotron large coherent oscillation and off-centering of the beam may cause large amount of beam loss. The off-centered beam may hit the beam chamber wall prohibiting extraction of the beam. Or it may hit the RF liner surfaces due to vertical blow-up across various resonances during acceleration. The vertical shift of beam caused by the mis-alignment gradually moves the beam out of geometrical median plane eventually leading to internal beam losses. The loss of isochronisms results the reduction of beam intensity depending on the particle phase history. Small field perturbations generated by trim coils have been used to identify the beam loss mechanisms in the superconducting cyclotron at out centre. Besides, the beam loss due to interaction of accelerating ions with residual gases is also discussed. The beam profile obtained from differential and three finger probes gives a clear insight of the loss-mechanism. The paper describes different beam losses observed in the cyclotron with corresponding beam profiles under different field perturbations, Special emphasis is given on characteristics features of beam-current profile to identify the cause of beam loss. (author)

  17. Isochronous cyclotron closed equilibrium orbit calculation program description

    International Nuclear Information System (INIS)

    Kiyan, I.N.; Vorozhtsov, S.B.; Tarashkevich, R.

    2003-01-01

    The Equilibrium Orbit Research Program - EORP, written in C++ with the use of Visual C++ is described. The program is intended for the calculation of the particle rotation frequency and particle kinetic energy in the closed equilibrium orbits of an isochronous cyclotron, where the closed equilibrium orbits are described through the radius and particle momentum angle: r eo (θ) and φ p (θ). The program algorithm was developed on the basis of articles, lecture notes and original analytic calculations. The results of calculations by the EORP were checked and confirmed by using the results of calculations by the numerical methods. The discrepancies between the EORP results and the numerical method results for the calculations of the particle rotation frequency and particle kinetic energy are within the limits of ±1·10 -4 . The EORP results and the numerical method results for the calculations of r eo (θ) and φ p (θ) practically coincide. All this proves the accuracy of calculations by the EORP for the isochronous cyclotrons with the azimuthally varied fields. As is evident from the results of calculations, the program can be used for the calculations of both straight - sector and spiral-sector isochronous cyclotrons. (author)

  18. Thermal effects on parallel-propagating electron cyclotron waves

    International Nuclear Information System (INIS)

    Robinson, P.A.

    1987-01-01

    Thermal effects on the dispersion of right-handed electron cyclotron waves propagating parallel to a uniform, ambient magnetic field are investigated in the strictly non-relativistic ('classical') and weakly relativistic approximations for real frequency and complex wave vector. In each approximation, the two branches of the RH mode reconnect near the cyclotron frequency as the plasma temperature is increased or the density is lowered. This reconnection occurs in a manner different from that previously assumed at parallel propagation and from that at perpendicular propagation, giving rise to a new mode near the cold plasma cut-off frequency ωsub(xC). For both parallel and perpendicular propagation, it is noted that reconnection occurs approximately when the cyclotron linewidth equals the width of the stop-band in the cold plasma dispersion relation. Inclusion of weakly relativistic effects is found to be necessary for quantitative calculations and for an accurate treatment of the new mode near ωsub(xC). Weakly relativistic effects also modify the analytic properties of the dispersion relation so as to introduce a new family of weakly damped and undamped solutions. (author)

  19. Ion sources for cyclotron applications

    International Nuclear Information System (INIS)

    Leung, K.N.; Bachman, D.A.; McDonald, D.S.; Young, A.T.

    1992-07-01

    The use of a multicusp plasma generator as an ion source has many advantages. The development of both positive and negative ion beams based on the multicusp source geometry is presented. It is shown that these sources can be operated at steady state or cw mode. As a result they are very suitable for cyclotron operations

  20. Status report on cyclotron operation

    CERN Document Server

    Kovács, P; Ander, I; Lakatos, T; Fenyvesi, A; Ditrói, F; Takács, S; Tarkanyi, F

    2003-01-01

    The operation of the cyclotron in 2002 was concentrated to 9 months; January, July and August were reserved for maintenance and holidays. The overall working time of the accelerator was 4084 hours, the breakdown periods amounted to 15 hours last year. In order to improve the circumstances of the irradiations, several following improvements were done. (R.P.)

  1. Nonlinear Cyclotron absorption of a hole doppleron in cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Voloshin, I.F.; Bugal' ter, G.A.; Demikhovskii, V.Y.; Fisher, L.M.; Yudin, V.A.

    1977-10-01

    We investigated experimentally the nonlinear behavior of the impedance of a cadmium plate in the region of existence of the hole doppleron. It is shown theoretically that this phenomenon can be attributed to nonlinear cyclotron absorption of the wave in the metal. A theory of nonlinear cyclotron absorption of a hole doppleron in cadmium is constructed. The nonlinearity is due to the influence of the wave magnetic field H that alters the trajectories of the resonant electrons responsible for the cyclotron asorption. The Lorentz force connected with the field H modulates the particle velocity along the magnetic field at a characteristic frequency ..omega../sub 0/ proportional to the square root of the wave amplitude. The modulation of the longitudinal particle velocity leads to violation of the condition of their resonant interaction with the wave, as a result of which the absorption coefficient decreases. The nonlinearity is significant when the frequency ..omega../sub 0/ is large compared with the electron-collision frequency. A decrease of the cyclotron absorption changes radically the picture of the surface-impedance oscillations of the plate in the magnetic field. We studied in the experiment the influence of the temperature, of the angle of inclination of the magnetic field, and of the frequency on the nonlinear-effect threshold field that separates the regions of linear and nonlinear behavior of the sample impedance. The measurement results are in qualitative agreement with the conclusions of the theory.

  2. Design Study of a Mini Cyclotron for the Application of Biomedical Accelerator Mass Spectrometry

    International Nuclear Information System (INIS)

    Kim, Jong-Won; Yun, Chong-Chul; Youn, Min-Yong; Wang, Sonjong

    2009-01-01

    A small cyclotron has been considered for the use of biomedical accelerator mass spectrometer (BAMS). Over a decade ago a few cyclotrons had been constructed and tested for AMS, but technical problems of instability and poor transmission efficiency caused to discontinue further developments. The major reason of the demise of cyclotron AMS was the dominance of commercial Tandem-based AMS facilities. Now BAMS may ask for more compact system, and perhaps using positive ions to accelerate isotope tracers is a favorable feature. The design of a cyclotron to meet the requirements of BAMS has been performed by adopting a compact magnet with high stability and a flat-topping rf system to increase transmission efficiency.

  3. Electron cyclotron heating (ECH) of tokamak plasmas

    International Nuclear Information System (INIS)

    Hoshino, Katsumichi

    1990-01-01

    Electron cyclotron heating (ECH) is one of the intense methods of plasma heating, and which utilizes the collisionless electron-cyclotron-resonance-interaction between the launched electromagnetic waves (called electron cyclotron waves) and electrons which are one of the constituents of the high temperature plasmas. Another constituent, namely the ions which are subject to nuclear fusion, are heated indirectly but strongly and instantly (in about 0.1 s) by the collisions with the ECH-heated electrons in the fusion plasmas. The recent progress on the development of high-power and high-frequency millimeter-wave-source enabled the ECH experiments in the middle size tokamaks such as JFT-2M (Japan), Doublet III (USA), T-10 (USSR) etc., and ECH has been demonstrated to be the sure and intense plasma heating method. The ECH attracts much attention for its remarkable capabilities; to produce plasmas (pre-ionization), to heat plasmas, to drive plasma current for the plasma confinement, and recently especially by the localization and the spatial controllability of its heating zone, which is beneficial for the fine controls of the profiles of plasma parameters (temperature, current density etc.), for the control of the magnetohydrodynamic instabilities, or for the optimization/improvement of the plasma confinement characteristics. Here, the present status of the ECH studies on tokamak plasmas are reviewed. (author)

  4. Operation of a quasioptical electron cyclotron maser

    International Nuclear Information System (INIS)

    Morse, E.C.; Pyle, R.V.

    1984-12-01

    The electron cyclotron maser or gyrotron concept has been developed to produce sources producing 200 kW at 28 GHz continuously, and higher power outputs and frequencies in pulsed mode. These sources have been useful in electron cyclotron resonance heating (ECRH) in magnetically confined fusion devices. However, higher frequencies and higher power levels will be required in reactor-grade fusion plasmas, with likely requirements of 1.0 MW or more per source at 140 GHz. Conventional gyrotrons follow a trend of decreasing power for increasing frequency. In order to circumvent this problem, the quasioptical electron cyclotron maser was proposed. In this device, the closed resonator of the conventional gyrotron is replaced with an open, Fabry-Perot type resonator. The cavity modes are then the TEM-type modes of an optical laser. The advantage of this configuration is that the cavity size is not a function of frequency, since the length can be any half-integer number of wavelengths. Furthermore, the beam traverses across the cavity transverse to the direction of radiation output, and thus the rf window design is less complicated than in conventional tubes. The rf output, if obtained by diffraction coupling around one of the mirrors, could be in a TEM mode, which would allow for quasioptical transmission of the microwaves into the plasma in fusion devices. 4 references, 1 figure

  5. Tokamak startup with electron cyclotron heating

    International Nuclear Information System (INIS)

    Holly, D.J.; Prager, S.C.; Shepard, D.A.; Sprott, J.C.

    1980-04-01

    Experiments are described in which the startup voltage in a tokamak is reduced by approx. 60% by the use of a modest amount of electron cyclotron resonance heating power for preionization. A 50% reduction in volt-second requirement and impurity reflux are also observed

  6. Tokamak startup with electron cyclotron heating

    Energy Technology Data Exchange (ETDEWEB)

    Holly, D J; Prager, S C; Shepard, D A; Sprott, J C

    1980-04-01

    Experiments are described in which the startup voltage in a tokamak is reduced by approx. 60% by the use of a modest amount of electron cyclotron resonance heating power for preionization. A 50% reduction in volt-second requirement and impurity reflux are also observed.

  7. A compact cost-effective beamline for a PET Cyclotron

    International Nuclear Information System (INIS)

    Dehnel, M.P.; Jackle, P.; Roeder, M.; Stewart, T.; Theroux, J.; Brasile, J.P.; Sirot, P.; Buckley, K.R.; Bedue, M.

    2007-01-01

    Most commercial PET Cyclotrons have targets mounted on or near the main cyclotron vacuum chamber. There is often little or no system capability for centering or focusing the extracted beam on target to achieve maximum production. This paper describes the ion-optics, design and development of a compact cost-effective beamline comprised of low activation and radiation resistant materials. The beamline, complete with suitable diagnostic devices, permits the extracted proton beam to be centered (X-Y steering magnet), and focused (quadrupole doublet) on target eliminating unnecessary beamspill and ensuring high production

  8. Design study of an ultra-compact superconducting cyclotron for isotope production

    Science.gov (United States)

    Smirnov, V.; Vorozhtsov, S.; Vincent, J.

    2014-11-01

    A 12.5 MeV, 25 μA, proton compact superconducting cyclotron for medical isotope production has been designed and is currently in fabrication. The machine is initially aimed at producing 13N ammonia for Positron Emission Tomography (PET) cardiology applications. With an ultra-compact size and cost-effective price point, this system will offer clinicians unprecedented access to the preferred radiopharmaceutical isotope for cardiac PET imaging. A systems approach that carefully balanced the subsystem requirements coupled to precise beam dynamics calculations was followed. The system is designed to irradiate a liquid target internal to the cyclotron and to minimize the need for radiation shielding. The main parameters of the cyclotron, its design, and principal steps of the development work are presented here.

  9. Fast wave and electron cyclotron current drive in the DIII-D tokamak

    International Nuclear Information System (INIS)

    Petty, C.C.; Pinsker, R.I.; Austin, M.E.

    1995-01-01

    The non-inductive current drive from directional fast Alfven and electron cyclotron waves was measured in the DIII-D tokamak in order to demonstrate these forms of radiofrequency (RF) current drive and to compare the measured efficiencies with theoretical expectations. The fast wave frequency was 8 times the deuterium cyclotron frequency at the plasma centre, while the electron cyclotron wave was at twice the electron cyclotron frequency. Complete non-inductive current drive was achieved using a combination of fast wave current drive (FWCD) and electron cyclotron current drive (ECCD) in discharges for which the total plasma current was inductively ramped down from 400 to 170 kA. For steady current discharges, an analysis of the loop voltage revealed up to 195 kA of a non-inductive current (out of 310 kA) during combined electron cyclotron and fast wave injection, with a maximum of 110 kA of FWCD and 80 kA of ECCD achieved (not simultaneously). The peakedness of the current profile increased with RF current drive, indicating that the driven current was centrally localized. The FWCD efficiency increased linearly with the central electron temperature as expected; however, the FWCD was severely degraded in low current discharges owing to incomplete fast wave absorption. The measured FWCD agreed with the predictions of a ray tracing code only when a parasitic loss of 4% per pass was included in the modelling along with multiple pass absorption. Enhancement of the second harmonic ECCD efficiency by the toroidal electric field was observed experimentally. The measured ECCD was in good agreement with Fokker-Planck code predictions. (author). 41 refs, 13 figs, 1 tab

  10. The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters

    International Nuclear Information System (INIS)

    Iazzourene, F.

    1982-01-01

    The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr

  11. Linear and nonlinear physics of the magnetoacoustic cyclotron instability of fusion-born ions in relation to ion cyclotron emission

    Energy Technology Data Exchange (ETDEWEB)

    Carbajal, L., E-mail: L.Carbajal-Gomez@warwick.ac.uk; Cook, J. W. S. [Centre for Fusion, Space and Astrophysics, Department of Physics, The University of Warwick, Coventry CV4 7AL (United Kingdom); Dendy, R. O. [EURATOM/CCFE Fusion Association, Culham Science Centre, Abingdon OX14 3DB, Oxfordshire (United Kingdom); Centre for Fusion, Space and Astrophysics, Department of Physics, The University of Warwick, Coventry CV4 7AL (United Kingdom); Chapman, S. C. [Centre for Fusion, Space and Astrophysics, Department of Physics, The University of Warwick, Coventry CV4 7AL (United Kingdom); Department of Mathematics and Statistics, University of Tromsø, N-9037, Tromsø (Norway); Max Planck Institute for the Physics of Complex Systems, D-01187, Dresden (Germany)

    2014-01-15

    The magnetoacoustic cyclotron instability (MCI) probably underlies observations of ion cyclotron emission (ICE) from energetic ion populations in tokamak plasmas, including fusion-born alpha-particles in JET and TFTR [Dendy et al., Nucl. Fusion 35, 1733 (1995)]. ICE is a potential diagnostic for lost alpha-particles in ITER; furthermore, the MCI is representative of a class of collective instabilities, which may result in the partial channelling of the free energy of energetic ions into radiation, and away from collisional heating of the plasma. Deep understanding of the MCI is thus of substantial practical interest for fusion, and the hybrid approximation for the plasma, where ions are treated as particles and electrons as a neutralising massless fluid, offers an attractive way forward. The hybrid simulations presented here access MCI physics that arises on timescales longer than can be addressed by fully kinetic particle-in-cell simulations and by analytical linear theory, which the present simulations largely corroborate. Our results go further than previous studies by entering into the nonlinear stage of the MCI, which shows novel features. These include stronger drive at low cyclotron harmonics, the re-energisation of the alpha-particle population, self-modulation of the phase shift between the electrostatic and electromagnetic components, and coupling between low and high frequency modes of the excited electromagnetic field.

  12. Instructional materials for SARA/OSHA training. Volume 1, General site working training

    Energy Technology Data Exchange (ETDEWEB)

    Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)

    1988-04-01

    This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.

  13. Intelligent low-level RF system by non-destructive beam monitoring device for cyclotrons

    Science.gov (United States)

    Sharifi Asadi Malafeh, M. S.; Ghergherehchi, M.; Afarideh, H.; Chai, J. S.; Yoon, Sang Kim

    2016-04-01

    The project of a 10 MeV PET cyclotron accelerator for medical diagnosis and treatment was started at Amirkabir University of Technology in 2012. The low-level RF system of the cyclotron accelerator is designed to stabilize acceleration voltage and control the resonance frequency of the cavity. In this work an Intelligent Low Level Radio Frequency Circuit or ILLRF, suitable for most AVF cyclotron accelerators, is designed using a beam monitoring device and narrow band tunable band-pass filter. In this design, the RF phase detection does not need signal processing by a microcontroller.

  14. Research and education by SF cyclotron facility

    International Nuclear Information System (INIS)

    1992-04-01

    This report represents the current activities in research and education using the cyclotron facility and related apparatus which are supported by Nuclear Physics Division and this is a continuation of INS-T-466 (1986, December). In this version an iron-free β-ray spectrometer and a cooler-synchrotron (TARN II) are briefly described also in the first chapter. The second chapter explains experimental programs performed in the last 5 years. The third chapter gives the number of publications on researches performed in 1975-1991, and also gives twelve topics obtained from the cyclotron and the β-ray spectrometer in recent 5 years. The last chapter provides the whole list of the works for Doctor and Master theses performed at the facility in the last 10 years. (J.P.N.)

  15. Helical axial injection concept for cyclotrons

    Energy Technology Data Exchange (ETDEWEB)

    Hudson, E.D.

    1981-01-01

    A concept for an external beam injection system using a helical beam path centered on the cyclotron axis is described. This system could be used to couple two accelerator stages, with or without intermediate stripping, in cases where conventional axial injection or radial injection are not practical.

  16. Helical axial injection concept for cyclotrons

    International Nuclear Information System (INIS)

    Hudson, E.D.

    1981-01-01

    A concept for an external beam injection system using a helical beam path centered on the cyclotron axis is described. This system could be used to couple two accelerator stages, with or without intermediate stripping, in cases where conventional axial injection or radial injection are not practical

  17. Ion-cyclotron instability in magnetic mirrors

    International Nuclear Information System (INIS)

    Pearlstein, L.D.

    1987-01-01

    This report reviews the role of ion-cyclotron frequency instability in magnetic mirrors. The modes discussed here are loss-cone or anisotropy driven. The discussion includes quasilinear theory, explosive instabilities of 3-wave interaction and non-linear Landau damping, and saturation due to non-linear orbits

  18. Excitation of electrostatic ion cyclotron wave in electron beam plasma system

    International Nuclear Information System (INIS)

    Fukumura, Takashi; Takamoto, Teruo

    1984-01-01

    The electrostatic ion cyclotron waves excited in an electron beam plasma system was investigated. The excitation condition of the waves was calculated by using Harris type dispersion relation under some assumption, and its comparison with the experimental result was made. Beam plasma discharge is a kind of RF discharge, and it is caused by the waves generated by the interaction of electron beam with plasma. It was shown that electrostatic ion cyclotron waves seemed to be the most probable as excited waves. But the excitation mechanism of these waves has not been concretely investigated. In this study, the excitation condition of electrostatic ion cyclotron waves was calculated as described above. The experimental apparatus and the results of potential, electric field and ion saturation current in beam plasma, electron drift motion in azimuthal direction and the waves excited in beam plasma are reported. The frequency of oscillation observed in beam plasma corresponds to the harmonics or subharmonics of ion cyclotron frequency. The calculation of Harris type dispersion relation, the numerical calculation and the comparison of the experimental result with the calculated result are described. (Kako, I.)

  19. Design study of electrostatic inflector in compact cyclotron injection system

    International Nuclear Information System (INIS)

    Zhang Tianjue; Fan Mingwu

    1996-01-01

    The beam dynamics behaviour in electrostatic inflector is investigated for a vertical type injection system to a compact cyclotron. The computer aided design and matching of the inflector are based on the simulation of computed beam orbit. Modeling and simulation are done on PC-486 to form a software package. The software package can be used to develop a new type cyclotron design combining with the software package CYCCAE developed by China Institute of Atomic Energy three years ago

  20. Status report on RIKEN Ring Cyclotron

    International Nuclear Information System (INIS)

    Yano, Y.

    1988-01-01

    This paper gives a status report on RIKEN Ring Cyclotron (RRC), successfully commissioned on December 16, 1986. The routine operation of RRC began in April, 1987, and was made until March 1988. April and May were devoted to the machine studies, and beams were delivered to the experiments from the end of May. Seven kinds of ion species from carbon to copper were used for the nuclear physics and atomic physics experiments during these one-year runs. High quality beams with transverse emittances less than 10 mm mrad, energy spread of approximately 0.1% and pulse width less than 300 psec were extracted. Since the middle of March, 1988, RRC has been shut down for extending the beam transfer lines and installing the various experimental setups. Next experimental program will start in July, 1988. The initial operational status of RRC is described as well as the running construction program of the new injector, a K70 AVF cyclotron with an external ECR ion source

  1. A new slow positron beam facility using a compact cyclotron

    International Nuclear Information System (INIS)

    Hirose, Masafumi

    1998-01-01

    In 1993, Sumitomo Heavy Industries became the first in the world to successfully produce a slow positron beam using a compact cyclotron. Slow positron beam production using an accelerator had mainly consisted of using an electron linear accelerator (LINAC). However, the newly developed system that uses a compact cyclotron enabled cost reduction, downsizing of equipment, production of a DC slow positron beam, a polarized slow positron beam, and other benefits. After that, a genuine slow positron beam facility was developed with the construction of compact cyclotron No.2, and beam production in the new facility has already been started. The features of this new slow positron beam facility are explained below. 1) It is the world's first compact slow positron beam facility using a compact cyclotron. 2) It is the only genuine slow positron beam facility in the world which incorporates the production and use of a slow positron beam in the design stage of the cyclotron. To use a slow positron beam for non-destructive detection of lattice defects in semiconductor material, it is necessary to convert the beam into ultra-short pulses of several hundreds of pico-seconds. Sumitomo Heavy Industries has devised a new short-pulsing method (i.e. an induction bunching method) that enables the conversion of a slow positron beam into short pulses with an optimum pulsing electric field change, and succeeded in converting a slow positron beam into short pulses using this method for the first time in the world. Non-destructive detection of lattice defects in semiconductor material using this equipment has already been started, and some information about the depth distribution, size, density, etc. of lattice defects has already been obtained. (J.P.N.)

  2. Cyclotron production of Cu-61

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Ráliš, Jan; Seifert, Daniel

    2013-01-01

    Roč. 40, 2 Supplement (2013), S323-S323 ISSN 1619-7070. [Annual Congress of the European Association of Nuclear Medicine (EANM). 19.10.2013-23.10.2013, Lyon] R&D Projects: GA TA ČR TA02010797 Institutional support: RVO:61389005 Keywords : cyclotron U-120M * PET * Cu-61 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  3. Electrostatic ion-cyclotron waves in a nonuniform magnetic field

    International Nuclear Information System (INIS)

    Cartier, S.L.; D'Angelo, N.; Merlino, R.L.

    1985-01-01

    The properties of electrostatic ion-cyclotron waves excited in a single-ended cesium Q machine with a nonuniform magnetic field are described. The electrostatic ion-cyclotron waves are generated in the usual manner by drawing an electron current to a small exciter disk immersed in the plasma column. The parallel and perpendicular (to B) wavelengths and phase velocities are determined by mapping out two-dimensional wave phase contours. The wave frequency f depends on the location of the exciter disk in the nonuniform magnetic field, and propagating waves are only observed in the region where f> or approx. =f/sub c/i, where f/sub c/i is the local ion-cyclotron frequency. The parallel phase velocity is in the direction of the electron drift. From measurements of the plasma properties along the axis, it is inferred that the electron drift velocity is not uniform along the entire current channel. The evidence suggests that the waves begin being excited at that axial position where the critical drift velocity is first exceeded, consistent with a current-driven excitation mechanism

  4. Cyclotron resonance for electrons over helium in resonator

    CERN Document Server

    Shikin, V B

    2002-01-01

    The problem on the cyclotron resonance (CR) for electrons on the helium film, positioned in the resonator lower part, is solved. It is shown, that it relates to one of the examples of the known problem on the oscillations of the coupled oscillators system. The coupling constant between these oscillators constituting the variable function of the problem parameters. It is minimal in the zero magnetic field and reaches its maximum under the resonance conditions, when the cyclotron frequency coincides with one of the resonator modes. The CR details of the Uhf CR-energy absorption coupled by the electrons + resonator system, are calculated. The applications of the obtained results to the available CR experiments for electrons over helium

  5. Cyclotron spectra from inhomogeneous accretion columns. II. Polarization

    International Nuclear Information System (INIS)

    Wu, K.; Chanmugam, G.

    1989-01-01

    Circularly and linearly polarized radiation from inhomogeneous cyclotron emission regions with uniform magnetic field and temperature but different electron density profiles are studied. Calculations show that the inhomogeneous models generally produce larger polarization for low harmonics and smaller polarization for high harmonics compared to the homogeneous models. Polarization light curves for different inhomogeneous models with a wide variety of parameters are presented, providing handy theoretical results to compare with observations. The observed polarization light curves of ST LMi, EF Eri, and BL Hydri are fitted using an inhomogeneous model for the first time, and good fits are obtained, supporting the hypothesis that the cyclotron emission regions of AM Her systems have a complicated structure. 37 refs

  6. Design of the injection channel magnets for the K1200 cyclotron

    International Nuclear Information System (INIS)

    Wu, X.Y.; Lawton, D.; Marti, F.; Zeller, A.F.

    2001-01-01

    The beam from the K500 cyclotron is injected radially into the median plane of the K1200 cyclotron where it is stripped inside a dee. Along the injection path, the injected beam traverses large magnetic gradients under the K1200 superconducting coil and on the edge of the hill. To match the injected beam to the eigen-ellipse for the accelerated beam, two magnetic elements are included in the injection channel in the yoke of the K1200 cyclotron. One of them is an active element and the other a conical focusing passive element. This last element must move in the horizontal plane to match the different beam paths. We describe in the paper the beam dynamics calculations as well as the mechanical design and construction of these magnets

  7. Realistic simulations of a cyclotron spiral inflector within a particle-in-cell framework

    Science.gov (United States)

    Winklehner, Daniel; Adelmann, Andreas; Gsell, Achim; Kaman, Tulin; Campo, Daniela

    2017-12-01

    We present an upgrade to the particle-in-cell ion beam simulation code opal that enables us to run highly realistic simulations of the spiral inflector system of a compact cyclotron. This upgrade includes a new geometry class and field solver that can handle the complicated boundary conditions posed by the electrode system in the central region of the cyclotron both in terms of particle termination, and calculation of self-fields. Results are benchmarked against the analytical solution of a coasting beam. As a practical example, the spiral inflector and the first revolution in a 1 MeV /amu test cyclotron, located at Best Cyclotron Systems, Inc., are modeled and compared to the simulation results. We find that opal can now handle arbitrary boundary geometries with relative ease. Simulated injection efficiencies and beam shape compare well with measured efficiencies and a preliminary measurement of the beam distribution after injection.

  8. Effect of ion clouds micromotion on measured signal in Fourier transform ion cyclotron resonance: Computer simulation.

    Science.gov (United States)

    Vladimirov, Gleb; Kostyukevich, Yury; Kharybin, Oleg; Nikolaev, Eugene

    2017-08-01

    Particle-in-cell-based realistic simulation of Fourier transform ion cyclotron resonance experiments could be used to generate ion trajectories and a signal induced on the detection electrodes. It has been shown recently that there is a modulation of "reduced" cyclotron frequencies in ion cyclotron resonance signal caused by Coulomb interaction of ion clouds. In this work it was proposed to use this modulation in order to determine frequency difference between an ion of known m/z and all other ions generating signal in ion cyclotron resonance cell. It is shown that with an increase of number of ions in ion cyclotron resonance trap, the modulation index increases, which lead to a decrease in the accuracy of determination of peak intensities by super Fourier transform resolution methods such as filter diagonalization method.

  9. Optimization approach for saddling cost of medical cyclotrons with fuzziness

    International Nuclear Information System (INIS)

    Abass, S.A.; Massoud, E.M.A.

    2007-01-01

    Most radiation fields are combinations of different kinds of radiation. The radiations of most significance are fast neutrons, thermal neutrons, primary gammas and secondary gammas. Thermos's composite shielding materials are designed to attenuate these types of radiation. The shielding design requires an accurate cost-benefit analysis based on uncertainty optimization technique. The theory of fuzzy sets has been employed to formulate and solve the problem of cost-benefit analysis of medical cyclotron. This medical radioisotope production cyclotron is based in Sydney, Australia

  10. The Midwest Proton Radiation Institute project at the Indiana University Cyclotron Facility

    Energy Technology Data Exchange (ETDEWEB)

    Anferov, V; Broderick, B; Collins, J C; Friesel, D L; Jenner, D; Jones, W P; Katuin, J; Klein, S B; Starks, W; Self, J; Schreuder, N [IUCF, Bloomington, Indiana 47408 (United States)

    2001-12-12

    The IUCF cyclotrons ceased delivering particle beams for physics research and became dedicated medical proton beam accelerators in 1999. Removal of the beam lines and nuclear research facilities associated with the cyclotrons to make room for the new medical beam delivery systems was completed in October, 2000. A new achromatic beam line was completed, extending from the main stage cyclotron and ending at a temporary research platform. This beam line is being commissioned during ongoing applied research. The achromatic line will deliver 0.5 {mu}A of 205 MeV protons from which the treatment room technician may draw current at any time via fast switching, laminated magnets located at the entrances to the energy selection systems upstream of each of the treatment rooms. Three treatment rooms are planned, one containing two fixed horizontal lines and two gantry rooms. The cyclotrons will also support full time research in radiation effects, single event upset, radiation biology and pre-clinical research. This contribution describes the status of the medical construction project.

  11. The National Medical Cyclotron - An Australian experience in technology

    International Nuclear Information System (INIS)

    Barnes, R. K.

    1997-01-01

    The establishment of the National Medical Cyclotron (NMC) in the early 1990's was the practical outcome of a vision, held by nuclear medicine professionals, to complement the available neutron-rich radionuclides produced in Australia, with neutron-deficient radionuclides. The NMC is operated by the Australian Nuclear Science and Technology Organisation (ANSTO) in collaboration with the Royal Prince Alfred Hospital (RPAH) in Sydney where the PET department is able to use the short-lived radiotracers to good advantage. Neutron-deficient radionuclides, are also produced by the NMC laboratories. The cyclotron-generated radionuclides are used in over 70,000 patient studies per year

  12. Gaseous radioactive effluent restrictions, measurement, and minimization at a PET/cyclotron facility

    International Nuclear Information System (INIS)

    Plascjak, P.S.; Kim, K.K.; Googins, S.W.; Meyer, W.C. Jr.

    1993-01-01

    In the US, restrictions on the release of radioactive effluents from PET (positron emission tomography)/cyclotron facilities are typically imposed by State regulatory agencies and may be based on various methodologies and limits published by numerous agencies. This work presents suitable effluent concentration limits for various chemical forms of radioisotopes routinely produced in PET/cyclotron facilities. They were determined by application of metabolic models defined by ICRP 53 and ICRP 26/30 which will result in compliance with effective dose equivalent limits of 100 mrem per year at the release point. The NIH Cyclotron Facility effluent air monitoring system, environmental dosimetry program, and simple, effective systems for radioactive effluent minimization are also described. (orig.)

  13. Experiments on ion cyclotron damping at the deuterium fourth harmonic in DIII-D

    International Nuclear Information System (INIS)

    Pinsker, R.I.; Petty, C.C.; Baity, F.W.; Bernabei, S.; Greenough, N.; Heidbrink, W.W.; Mau, T.K.; Porkolab, M.

    1999-05-01

    Absorption of fast Alfven waves by the energetic ions of an injected beam is evaluated in the DIII-D tokamak. Ion cyclotron resonance absorption at the fourth harmonic of the deuteron cyclotron frequency is observed with deuterium neutral beam injection (f = 60 MHz, B T = 1.9 T). Enhanced D-D neutron rates are evidence of absorption at the Doppler-shifted cyclotron resonance. Characteristics of global energy confinement provide further proof of substantial beam acceleration by the rf. In many cases, the accelerated deuterons cause temporary stabilization of the sawtooth (monster sawteeth), at relatively low rf power levels of ∼1 MW

  14. Calibration of the simulation model of the VINCY cyclotron magnet

    Directory of Open Access Journals (Sweden)

    Ćirković Saša

    2002-01-01

    Full Text Available The MERMAID program will be used to isochronise the nominal magnetic field of the VINCY Cyclotron. This program simulates the response, i. e. calculates the magnetic field, of a previously defined model of a magnet. The accuracy of 3D field calculation depends on the density of the grid points in the simulation model grid. The size of the VINCY Cyclotron and the maximum number of grid points in the XY plane limited by MERMAID define the maximumobtainable accuracy of field calculations. Comparisons of the field simulated with maximum obtainable accuracy with the magnetic field measured in the first phase of the VINCY Cyclotron magnetic field measurements campaign has shown that the difference between these two fields is not as small as required. Further decrease of the difference between these fields is obtained by the simulation model calibration, i. e. by adjusting the current through the main coils in the simulation model.

  15. Radiation effects testing at the 88-Inch Cyclotron at LBNL

    International Nuclear Information System (INIS)

    McMahan, Margaret A.; Koga, Rokotura

    2002-01-01

    The effects of ionizing particles on sensitive microelectronics is an important component of the design of systems as diverse as satellites and space probes, detectors for high energy physics experiments and even internet server farms. Understanding the effects of radiation on human cells is an equally important endeavor directed towards future manned missions in space and towards cancer therapy. At the 88-Inch Cyclotron at the Berkeley Laboratory, facilities are available for radiation effects testing (RET) with heavy ions and with protons. The techniques for doing these measurements and the advantages of using a cyclotron will be discussed, and the Cyclotron facilities will be compared with other facilities worldwide. RET of the same part at several facilities of varying beam energy can provide tests of the simple models used in this field and elucidate the relative importance of atomic and nuclear effects. The results and implications of such measurements will be discussed

  16. Focusing and bunching of ion beam in axial injection channel of IPHC cyclotron TR24

    Science.gov (United States)

    Adam, T.; Ivanenko, I.; Kazarinov, N.; Osswald, F.; Traykov, E.

    2017-07-01

    The CYRCe cyclotron (CYclotron pour la ReCherche et l’Enseignement) is used at IPHC (Institut Pluridisciplinaire Hubert Curien) for the production of radio-isotopes for diagnostics, medical treatments and fundamental research in radiobiology. The TR24 cyclotron produced and commercialized by ACSI (Canada) delivers a 16-25 MeV proton beam with intensity from few nA up to 500 μA. The solenoidal focusing instead of existing quadrupole one is proposed in this report. The changing of the focusing elements will give the better beam matching with the acceptance of the spiral inflector of the cyclotron. The parameters of the focusing solenoid are found. Additionally, the main parameters of the bunching system are evaluated in the presence of the beam space charge. This system consists of the buncher installed in the axial injection beam line of the cyclotron. The using of the grid-less multi harmonic buncher may increase the accelerated beam current and will give the opportunity to new proton beam applications.

  17. On the origin of cyclotron lines in the spectra of X-ray pulsars

    Directory of Open Access Journals (Sweden)

    Mushtukov A. A.

    2014-01-01

    Full Text Available Cyclotron resonance scattering features are observed in the spectra of some X-ray pulsars and show significant changes in the line energy with the pulsar luminosity. In a case of bright sources, the line centroid energy is anti-correlated with the luminosity. Such a behaviour is often associated with the onset and growth of the accretion column, which is believed to be the origin of the observed emission and the cyclotron lines. However, this scenario inevitably implies large gradient of the magnetic field strength within the line-forming region, and it makes the formation of the observed line-like features problematic. Moreover, the observed variation of the cyclotron line energy is much smaller than could be anticipated for the corresponding luminosity changes. We argue that a more physically realistic situation is that the cyclotron line forms when the radiation emitted by the accretion column is reflected from the neutron star surface. The idea is based on the facts that a substantial part of column luminosity is intercepted by the neutron star surface and the reflected radiation should contain absorption features. The reflection model is developed and applied to explain the observed variations of the cyclotron line energy in a bright X-ray pulsar V 0332+53 over a wide range of luminosities.

  18. Spiral inflector and central region study for three cyclotrons at CIAE

    International Nuclear Information System (INIS)

    Zhang Tianjue; Yao Hongjuan; Guan Fengping; Chu Chengjie; Lu Yinlong; Jia Xianlu; Zhong Junqing; Yang Jianjun; Xing Jiansheng; Lin Yuzheng

    2007-01-01

    The beam dynamics behaviour in the compact cyclotron central region is investigated. The design study for central region, including the spiral inflector, Dee tip, shield and posts, for three cyclotrons at CIAE will be described in this paper. The code development by CIAE and the UNIX based codes developed by TRIUMF were implemented on WINDOWS/PC by CIAE for the spiral inflector and central region design will be given too

  19. Magnetic component of narrowband ion cyclotron waves in the auroral zone

    Czech Academy of Sciences Publication Activity Database

    Santolík, Ondřej; Pickett, J. S.; Gurnett, D. A.; Storey, L. R. O.

    2002-01-01

    Roč. 107, A12, 1444 (2002), s. SMP 17-1-17-14, doi: 10.1029/2001JA000146 ISSN 0148-0227 R&D Projects: GA ČR GA205/01/1064 Grant - others:NASA(US) NAG5-7943 Institutional research plan: CEZ:AV0Z3042911; CEZ:MSM 113200004 Keywords : proton-cyclotron frequency * plasma wave instrument * cyclotron waves Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 2.245, year: 2002

  20. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  1. Cyclotrons as Drivers for Precision Neutrino Measurements

    International Nuclear Information System (INIS)

    Alonso, J.; Barletta, W. A.; Winslow, L. A.; Shaevitz, M. H.; Spitz, J.; Conrad, J. M.; Toups, M.; Adelmann, A.

    2014-01-01

    As we enter the age of precision measurement in neutrino physics, improved flux sources are required. These must have a well defined flavor content with energies in ranges where backgrounds are low and cross-section knowledge is high. Very few sources of neutrinos can meet these requirements. However, pion/muon and isotope decay-at-rest sources qualify. The ideal drivers for decay-at-rest sources are cyclotron accelerators, which are compact and relatively inexpensive. This paper describes a scheme to produce decay-at-rest sources driven by such cyclotrons, developed within the DAEδALUS program. Examples of the value of the high precision beams for pursuing Beyond Standard Model interactions are reviewed. New results on a combined DAEδALUS—Hyper-K search for CP violation that achieve errors on the mixing matrix parameter of 4° to 12° are presented

  2. Electron cyclotron emission imaging in tokamak plasmas

    NARCIS (Netherlands)

    Munsat, T.; Domier, C.W.; Kong, X. Y.; Liang, T. R.; N C Luhmann Jr.,; Tobias, B. J.; Lee, W.; Park, H. K.; Yun, G.; Classen, I.G.J.; Donne, A. J. H.

    2010-01-01

    We discuss the recent history and latest developments of the electron cyclotron emission imaging diagnostic technique, wherein electron temperature is measured in magnetically confined plasmas with two-dimensional spatial resolution. The key enabling technologies for this technique are the

  3. Electron-cyclotron-resonance ion sources (review)

    International Nuclear Information System (INIS)

    Golovanivskii, K.S.; Dougar-Jabon, V.D.

    1992-01-01

    The physical principles are described and a brief survey of the present state is given of ion sources based on electron-cyclotron heating of plasma in a mirror trap. The characteristics of ECR sources of positive and negative ions used chiefly in accelerator technology are presented. 20 refs., 10 figs., 3 tabs

  4. Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

    Directory of Open Access Journals (Sweden)

    Helena López

    2013-07-01

    Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.

  5. Experiments on ion cyclotron damping at the deuterium fourth harmonic in DIII-D

    International Nuclear Information System (INIS)

    Pinsker, R. I.; Baity, F. W.; Bernabei, S.; Greenough, N.; Heidbrink, W. W.; Mau, T. K.; Petty, C. C.; Porkolab, M.

    1999-01-01

    Absorption of fast Alfven waves by the energetic ions of an injected beam is evaluated in the DIII-D tokamak. Ion cyclotron resonance absorption at the fourth harmonic of the deuteron cyclotron frequency is observed with deuterium neutral beam injection (f=60 MHz, B T =1.9 T). Enhanced D-D neutron rates are evidence of absorption at the Doppler-shifted cyclotron resonance. Characteristics of global energy confinement provide further proof of substantial beam acceleration by the rf. In many cases, the accelerated deuterons cause temporary stabilization of the sawtooth (''monster sawteeth''), at relatively low rf power levels of ∼1 MW. (c) 1999 American Institute of Physics

  6. ELECTRON CYCLOTRON CURRENT DRIVE IN DIII-D: EXPERIMENT AND THEORY

    International Nuclear Information System (INIS)

    PRATER, R; PETTY, CC; LUCE, TC; HARVEY, RW; CHOI, M; LAHAYE, RJ; LIN-LIU, Y-R; LOHR, J; MURAKAMI, M; WADE, MR; WONG, K-L

    2003-01-01

    A271 ELECTRON CYCLOTRON CURRENT DRIVE IN DIII-D: EXPERIMENT AND THEORY. Experiments on the DIII-D tokamak in which the measured off-axis electron cyclotron current drive has been compared systematically to theory over a broad range of parameters have shown that the Fokker-Planck code CQL3D provides an excellent model of the relevant current drive physics. This physics understanding has been critical in optimizing the application of ECCD to high performance discharges, supporting such applications as suppression of neoclassical tearing modes and control and sustainment of the current profile

  7. Micro computer aided beam transport for the SF cyclotron

    International Nuclear Information System (INIS)

    Honma, Toshihiro; Yamazaki, Tsutomu.

    1984-01-01

    An improvement of the beam transport system for the SF cyclotron is described. The system was designed to handle on-line alignment of the beam extracted from the SF cyclotron onto the optical axis of the transport line. It also enables to measure the beam emittance. The measurement of the emittance parameters is in particular necessary to calculate the beam optics. The calculation has been modified to become easy to handle. With the help of the computer-aided on-line beam profile measurement system, the operation of the beam transport system is very subservient to shorten the beam-tuning time and to improve the beam-transmission efficiency and the quality. (author)

  8. New type sector cyclotron and improvement of EULIMA project

    International Nuclear Information System (INIS)

    Gao, Shuyang

    1988-01-01

    In this paper the two sorts of new type sector cyclotron have been discussed. Both of them remain with the same structure as straight-side sector magnet; but the annular shim systems are added on the pole faces of the every sectors. One of them has one group of the shim system; another has the three groups on the every sector. The analytical expressions of the magnetic field for the structure have been given. The linear motion stability of the particles has been proved. The new type of the compact superconducting cyclotron in the median energy is put forward as an instance for its application to the EULIMA project. (author)

  9. The National Medical Cyclotron - An Australian experience in technology

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, R K [Australian Nuclear Science and Technology Organisation (ANSTO), Lucas Heights, NSW (Australia). National Medical Cyclotron

    1998-12-31

    The establishment of the National Medical Cyclotron (NMC) in the early 1990`s was the practical outcome of a vision, held by nuclear medicine professionals, to complement the available neutron-rich radionuclides produced in Australia, with neutron-deficient radionuclides. The NMC is operated by the Australian Nuclear Science and Technology Organisation (ANSTO) in collaboration with the Royal Prince Alfred Hospital (RPAH) in Sydney where the PET department is able to use the short-lived radiotracers to good advantage. Neutron-deficient radionuclides, are also produced by the NMC laboratories. The cyclotron-generated radionuclides are used in over 70,000 patient studies per year. 7 refs., 1 tab.

  10. Injection and central region studies for the VINCY Cyclotron

    International Nuclear Information System (INIS)

    Milinkovic, L.; Toprek, D.; Brajuskovic, B.

    1992-01-01

    The central region of the VINCY Cyclotron, the main part of the TESLA Accelerator Installation, is designed to operate with two external ion sources: an ECR ion source for heavy ions, and a multicusp ion source for H - and D - ions. A tilted spiral inflector with an electric bending radius of 25 mm is used to bend the beams into the median plane of the Cyclotron at the magnetic radius of 16 mm. The optical properties of the inflector were studied, and an effort to minimize the inflector fringe field, using the RELAX3D code, for the calculation of the electric potential distribution, was made. (author) 7 refs.; 4 figs

  11. Wave trajectory and electron cyclotron heating in tokamak plasmas

    International Nuclear Information System (INIS)

    Tanaka, S.; Maekawa, T.; Terumichi, Y.; Hamada, Y.

    1980-01-01

    Wave trajectories in high density tokamak plasmas are studied numerically. Results show that the ordinary wave injected at an appropriate incident angle can propagate into the dense plasmas and is mode-converted to the extraordinary wave at the plasma cutoff, is further converted to the electron Bernstein wave during passing a loop or a folded curve near the upper hybrid resonance layer, and is cyclotron damped away, resulting in local electron heating before arriving at the cyclotron resonance layer. Similar trajectory and damping are obtained when a microwave in a form of extraordinary wave is injected quasi-perpendicularly in the direction of decreasing toroidal field

  12. Ion-Beam-Excited Electrostatic Ion Cyclotron Instability

    DEFF Research Database (Denmark)

    Michelsen, Poul; Pécseli, Hans; Juul Rasmussen, Jens

    1977-01-01

    The stability limits of the ion‐beam‐excited, electrostatic, ion cyclotron instability were investigated in a Q‐machine plasma where the electrons could be heated by microwaves. In agreement with theory, the beam energy necessary for excitation decreased with increasing electron temperature....

  13. Ion-Beam-Excited, Electrostatic, Ion Cyclotron Instability

    DEFF Research Database (Denmark)

    Michelsen, Poul; Pécseli, Hans; Juul Rasmussen, Jens

    1977-01-01

    The stability limits of the ion‐beam‐excited, electrostatic, ion cyclotron instability were investigated in a Q‐machine plasma where the electrons could be heated by microwaves. In agreement with theory, the beam energy necessary for excitation decreased with increasing electron temperature....

  14. Visual assistance system for cyclotron operation

    International Nuclear Information System (INIS)

    Okamura, Tetsuya; Tachikawa, Toshiki; Murakami, Tohru.

    1994-01-01

    A computer-based operation system for a cyclotron which assists operators has been developed. It is the operation assistance system depending on visual sense to indicate beam parameters to operators. First, the mental model of operators at the time of beam adjustment was analyzed, and it was presumed to be composed of five partial mental models, that is, beam behavior model, feasible setting region model, parameter sensitivity model, parameter interrelation model and status map model. Next, three visual interfaces were developed. Beam trajectory is rapidly calculated and graphically displayed whenever operators change parameters. Feasible setting regions (FSR) for parameters that satisfy the beam acceptance criteria of a cyclotron are indicated. The distribution of beam current values which are the quantity for evaluating adjustment is indicated as search history. Finally, for evaluating the system effectiveness, the search time required to reach the optimum conditions was measured. In addition, the system usability was evaluated by written questionnaires. The result of experiment showed the reduction of search time by about 65%. The written questionnaires survey showed the operators highly evaluate system usability. (K.I.)

  15. Cyclotron Resonances in Electron Cloud Dynamics

    International Nuclear Information System (INIS)

    Celata, C.M.; Furman, M.A.; Vay, J.L.; Grote, D.P.; Ng, J.T.; Pivi, M.F.; Wang, L.F.

    2009-01-01

    A new set of resonances for electron cloud dynamics in the presence of a magnetic field has been found. For short beam bunch lengths and low magnetic fields where l b c , (l b = bunch duration, ω c = non-relativistic cyclotron frequency) resonances between the bunch frequency and harmonics of the cyclotron frequency cause an increase in the electron cloud density in narrow ranges of magnetic field near the resonances. For ILC parameters the increase in the density is up to a factor ∼ 3, and the spatial distribution of the electrons is broader near resonances, lacking the well-defined density 'stripes' of multipactoring found for non-resonant cases. Simulations with the 2D computer code POSINST, as well as a single-particle tracking code, were used to elucidate the physics of the dynamics. The resonances are expected to affect the electron cloud dynamics in the fringe fields of conventional lattice magnets and in wigglers, where the magnetic fields are low. Results of the simulations, the reason for the bunch-length dependence, and details of the dynamics will be discussed

  16. Matching of ion sources to cyclotron inflectors

    International Nuclear Information System (INIS)

    Baartman, R.

    1988-06-01

    In general, cyclotron inflectors strongly couple the two transverse subspaces. This leads to a growth in emittance projections for a beam with no initial correlation between the two transverse subspaces. Only in the case of the Mueller (hyperboloid) inflector is there no emittance growth. We have made calculations using an optimization routine to match a given beam through the axial injection system. We find that in the limit where all the emittance is due to a beam's axial angular momentum (for example, from an ECR source), matching with no emittance growth is possible even in the case of mirror or spiral inflectors. Moreover, any one of the two transverse emittances circulating in the cyclotron can be made smaller than the source emittance while maintaining the sum of the emittances constant. This is achieved by rotating the matching quadrupoles with respect to the inflector and retuning

  17. Radioisotope production in the I. Ph. P. E. cyclotron for medical application

    Energy Technology Data Exchange (ETDEWEB)

    Krasnov, N.N.; Dmitriyev, P.P.; Konjakhin, N.A.; Ognev, A.A. (Gosudarstvennyj Komitet po Ispol' zovaniyu Atomnoj Ehnergii SSSR, Obninsk. Fiziko-Ehnergeticheskij Inst.)

    1982-01-01

    The production methods for seven radioisotopes, Ga-67, Sr-85, Pd-103, In-111, Tm-167, Hg-197 and Pb-203, by using a classical 1.5m cyclotron in the Institute of Physics and Power Engineering, Obninsk, USSR, are described. At present, more than 50 cyclotrons in different countries are used for the production of radioisotopes applied to medicine. Radioisotopes are produced with the cyclotron in the I.Ph.P.E. in the form of irradiated targets, which are delivered to Moscow radiopharmaceutical factory, where radiopharmaceuticals are produced on the base of these targets. The cyclotron is operated in two regimes providing the acceleration of protons, deuterons and alpha -particles. Two types of target assemblies are used for irradiation, the one is intended for the internal beam, and the other is for the external beam. The reactions used for the production of seven radioisotopes described above, the types of targets, particle energy, respective irradiated materials, beam current, thick target yield and the amount of respective radioisotopes produced per year are reported. Metals have large heat conductivity, therefore the use of metal targets increases beam current, and increases the production rate of radioisotopes.

  18. Comparative study of ion cyclotron waves at Mars, Venus and Earth

    Science.gov (United States)

    Wei, H. Y.; Russell, C. T.; Zhang, T. L.; Blanco-Cano, X.

    2011-08-01

    Ion cyclotron waves are generated in the solar wind when it picks up freshly ionized planetary exospheric ions. These waves grow from the free energy of the highly anisotropic distribution of fresh pickup ions, and are observed in the spacecraft frame with left-handed polarization and a wave frequency near the ion's gyrofrequency. At Mars and Venus and in the Earth's polar cusp, the solar wind directly interacts with the planetary exospheres. Ion cyclotron waves with many similar properties are observed in these diverse plasma environments. The ion cyclotron waves at Mars indicate its hydrogen exosphere to be extensive and asymmetric in the direction of the interplanetary electric field. The production of fast neutrals plays an important role in forming an extended exosphere in the shape and size observed. At Venus, the region of exospheric proton cyclotron wave production may be restricted to the magnetosheath. The waves observed in the solar wind at Venus appear to be largely produced by the solar-wind-Venus interaction, with some waves at higher frequencies formed near the Sun and carried outward by the solar wind to Venus. These waves have some similarity to the expected properties of exospherically produced proton pickup waves but are characterized by magnetic connection to the bow shock or by a lack of correlation with local solar wind properties respectively. Any confusion of solar derived waves with exospherically derived ion pickup waves is not an issue at Mars because the solar-produced waves are generally at much higher frequencies than the local pickup waves and the solar waves should be mostly absorbed when convected to Mars distance as the proton cyclotron frequency in the plasma frame approaches the frequency of the solar-produced waves. In the Earth's polar cusp, the wave properties of ion cyclotron waves are quite variable. Spatial gradients in the magnetic field may cause this variation as the background field changes between the regions in which

  19. Evaluation of residual radioactivity and dose rate of a target assembly in an IBA cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Seon Yong; Kim, Young Ju; Lee, Seung Wook [School of Mechanical Engineering, Pusan National University (Korea, Republic of)

    2016-12-15

    When a cyclotron produces 18F-, accelerated protons interact with metal parts of the cyclotron machine and induces radioactivity. Especially, the target window and chamber of the target assembly are the main parts where long-lived radionuclides are generated as they are incident by direct beams. It is of great importance to identify radionuclides induced in the target assembly for the safe operation and maintenance of a cyclotron facility. In this study, we analyzed major radionuclides generated in the target assembly by an operation of the Cyclotron 18/9 machine and measured dose rates after the operation to establish the radiation safety guideline for operators and maintenance personnel of the machine. Gamma spectroscopy with HPGe was performed on samples from the target chamber and Havar foil target window to identify the radionuclides generated during the operation for production of 18F-- isotope and their specific activity. Also, the dose rates from the target were measured as a function of time after an operation. These data will help improve radiological safety of operating the cyclotron facilities.

  20. A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta

    OpenAIRE

    Carvalho, Marieta

    2014-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...

  1. The theory of accelerated particles in AVF cyclotrons

    International Nuclear Information System (INIS)

    Schulte, W.M.

    1978-01-01

    This thesis deals with the study of the motion of accelerated charged particles in an AVF cyclotron. This study has been done on behalf of the VICKSI- project of the Hahn-Meitner-Institut in West Berlin. A new theory is developed which facilitates an accurate description of the influence of the acceleration on the motion in the median plane of a cyclotron. The theory is applied to systems with 1 or 2 Dee electrodes, the frequency of the accelerating voltage being equal to the revolution frequency of the particles or a higher harmonic of this frequency. It turned out that the betatron oscillations in the radial phase space may be disturbed considerably as a result of the acceleration. In the theory the author makes use of the Hamilton formalism. After a number of canonical transformations a Hamilton function was found, in which the most important effects show themselves clearly. The corresponding equations of motion can be solved very quickly with the help of a simple computer program. The results of this theory are in agreement with those of extensive numerical orbit integration programmes. In this thesis attention is also devoted to the centering of the beam in the VICKSI cyclotron just after injection, the possibility to obtain single-turn extraction and the interpretation of the high frequency phase measurements. (Auth.)

  2. RF control hardware design for CYCIAE-100 cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Yin, Zhiguo, E-mail: bitbearAT@hotmail.com; Fu, Xiaoliang; Ji, Bin; Zhao, Zhenlu; Zhang, Tianjue; Li, Pengzhan; Wei, Junyi; Xing, Jiansheng; Wang, Chuan

    2015-11-21

    The Beijing Radioactive Ion-beam Facility project is being constructed by BRIF division of China Institute of Atomic Energy. In this project, a 100 MeV high intensity compact proton cyclotron is built for multiple applications. The first successful beam extraction of CYCIAE-100 cyclotron was done in the middle of 2014. The extracted proton beam energy is 100 MeV and the beam current is more than 20 μA. The RF system of the CYCIAE-100 cyclotron includes two half-wavelength cavities, two 100 kW tetrode amplifiers and power transmission line systems (all above are independent from each other) and two sets of Low Level RF control crates. Each set of LLRF control includes an amplitude control unit, a tuning control unit, a phase control unit, a local Digital Signal Process control unit and an Advanced RISC Machines based EPICS IOC unit. These two identical LLRF control crates share one common reference clock and take advantages of modern digital technologies (e.g. DSP and Direct Digital Synthesizer) to achieve closed loop voltage and phase regulations of the dee-voltage. In the beam commission, the measured dee-voltage stability of RF system is better than 0.1% and phase stability is better than 0.03°. The hardware design of the LLRF system will be reviewed in this paper.

  3. Orsay cyclotron design with superconducting coils and the associated accelerating unit

    International Nuclear Information System (INIS)

    1983-06-01

    This report ends the theoretical and technical studies of the project of new accelerating unit proposed by IPN at Orsay. The isochronous cyclotron with superconducting coils is coupled to two different injections: an axial one with polarized or not ion sources for light ions or multicharged ion sources for heavy ions; a radial injection from the reviewed tandem MP13Met. The following points are underlined: 1) the specificity of the machine 2) the theoretical and technical feasibility of a compact high frequency accelerating system suited to this type of machine 3) the development of an extraction device of the beam 4) the feasibility of an axial injection along the optical axis coupled to a unique central region of the cyclotron 5) the criterions to define, the choices to make to get a radial injection of the beam coming from the tandem in the cyclotron [fr

  4. Análise SWOT global da exploração dos suínos da raça Bísara

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...

  5. Currents driven by electron cyclotron waves

    International Nuclear Information System (INIS)

    Karney, C.F.F.; Fisch, N.J.

    1981-07-01

    Certain aspects of the generation of steady-state currents by electron cyclotron waves are explored. A numerical solution of the Fokker-Planck equation is used to verify the theory of Fisch and Boozer and to extend their results into the nonlinear regime. Relativistic effects on the current generated are discussed. Applications to steady-state tokamak reactors are considered

  6. Electron cyclotron heating and associated parallel cooling

    International Nuclear Information System (INIS)

    Rapozo, C. da C.; Assis, A.S. de; Busnardo Neto, J.

    1990-01-01

    It has been experimentally observed that during the electron-cyclotron heating the electron longitudinal temperature drops as the perpendicular temperature increases. The experiment was carried in a linear mirror machine with a low density (10 10 cm -3 ) weakly ionized (< 1.0 %) plasma. (Author)

  7. On Resonant Heating Below the Cyclotron Frequency

    International Nuclear Information System (INIS)

    Chen, Liu; Lin, Zhihong; White, R.

    2001-01-01

    Resonant heating of particles by an electrostatic wave propagating perpendicular to a confining uniform magnetic field is examined. It is shown that, with a sufficiently large wave amplitude, significant perpendicular stochastic heating can be obtained with wave frequency at a fraction of the cyclotron frequency

  8. Neutron spectra due 13N production in a PET cyclotron

    International Nuclear Information System (INIS)

    Benavente, J.A.; Vega-Carrillo, H.R.; Lacerda, M.A.S.; Fonseca, T.C.F.; Faria, F.P.; Silva, T.A. da

    2015-01-01

    Monte Carlo and experimental methods have been used to characterize the neutron radiation field around PET (Positron Emission Tomography) cyclotrons. In this work, the Monte Carlo code MCNPX was used to estimate the neutron spectra, the neutron fluence rates and the ambient dose equivalent (H*(10)) in seven locations around a PET cyclotron during 13 N production. In order to validate these calculations, H*(10) was measured in three sites and were compared with the calculated doses. All the spectra have two peaks, one above 0.1 MeV due to the evaporation neutrons and another in the thermal region due to the room-return effects. Despite the relatively large difference between the measured and calculated H*(10) for one point, the agreement was considered good, compared with that obtained for 18 F production in a previous work. - Highlights: • MCNPX code was used to estimate the neutron spectra in a PET cyclotron. • Neutrons were estimated when 13 N is produced. • Neutron spectra show evaporation and room-return neutrons. • Calculated H*(10) were compared with measured H*(10)

  9. The beam handling system of the Oslo Cyclotron

    International Nuclear Information System (INIS)

    Messelt, S.

    1985-11-01

    The beam optic system of the Oslo Cyclotron is described. A computer program for the calculation of optimal settings of quadropoles is presented. The reliability of the computer program is confirmed by experimental data

  10. Observation of Poincaré-Andronov-Hopf Bifurcation in Cyclotron Maser Emission from a Magnetic Plasma Trap

    Science.gov (United States)

    Shalashov, A. G.; Gospodchikov, E. D.; Izotov, I. V.; Mansfeld, D. A.; Skalyga, V. A.; Tarvainen, O.

    2018-04-01

    We report the first experimental evidence of a controlled transition from the generation of periodic bursts of electromagnetic radiation into the continuous-wave regime of a cyclotron maser formed in magnetically confined nonequilibrium plasma. The kinetic cyclotron instability of the extraordinary wave of weakly inhomogeneous magnetized plasma is driven by the anisotropic electron population resulting from electron cyclotron plasma heating in a MHD-stable minimum-B open magnetic trap.

  11. Geometric analysis of phase bunching in the central region of cyclotron

    International Nuclear Information System (INIS)

    Miyawaki, Nobumasa; Fukuda, Mitsuhiro; Kurashima, Satoshi; Kashiwagi, Hirotsugu; Okumura, Susumu; Arakawa, Kazuo; Kamiya, Tomihiro

    2013-01-01

    An optimum condition for realizing phase bunching in the central region of a cyclotron was quantitatively clarified by a simplified geometric trajectory analysis of charged particles from the first to the second acceleration gap. The phase bunching performance was evaluated for a general case of a cyclotron. The phase difference of incident particles at the second acceleration gap depends on the combination of four parameters: the acceleration harmonic number h, the span angle θ D of the dee electrode, the span angle θ F from the first to the second acceleration gap, the ratio R V of the peak acceleration voltage between the cyclotron and ion source. Optimum values of θ F for phase bunching were limited by the relationship between h and θ D , which is 90°/h+θ D /2≤θ F ≤180°/h+θ D /2, and sin θ F >0. The phase difference with respect to the reference particle at the second acceleration gap is minimized for voltage-ratios between two and four for an initial phase difference within 40 RF degrees. Although the slope of the first acceleration gap contributes to the RF phase at which the particles reach the second acceleration gap, phase bunching was not affected. An orbit simulation of the AVF cyclotron at the Japan Atomic Energy Agency verifies the evaluation based on geometric analysis

  12. Dispersion equations for field-aligned cyclotron waves in axisymmetric magnetospheric plasmas

    Directory of Open Access Journals (Sweden)

    N. I. Grishanov

    2006-03-01

    Full Text Available In this paper, we derive the dispersion equations for field-aligned cyclotron waves in two-dimensional (2-D magnetospheric plasmas with anisotropic temperature. Two magnetic field configurations are considered with dipole and circular magnetic field lines. The main contribution of the trapped particles to the transverse dielectric permittivity is estimated by solving the linearized Vlasov equation for their perturbed distribution functions, accounting for the cyclotron and bounce resonances, neglecting the drift effects, and assuming the weak connection of the left-hand and right-hand polarized waves. Both the bi-Maxwellian and bi-Lorentzian distribution functions are considered to model the ring current ions and electrons in the dipole magnetosphere. A numerical code has been developed to analyze the dispersion characteristics of electromagnetic ion-cyclotron waves in an electron-proton magnetospheric plasma with circular magnetic field lines, assuming that the steady-state distribution function of the energetic protons is bi-Maxwellian. As in the uniform magnetic field case, the growth rate of the proton-cyclotron instability (PCI in the 2-D magnetospheric plasmas is defined by the contribution of the energetic ions/protons to the imaginary part of the transverse permittivity elements. We demonstrate that the PCI growth rate in the 2-D axisymmetric plasmasphere can be significantly smaller than that for the straight magnetic field case with the same macroscopic bulk parameters.

  13. A CCD camera probe for a superconducting cyclotron

    International Nuclear Information System (INIS)

    Marti, F.; Blue, R.; Kuchar, J.; Nolen, J.A.; Sherrill, B.; Yurkon, J.

    1991-01-01

    The traditional internal beam probes in cyclotrons have consisted of a differential element, a wire or thin strip, and a main probe with several fingers to determine the vertical distribution of the beam. The resolution of these probes is limited, especially in the vertical direction. The authors have developed a probe for their K1200 superconducting cyclotron based on a CCD TV camera that works in a 6 T magnetic field. The camera looks at the beam spot on a scintillating screen. The TV image is processed by a frame grabber that digitizes and displays the image in pseudocolor in real time. This probe has much better resolution than traditional probes. They can see beams with total currents as low as 0.1 pA, with position resolution of about 0.05 mm

  14. Aharonov-Bohm effect in cyclotron and synchrotron radiations

    Energy Technology Data Exchange (ETDEWEB)

    Bagrov, V.G.; Gitman, D.M. E-mail: gitman@fma.if.usp.br; Levin, A.; Tlyachev, V.B

    2001-07-02

    We study the impact of Aharonov-Bohm solenoid on the radiation of a charged particle moving in a constant uniform magnetic field. With this aim in view, exact solutions of Klein-Gordon and Dirac equations are found in the magnetic-solenoid field. Using such solutions, we calculate exactly all the characteristics of one-photon spontaneous radiation both for spinless and spinning particle. Considering non-relativistic and relativistic approximations, we analyze cyclotron and synchrotron radiations in detail. Radiation peculiarities caused by the presence of the solenoid may be considered as a manifestation of Aharonov-Bohm effect in the radiation. In particular, it is shown that new spectral lines appear in the radiation spectrum. Due to angular distribution peculiarities of the radiation intensity, these lines can in principle be isolated from basic cyclotron and synchrotron radiation spectra.

  15. Aharonov-Bohm effect in cyclotron and synchrotron radiations

    International Nuclear Information System (INIS)

    Bagrov, V.G.; Gitman, D.M.; Levin, A.; Tlyachev, V.B.

    2001-01-01

    We study the impact of Aharonov-Bohm solenoid on the radiation of a charged particle moving in a constant uniform magnetic field. With this aim in view, exact solutions of Klein-Gordon and Dirac equations are found in the magnetic-solenoid field. Using such solutions, we calculate exactly all the characteristics of one-photon spontaneous radiation both for spinless and spinning particle. Considering non-relativistic and relativistic approximations, we analyze cyclotron and synchrotron radiations in detail. Radiation peculiarities caused by the presence of the solenoid may be considered as a manifestation of Aharonov-Bohm effect in the radiation. In particular, it is shown that new spectral lines appear in the radiation spectrum. Due to angular distribution peculiarities of the radiation intensity, these lines can in principle be isolated from basic cyclotron and synchrotron radiation spectra

  16. Transparency of magnetized plasma at the cyclotron frequency

    International Nuclear Information System (INIS)

    Shvets, G.; Wurtele, J.S.

    2002-01-01

    Electromagnetic radiation is strongly absorbed by a magnetized plasma if the radiation frequency equals the cyclotron frequency of plasma electrons. It is demonstrated that absorption can be completely canceled in the presence of a magnetostatic field of an undulator, or a second radiation beam, resulting in plasma transparency at the cyclotron frequency. This effect is reminiscent of the electromagnetically induced transparency (EIT) of three-level atomic systems, except that it occurs in a completely classical plasma. Unlike the atomic systems, where all the excited levels required for EIT exist in each atom, this classical EIT requires the excitation of nonlocal plasma oscillation. A Lagrangian description was used to elucidate the physics of the plasma transparency and control of group and phase velocity. This control leads to applications for electromagnetic pulse compression and electron/ion acceleration

  17. Study of first harmonic field effects on beam extraction for VEC K500 superconducting cyclotron

    International Nuclear Information System (INIS)

    Dey, M.K.; Debnath, J.; Mallik, C.; Bhandari, R.K.

    2002-01-01

    In superconducting cyclotron large momentum compaction at extraction region makes the turn separation very small. The first harmonic effects on the He +1 beam using simulated magnetic field for VEC K500 cyclotron is reported

  18. Study of the activation of the parts components of the CV-28 cyclotron

    International Nuclear Information System (INIS)

    Fajardo, P.W.

    1986-08-01

    The CV-17 cyclotron, isochronous, compact, of variable energy is an accelerator of charged particles and is applied in several situations such as: radioisotopes production, neutron production, irradiation damage analysis, activation analysis. During the production of the particle beams, the parts components of the interior of the cyclotron are irradiated and become radioactive. Due the fact of the cyclotron require maintenance, the knowledgement of the radionuclides present is of primordial importance of the view point of the radioprotection. Taking the excitation function of a nuclear reaction is observed that determined reaction may happen and produce a radionuclide. The radionuclides formed in the parts components by charged particles are presented. (V.R.B.)

  19. Clinical diagnostic system using a small cyclotron for medical use

    International Nuclear Information System (INIS)

    Yonekura, Y.; Magata, Y.; Konishi, J.

    1990-01-01

    Since a small cyclotron and a positron emission tomography (PET) scanner have been installed at the Kyoto University Hospital in 1983, a great deal of effort has been directed to the clinical application of the PET-cyclotron system. This paper outlines the experience with PET in the clinical setting, including the facility, equipments and staff involved, weekly schedule, typical clinical protocols, and some results from the patients. The system consists of small cyclotron for production of the short-lived positron emitting radionuclides, fully automated synthesis system for labeling various compounds, scanning for measurement of radioactivities, and data analysis system for calculating physiological parameters. A resolving cylinder target system with eight smaller cylinders is equipped for production of C-11, N-13, O-15, and F-18. Labeled compounds are quickly delivered to the PET scanner room by two systems--the continuous delivery system for the labeled gas and the rapid delivery system for the liquid compounds by compressed air. A PET scanner devoted for clinical studies is a multislice whole-body PET scanner. Ten PET studies are performed weekly on the average for measuring blood flow and oxygen and glucose metabolism in the brain, blood flow and glucose and fatty acid metabolism in the heart, blood flow and amino acid uptake in the pancreas, lung ventilation, and tumor glucose metabolism. The availability of PET-cyclotron system is still limited in view of cost. The previous clinical studies suggest the contribution of PET to the the understanding of the mechanism of disease pathophysiology. (N.K.)

  20. Microwave power coupling with electron cyclotron resonance ...

    Indian Academy of Sciences (India)

    600 W microwave power with an average electron density of ∼ 6 × 1011 cm. −3 ... the angular frequency of the cyclotron motion, e is the electron charge, m is the mass of .... is also suitable for ECR plasma-based applications like high-quality ...

Some links on this page may take you to non-federal websites. Their policies may differ from this site.