WorldWideScience

Sample records for sara cornish 228-5345

  1. News developments at Sara

    International Nuclear Information System (INIS)

    Belmont, J.L.; Fruneau, M.; Martin, P.

    1989-05-01

    SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration

  2. 2012 SARA Students Technical Report

    International Nuclear Information System (INIS)

    Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet

    2012-01-01

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of

  3. 2012 SARA Students Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

    2012-07-30

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the

  4. The SARA REU Site Program

    Science.gov (United States)

    Wood, M. A.; Oswalt, T. D.; SARA Collaboration

    2000-12-01

    We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.

  5. Sara

    International Nuclear Information System (INIS)

    Aparo, M.; Dionisi, M.; Vicini, C.; Zeppa, P.; Frazzoli, F.V.; Remetti, R.; Portale, C.

    1989-01-01

    Nuclear Material Accountability, supported by Containment and Surveillance measures, is a foundamental means for an effective International Safeguard implemention in nuclear plants. Accountability is based on the verification that difference between a material quantity entering a given material balance and the quantity leaving that area in a given period of time, correspond and the amount of material actually present at the moment of the inspection. In the recent years International Safeguards appealing to the needs of timeliness in detecting diversion and concealing activities, devoted ReD efforts on a new Dynamic Accountability procedures (NRTMA) with particular concern with reprocessing plants. The present paper, which is the result of a research activity carried out in the frame of the Italian Support Programme to IAEA for Safeguards implementation, deals with a feasibility study of a NRTMA system to be applied to the EUREX pilot reprocessing plant. Such a feasibility study was performed by developing a computer program based on simulated plant generated data

  6. A Nonparametric Operational Risk Modeling Approach Based on Cornish-Fisher Expansion

    Directory of Open Access Journals (Sweden)

    Xiaoqian Zhu

    2014-01-01

    Full Text Available It is generally accepted that the choice of severity distribution in loss distribution approach has a significant effect on the operational risk capital estimation. However, the usually used parametric approaches with predefined distribution assumption might be not able to fit the severity distribution accurately. The objective of this paper is to propose a nonparametric operational risk modeling approach based on Cornish-Fisher expansion. In this approach, the samples of severity are generated by Cornish-Fisher expansion and then used in the Monte Carlo simulation to sketch the annual operational loss distribution. In the experiment, the proposed approach is employed to calculate the operational risk capital charge for the overall Chinese banking. The experiment dataset is the most comprehensive operational risk dataset in China as far as we know. The results show that the proposed approach is able to use the information of high order moments and might be more effective and stable than the usually used parametric approach.

  7. Severe Accident Recriticality Analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  8. Severe accident recriticality analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H

    2001-11-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated

  9. Severe accident recriticality analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.

    2001-01-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady

  10. Severe Accident Recriticality Analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  11. Interpreting the SARA and RCRA training requirements

    International Nuclear Information System (INIS)

    Moreland, W.M.; Wells, S.M.

    1987-01-01

    The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements

  12. System Analysis and Risk Assessment (SARA) system

    International Nuclear Information System (INIS)

    Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

    1986-01-01

    Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable

  13. The relationship between SARA fractions and crude oil stability

    Directory of Open Access Journals (Sweden)

    Siavash Ashoori

    2017-03-01

    Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.

  14. Layering of life (Sara novel of Peter Sarić

    Directory of Open Access Journals (Sweden)

    Kostić Dragomir J.

    2015-01-01

    Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safe­guard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.

  15. Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.

    Science.gov (United States)

    O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J

    2008-04-01

    Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.

  16. Gene : CBRC-SARA-01-1996 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

  17. SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS

    International Nuclear Information System (INIS)

    Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.

    2015-01-01

    SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index

  18. Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

    Directory of Open Access Journals (Sweden)

    M. Sidi Ritau'din

    2017-06-01

    Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.

  19. Layering of life (Sara novel of Peter Sarić)

    OpenAIRE

    Kostić, Dragomir J.

    2015-01-01

    Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...

  20. A simple blowdown code for SUPER-SARA loop conditions

    International Nuclear Information System (INIS)

    Fritz, G.

    1981-01-01

    The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section

  1. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...

  2. Sara, a patient with borderline personality structure: A "crisis" management

    Directory of Open Access Journals (Sweden)

    Paola Marinelli

    2015-05-01

    Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma. 

  3. Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

    Directory of Open Access Journals (Sweden)

    Jessica N Snowden

    Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.

  4. System Analysis and Risk Assessment system (SARA) Version 4.0

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1992-01-01

    This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis

  5. The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...

  6. Calculations for the design and modification of the 2 cyclotrons of S.A.R.A

    International Nuclear Information System (INIS)

    Albrand, P.S.; Belmont, J.L.; Ripouteau, F.

    1983-09-01

    S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron

  7. Social humanoid robot SARA: development of the wrist mechanism

    Science.gov (United States)

    Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.

    2018-01-01

    This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.

  8. Mengukur Politisasi Agama dalam Ruang Publik: Komunikasi SARA dalam Perdebatan Rational Choice Theory

    Directory of Open Access Journals (Sweden)

    Mohammad Supriyadi

    2015-12-01

    Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.

  9. Concurrent software system design supported by SARA at the age of one

    Energy Technology Data Exchange (ETDEWEB)

    Campos, I.M.; Estrin, G.

    A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.

  10. ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

    Directory of Open Access Journals (Sweden)

    Sulistyastuti Sutomo

    2015-01-01

    Full Text Available Not only does art   have   self-fullfillment, but  it also has axiological  benefits both socially, culturally, religiously, and economiclally.  So does Sara Douda dance.  Sara Douda aesthetics  is first contained  in its whole dance movements. In addition, it  can also be found in the whole dance equipments.  Moreover,  this dance aesthetics  may  also be contained in the verbal symbols in the speech forms  prior to the dance performance. However,  both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and  religious values in the Loli community about  their honoring their ancestors,  having social harmony, and  highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance.   Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...

  17. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    Science.gov (United States)

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...

  5. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  14. Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural

    Directory of Open Access Journals (Sweden)

    Tiara Kharisma

    2017-12-01

    Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

  18. Transferring generic SARA/OSHA training to US Department of Energy facilities

    International Nuclear Information System (INIS)

    White, A.; McKinley, T.

    1989-01-01

    The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs

  19. SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

    DEFF Research Database (Denmark)

    Martin, Christer; Heinze, C.; Busch, M.

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...

  3. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    OpenAIRE

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...

  5. Identification of Differentially Expressed Proteins in Liver in Response to Subacute Ruminal Acidosis (SARA Induced by High-concentrate Diet

    Directory of Open Access Journals (Sweden)

    X. Y. Jiang

    2014-08-01

    Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.

  6. SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-05-01

    Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.

  7. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    Science.gov (United States)

    Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

    2017-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.

  8. System Analysis and Risk Assessment System (SARA), Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.

    1992-02-01

    This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs

  9. Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

    2009-07-01

    Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench

  10. Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

    Science.gov (United States)

    Thomas, S. M.; Su, Y. C.; Hummel, P. R.

    2016-12-01

    Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance

  11. Development of an ion guide coupled to an on-line isotope separation system on Sara. Identification and study of isospin exotic nuclei at Isolde and Sara

    International Nuclear Information System (INIS)

    Bouldjedri, A.

    1992-06-01

    This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements

  12. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  13. Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.

    1995-01-01

    Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...

  15. Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010

    OpenAIRE

    Beaulé, Sophie

    2014-01-01

    With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w

  17. Lepidoptera, Nymphalidae, Heliconiinae, Heliconius sara apseudes (Hübner, 1813: Distribution extension

    Directory of Open Access Journals (Sweden)

    Iserhard, C. A.

    2010-01-01

    Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.

  18. PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

    Directory of Open Access Journals (Sweden)

    Jorge A. Orrego-Ruiz

    2014-06-01

    Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.

  19. The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

    Science.gov (United States)

    Wood, M. A.

    2003-12-01

    The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.

  20. Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.

    Science.gov (United States)

    Zhao, Bryan M; Hoffmann, F Michael

    2006-09-01

    Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.

  1. Sara John: Ethnisierte Arbeit. Eine feministische Perspektive. Marburg: Tectum Wissenschaftsverlag 2009.

    Directory of Open Access Journals (Sweden)

    Grit Grigoleit

    2011-03-01

    Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.

  2. A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

    Science.gov (United States)

    Worthen, Helena Harlow

    2012-01-01

    The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…

  3. Hemolytic disease of the fetus and newborn caused by an antibody to a low-prevalence antigen, anti-SARA.

    Science.gov (United States)

    Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy

    2011-09-01

    The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.

  4. Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

    Science.gov (United States)

    Goldrick-Rab, Sara; Kelly, Andrew P.

    2016-01-01

    In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

  6. NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r

  11. Escribiendo el silencio: la contemplación poética de Sara Pujol

    Directory of Open Access Journals (Sweden)

    Gala, Candelas

    2005-06-01

    Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.

  12. Intravenous immunoglobulin in the management of a rare cause of hemolytic disease of the newborn: Anti-SARA antibodies.

    Science.gov (United States)

    Venkataraman, Rohini; Yusuf, Kamran

    2017-01-01

    Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.

  13. Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

    Directory of Open Access Journals (Sweden)

    Tirshem Kumar Kaushik

    2015-05-01

    Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.

  14. Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge

    DEFF Research Database (Denmark)

    Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette

    2017-01-01

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...

  15. TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

    Energy Technology Data Exchange (ETDEWEB)

    1989-03-01

    This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.

  16. Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.

    1994-11-01

    The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)

  17. Instructional materials for SARA/OSHA training. Volume 1, General site working training

    Energy Technology Data Exchange (ETDEWEB)

    Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)

    1988-04-01

    This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.

  18. La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli

    Directory of Open Access Journals (Sweden)

    Umberto Fortis

    2014-04-01

    Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.

  19. Reading Sara Pujol Russell’s Poetry of Contemplation and Connection

    Directory of Open Access Journals (Sweden)

    Anita M. Hart

    2012-06-01

    Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.

  20. SAPHIRE technical reference manual: IRRAS/SARA Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.

    1993-01-01

    This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix

  1. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    Directory of Open Access Journals (Sweden)

    Abdullah K. Shehabat

    2016-09-01

    Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.

  2. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0. Volume 5, Systems Analysis and Risk Assessment (SARA) tutorial manual

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities

  3. SARA South Observations and Analysis of the Solar Type, Totally Eclipsing, Over Contact Binary, PY Aquarii

    Science.gov (United States)

    Chamberlain, Heather; Samec, Ronald G.; Caton, Daniel Bruce; Van Hamme, Walter

    2018-01-01

    PY Aqr (GSC 05191-00853) is a solar Type (T ~ 5750K) eclipsing binary. It was observed in July to October, 2017 at Cerro Tololo in remote mode with the 0.6-m SARA South reflector. Two times of minimum light were calculated from our present observations, a primary and a secondary eclipse:HJD Min I = 2457951.7762±0.0006 HJD Min II = 2458019.5295±00.0003. Both weighted as 1.0.In addition, four timings were determined from online data given in IBVS 5600 and five observations at minima were determined from archived All Sky Automated Survey Data:HJD Min I = 2452908.3165, 2452912.33612 HJD Min II = 2452877.5621, 2452913.34465. All weighted as 0.5.ASAS Observations at minima: 2452094.688, 2453478.882, 2453266.576, 2452093.685 and 54729.600. Each weighted as 0.10The following linear and quadratic ephemerides were determined from all available times of minimum light:JD Hel Min I=2452951.7443±0.0008d + 0.402093441±0.000000099 X E {1} JD Hel Min I=2452951.7439±0.0007d + 0.4020912±0.0000007 X E +0.00000000018 ± 0.00000000006 X E2 {2}A BVRI Bessell filtered simultaneous Wilson-Devinney Program (W-D) solution reveals that the system has a mass ratio of ~0.34 and a component temperature difference of only ~40 K. One low luminosity (Tfact ~ 0.94, ~66 degree radius) large cool region of spots was iterated on the primary component in the WD Synthetic Light Curve computations. It appears in the Southern Hemisphere (colatitude 155 degrees). The Roche Lobe fill-out of the binary is ~17%. The inclination is ~86 degrees. An eclipse duration of ~10 minutes was determined for the primary eclipse and the light curve solution. Additional and more detailed information is given in this report.

  4. DETERMINACIÓN DE LAS FRACCIONES SARA DE ASFALTOS COLOMBIANOS ENVEJECIDOS AL MEDIO AMBIENTE EMPLEANDO CROMATOGRAFÍA LÍQUIDA EN COLUMNA DETERMINAÇÃO DAS FRAÇÕES SARA DE ASFALTOS COLOMBIANOS ENVELHECIDOS AO MÉDIO AMBIENTE EMPREGANDO CROMATOGRAFIA LÍQUIDA EM COLUNA DETERMINATION OF SARA FRACTIONS OF ENVIRONMENTALLY AGED COLOMBIAN ASPHALTS USING LIQUID CHROMATOGRAPHY COLUMN

    Directory of Open Access Journals (Sweden)

    Fredy Alberto Reyes

    2012-06-01

    Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p

  5. Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia

    Directory of Open Access Journals (Sweden)

    Tjitske F. Lawerman

    2017-12-01

    Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced

  6. sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

    DEFF Research Database (Denmark)

    Christner, Martin; Heinze, Constanze; Busch, Michael

    2012-01-01

    to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...

  7. Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

    Science.gov (United States)

    Godwin, Allison; Potvin, Geoff

    2017-01-01

    This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…

  8. Staphylococcus aureus Quorum Regulator SarA Targeted Compound, 2-[(Methylaminomethyl]phenol Inhibits Biofilm and Down-Regulates Virulence Genes

    Directory of Open Access Journals (Sweden)

    P. Balamurugan

    2017-07-01

    Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.

  9. Cornish heat transfer experiment - final report

    International Nuclear Information System (INIS)

    Bourke, P.J.; Hodgkinson, D.P.

    1985-01-01

    The transfer of heat released in an in-site heating experiment simulating high level radioactive waste packages in granite in Cornwall has been found to be mainly by conduction but some appreciable convection does occur. Interim analysis of the data suggests that the latter may account for about 20% of the total. (author)

  10. The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters

    International Nuclear Information System (INIS)

    Iazzourene, F.

    1982-01-01

    The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr

  11. Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

    Directory of Open Access Journals (Sweden)

    Helena López

    2013-07-01

    Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.

  12. Os suínos da raça Bísara – oportunidades e desafios

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...

  13. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  14. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Diego O Andrey

    Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  15. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    OpenAIRE

    Abdullah K. Shehabat

    2016-01-01

    This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...

  16. Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests

    International Nuclear Information System (INIS)

    Eifler, W.; Shepherd, I.M.

    1983-01-01

    Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix

  17. Land-use evaluation for sustainable construction in a protected area: A case of Sara mountain national park.

    Science.gov (United States)

    Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena

    2018-01-15

    The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Probabilistic model fitting for spatio-temporal variability studies of precipitation: the Sara-Brut system - a case study

    International Nuclear Information System (INIS)

    Dorado Delgado, Jennifer; Burbano Criollo, Juan Carlos; Molina Tabares, Jose Manuel; Carvajal Escobar, Yesid; Aristizabal, Hector Fabio

    2006-01-01

    In this study, space and time variability of monthly and annual rainfall was analyzed for the downstream influence zone of a Colombian supply-regulation reservoir, Sara-Brut, located on the Cauca valley department. Monthly precipitation data from 18 gauge stations and for a 29-year record (1975-2003) were used. These data were processed by means of time series completion, consistency analyses and sample statistics computations. Theoretical probabilistic distribution models such as Gumbel, normal, lognormal and wake by, and other empirical distributions such as Weibull and Landwehr were applied in order to fit the historical precipitation data set. The fit standard error (FSE) was used to test the goodness of fit of the theoretical distribution models and to choose the best of this probabilistic function. The wake by approach showed the best goodness of fit in 89% of the total gauges taken into account. Time variability was analyzed by means of wake by estimated values of monthly and annual precipitation associated with return periods of 1,052, 1,25, 2, 10, 20 and 50 years. Precipitation space variability is presents by means of ArcGis v8.3 and using krigging as interpolation method. In general terms the results obtained from this study show significant distribution variability in precipitation over the whole area, and particularity, the formation of dry and humid nucleus over the northeastern strip and microclimates at the southwestern and central zone of the study area were observed, depending on the season of year. The mentioned distribution pattern is likely caused by the influence of pacific wind streams, which come from the Andean western mountain range. It is expected that the results from this work be helpful for future planning and hydrologic project design

  19. The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

    International Nuclear Information System (INIS)

    Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan

    2013-01-01

    Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques

  20. SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-04-01

    The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

  1. A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta

    OpenAIRE

    Carvalho, Marieta

    2014-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...

  2. The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

    Directory of Open Access Journals (Sweden)

    John M Morrison

    2012-03-01

    Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.

  3. Identification of new proton-rich rare earth nuclei by means of the coupled system helium jet-isotope separator of SARA

    International Nuclear Information System (INIS)

    Ollivier, T.

    1986-01-01

    In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr

  4. Análise SWOT global da exploração dos suínos da raça Bísara

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...

  5. Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973

    Directory of Open Access Journals (Sweden)

    Guillermina Feudal

    2017-12-01

    Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.

  6. Sharing AIS Related Anomalies (SARA)

    Science.gov (United States)

    2016-03-01

    78 6.3.7 SQL Versus NoSQL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 6.4 Data Processing...43 6.1 Overview of SQL and NoSQL differences, from [56]. . . . . . . . . . . . . . . . . . 82 A.1 Description of the ship anomaly upload use...constraints must be considered. These requirements, however, can only be defined when lower level implementation decisions, such as SQL versus NoSQL

  7. Severe accident recriticality analyses (SARA)

    DEFF Research Database (Denmark)

    Frid, W.; Højerup, C.F.; Lindholm, I.

    2001-01-01

    with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality-both super-prompt power bursts and quasi steady-state power......Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies......, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g(-1), was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s(-1). In most cases, however, the predicted energy deposition was smaller, below...

  8. Notas sobre Feral y las cigüeñas, de Fernando Alonso, y la "Historia del califa cigüeña" (Wilhelm Hauff, Sara Cone Bryant

    Directory of Open Access Journals (Sweden)

    Hans Christian Hagedorn

    2011-01-01

    Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.

  9. 1980 Annual status report: super-SARA

    International Nuclear Information System (INIS)

    1981-01-01

    The essential tasks of the JRC for the SUPERSARA project during 1980 were therefore twofold: 1. Actuation of an international Task Force with which to: a. discuss in depth the test objectives and the relationships between the SSTP and the world mosaic of activities in the field of LWR fuel behaviour; b. establish a consensus test matrix; c. identify and discuss the major technological problems affecting the feasibility of attaining the consensus test objectives, especially for the boil-down SFD tests. A Task Force with these objectives was necessary in order to provide the elements for a Council decision on phase II. 2. Conservation of the rythm of the main contractor (UKAEA-Harwell) and subcontractors for the timely fabrication of loop components and the timely design of those new aspects of the plant necessary for the boil-down SFD tests

  10. An investigation into control of radon and its daughter products in some Cornish mine atmospheres

    International Nuclear Information System (INIS)

    Dungey, C.J.; Hore, J.; Waller, M.D.

    1979-01-01

    Elements of the uranium series are widespread as trace elements in the granitic rocks in which much of Cornwall's mining takes place. The radon gas, together with its decay or daughter products, can be inhaled by the underground worker. It is now realised that even a small concentration of the gas can be harmful; this is reflected by the tightening of control standards in the U.S.A. by a factor of 30 in the past 10 years. The current standards are such that many non-uranium mines must now provide some means of control. As yet, no statutory limits have been set in the United Kingdom mining regulations, but the industry locally is hopeful of achieving reduced levels that will pre-empt any forthcoming legislation. The first requirement of any control technique is the ability to monitor the effects of any action. An instrument developed recently in the U.S.A. now enables the radon daughter concentration to be determined quickly on the spot, so the effectiveness of any control measures can be evaluated more rapidly. The evaluation of the best potential methods of control requires some understanding of the behaviour of the decay products in typical mine environments. Several control techniques are being tested, both in controlled experimental conditions at the Camborne School of Mines and in field conditions at South Crofty and Wheal Pendarves mines. The experience and results of these tests so far are examined. (author)

  11. Through the sands of time: Beach litter trends from nine cleaned north cornish beaches.

    Science.gov (United States)

    Watts, Andrew J R; Porter, Adam; Hembrow, Neil; Sharpe, Jolyon; Galloway, Tamara S; Lewis, Ceri

    2017-09-01

    Marine litter and its accumulation on beaches is an issue of major current concern due to its significant environmental and economic impacts. Yet our understanding of spatio-temporal trends in beach litter and the drivers of these trends are currently limited by the availability of robust long term data sets. Here we present a unique data set collected systematically once a month, every month over a six year period for nine beaches along the North Coast of Cornwall, U.K. to investigate the key drivers of beach litter in the Bude, Padstow and Porthcothan areas. Overall, an average of 0.02 litter items m -2 per month were collected during the six year study, with Bude beaches (Summerleaze, Crooklets and Widemouth) the most impacted (0.03 ± 0.004 litter items m -2 per month). The amount of litter collected each month decreased by 18% and 71% respectively for Padstow (Polzeath, Trevone and Harlyn) and Bude areas over the 6 years, possibly related to the regular cleaning, however litter increased by 120% despite this monthly cleaning effort on the Padstow area beaches. Importantly, at all nine beaches the litter was dominated by small, fragmented plastic pieces and rope fibres, which account for 32% and 17% of all litter items collected, respectively. The weathered nature of these plastics indicates they have been in the marine environment for an extended period of time. So, whilst classifying the original source of these plastics is not possible, it can be concluded they are not the result of recent public littering. This data highlights both the extent of the marine litter problem and that current efforts to reduce littering by beach users will only tackle a fraction of this litter. Such information is vital for developing effective management strategies for beach and marine litter at both regional and global levels. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Change in public attitudes towards a Cornish wind farm: Implications for planning

    International Nuclear Information System (INIS)

    Eltham, Douglas C.; Harrison, Gareth P.; Allen, Simon J.

    2008-01-01

    While independently conducted polls suggest significant public support for wind energy, there are often objections to particular wind farm developments from the local population which can result in planning permission being declined and a restriction in the ability to meet renewable energy and greenhouse gas reduction targets. The aim of the study was to determine whether the pre-construction opinions held by communities local to a wind farm change after an extended period following commissioning. Residents of St. Newlyn East, Cornwall, England, were asked to recall their opinions of Carland Cross wind farm in 1991 and 2006. Statistically significant changes in opinion were observed for attitudes regarding the wind farm's visual attractiveness and the importance of the energy security it provides. This study continues by exploring potential reasons for this in the context of recent literature on public attitudes towards renewable energy. The findings of this study support the proposals in the 2007 UK White Paper, Planning for a Sustainable Future, for community engagement early in the project process and for the requirement of infrastructure to be debated at the national level

  13. Through the sands of time: Beach litter trends from nine cleaned north cornish beaches

    International Nuclear Information System (INIS)

    Watts, Andrew J.R.; Porter, Adam; Hembrow, Neil; Sharpe, Jolyon; Galloway, Tamara S.; Lewis, Ceri

    2017-01-01

    Marine litter and its accumulation on beaches is an issue of major current concern due to its significant environmental and economic impacts. Yet our understanding of spatio-temporal trends in beach litter and the drivers of these trends are currently limited by the availability of robust long term data sets. Here we present a unique data set collected systematically once a month, every month over a six year period for nine beaches along the North Coast of Cornwall, U.K. to investigate the key drivers of beach litter in the Bude, Padstow and Porthcothan areas. Overall, an average of 0.02 litter items m −2 per month were collected during the six year study, with Bude beaches (Summerleaze, Crooklets and Widemouth) the most impacted (0.03 ± 0.004 litter items m −2 per month). The amount of litter collected each month decreased by 18% and 71% respectively for Padstow (Polzeath, Trevone and Harlyn) and Bude areas over the 6 years, possibly related to the regular cleaning, however litter increased by 120% despite this monthly cleaning effort on the Padstow area beaches. Importantly, at all nine beaches the litter was dominated by small, fragmented plastic pieces and rope fibres, which account for 32% and 17% of all litter items collected, respectively. The weathered nature of these plastics indicates they have been in the marine environment for an extended period of time. So, whilst classifying the original source of these plastics is not possible, it can be concluded they are not the result of recent public littering. This data highlights both the extent of the marine litter problem and that current efforts to reduce littering by beach users will only tackle a fraction of this litter. Such information is vital for developing effective management strategies for beach and marine litter at both regional and global levels. - Highlights: • Unique and systemically collected beach clean data set from 9 beaches over 6 years. • The most abundant litter items were various sizes of weather plastic pieces. • Weathered litter items are difficulty to assign to a specific source. - We found an average of 0.02 litter items m 2 of beach, due to weathering of the litter 41% of all litter items could not be assigned to a specific source.

  14. Geology of Reskajeage Farm Quarry (Nirex research site on Cornish slate)

    International Nuclear Information System (INIS)

    Hancock, P.L.; North, C.P.

    1989-08-01

    Convection with any water flow is the most likely way in which any radionuclides escaping from deep disposal of radioactive waste in hard fractured rock could return to the surface. Hence the interest in water flow and mass transport through fractures for establishing the safety of such disposal. Earlier work on this subject was carried out in granite at Troon in Cornwall. This work provided statistical data about individual fractures and helped with the development of realistic modelling of flow and transport (Bourke 1985 and 1988). Validation of this modelling was however impractical. Access was obtained to another site with a much smaller separation between fractures in slate to allow measurement of flow and transport through representative volumes of 10m dimensions. Individual fracture statistics are being determined so that modelling predictions can be theoretically made for experimental proving. The programme at the site was begun with a geological investigation. The main findings are that the somewhat heterogeneous hard rock consists mostly of siltstone with some sandstone layers, that it is not untypically broken by many fractures and that a comparatively major (3m wide) fault with slip of about a metre between its faces crossing part of the site. These findings are described in detail in the report. (author)

  15. Collective invention during the British Industrial Revolution : the case of the Cornish pumping engine

    NARCIS (Netherlands)

    Nuvolari, A.

    2004-01-01

    In this paper we argue that what Robert Allen has termed as collective invention settings (that is settings in which competing firms share technological knowledge) were a crucial source of innovation during the early phases of industrialization. Until now this has been very little considered in the

  16. Collective invention during the British industrial revolution : the case of the Cornish pumping engine

    NARCIS (Netherlands)

    Nuvolari, A.

    2004-01-01

    This paper argues that what Robert Allen has termed collective invention settings (that is, settings in which competing firms share technological knowledge) were a crucial source of innovation during the early phases of industrialisation. Until now this has been very little considered in the

  17. Ergenlik Dönemi Okuma Tutumu Ölçeği’nin Türkçe’ye Uyarlanması The Adaptasyon Of Survey Of Adolescent Reading Attitudes (Sara Into Turkish

    Directory of Open Access Journals (Sweden)

    Muhammet BAŞTUĞ

    2013-07-01

    Full Text Available The aim of this study is to adapt the Survey of Adolescent Reading Attitudes SARA to Turkish, which was developed by McKenna, Conradi, Lawrance, Jang, and Meyer (2012, and to test it for validity and reliability. The rationale is that the scale involves one’s attitude towards digital reading. The sample was comprised of 702 sixth,seventh and eighth grade students in Konya- 343 of them being femaleand the remaining 359 being male. The original scale had 18 items infour sub-dimensions, namely academic reading in digital settings (AD,recreational reading in digital settings (RD, academic reading in printsettings (AP and recreational reading in print settings (RP. Theexploratory factor analysis and confirmatory factor analysis revealedthat the four original sub-dimensions were retained when two itemswere omitted. Cronbach’s alpha coefficients were 0.691, 0.802, 0.690,0.660 and 0.623 for the overall scale, RD, RP, AP and AD respectively.The results suggest that the adapted scale is reliable and valid. The 15-item finalized version is appropriate for the Turkish language and use inTurkey. In the development of reading environments and materials,identification of students’ attitudes toward reading in a multidimensionalway is expected to make great contributions to morequalified learning environments. Bu araştırmanın amacı, McKenna, Conradi, Lawrence, Jang ve Meyer (2012 tarafından geliştirilen Ergenlik Dönemi Okuma Tutumu Ölçeği’nin geçerlik ve güvenirliğinin yapılarak Türkçe’ye uyarlanmasıdır. Ölçeğin dijital okumaya karşı tutumu da kapsaması sebebiyle uyarlama çalışmasının uygun olacağı düşünülmüştür. Çalışma grubunu Konya ilinde yer alan ve 6,7 ve 8. Sınıflara devam eden 343’ü kız, 359’u erkek toplam 702 öğrenci oluşturmuştur. Ölçeğin orjinali 18 maddeden ve “Akademik Dijital, Serbest Dijital, Akademik Kağıt ve Serbest Kağıt” olmak üzere 4 alt boyuttan olu

  18. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    Directory of Open Access Journals (Sweden)

    Mihael Černetič

    2015-02-01

    Full Text Available The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is analysed from the perspective of mindfulness. Within the course of therapy, parallels were observed between the client's increased mindfulness, improved internal and external contact, strengthened Adult ego state, mastery of introjections, as well as diminished feelings of guilt, improved mood, self care and ability to engage in appropriate separation and individuation. These gains support the conclusion that Integrative Psychotherapy and mindfulness are inherently related and that explicit incorporation of mindfulness may enhance the therapeutic process of Integrative Psychotherapy.

  19. Discovery of carbon nanotubes. Sara ni carbon nanotube e

    Energy Technology Data Exchange (ETDEWEB)

    Iijima, S

    1994-01-20

    This paper describes the following matters on carbon nanotubes (CNt): CNt is discovered in carbon deposits generated in the tip of a negative electrode during DC arc discharge between carbon electrodes. CNt has a construction in which cylinders made of normally several layers are superposed, based on cylindrical crystals in a single layer with six-member rings of carbon atoms laid out. Spiral arrangement of carbon six-member rings has been discovered in the single-layered crystals. Five-member rings exist in a location where the CNt tip is closed, and seven-member rings in a location where the CNt presents a saddle-like curve, without exceptions. It is introduced theoretically that the electronic structure of the single-layered CNt depends on the cylinder diameter and spiral pitch. Replacing part of the carbon negative electrode with iron, and vaporizing iron and carbon simultaneously through arc discharge can result in a single-layered CNt with a diameter of 1 nm. Heating the CNt deposited with metallic lead in an oxygen atmosphere can form CNt containing lead compounds. 19 refs., 9 figs.

  20. AFSC/REFM: Alaska Stock Assessment Results Archive (SARA)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Each year over 50 Alaskan groundfish stock assessments report the condition of Alaskan fisheries resources in the U.S. Exclusive Economic Zone. Stock assessment...

  1. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    OpenAIRE

    Mihael Černetič

    2015-01-01

    The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is ana...

  2. Gene : CBRC-SARA-01-0604 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available and polyadenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82107.1| cleavage and poly...adenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82108.1| cleavage and polyadenylat...ion specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] 3e-16 77% MSTVPTVSCTS...TDRWGLVGTGRCYGSGRGGSMLASCGELSQAIALPKPVLSGHQAGSDPAGSSLYLVLPEGRCLPSVPAHVCPGTAEPAQHSQTPLQRELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVCPWAGVPRAGRPGPQAQPALSFRCMQWPPAPIRHAPASHA ...

  3. 9 CFR 381.170 - Standards for kinds and classes, and for cuts of raw poultry.

    Science.gov (United States)

    2010-01-01

    ... INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY... poultry, and the requirements for each class: (1) Chickens—(i) Rock Cornish game hen or Cornish game hen. A Rock Cornish game hen or Cornish game hen is a young immature chicken (usually 5 to 6 weeks of age...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1| unnamed protein product [Mus musculus] gb|EAW65549.1| non imprinted in Prader-Willi/Angelman syndrome 1, ...isoform CRA_a [Homo sapiens] gb|EAW65551.1| non imprinted in Prader-Willi/Angelman syndrome 1, isoform CRA_a... [Homo sapiens] gb|ABM82178.1| non imprinted in Prader-Willi/Angelman syndrome 1 ...[synthetic construct] gb|ABM85364.1| non imprinted in Prader-Willi/Angelman syndrome 1 [synthetic construct] CAD97953.1 1e-113 81% ...

  5. Sara Lipton in Conversation with Eva Janáčová. [Interview

    Czech Academy of Sciences Publication Activity Database

    Janáčová, Eva; Lipton, S.

    2017-01-01

    Roč. 65, č. 1 (2017), s. 66-70 ISSN 0049-5123 Institutional support: RVO:68378033 Keywords : Judaism * Middle Ages * art Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Arts, Art history

  6. Low energy neutral atom imaging on the Moon with the SARA ...

    Indian Academy of Sciences (India)

    (LENA) imaging mass spectrometer, which will perform remote sensing of the lunar surface via detection of neutral atoms in the energy range from 10eV to 3keV from a 100km polar orbit. ..... as studying the existence of ion void regions around.

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1549 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndent protein export [Herminiimonas arsenicoxydans] emb|CAL63167.1| twin-arginine translocase subunit, sec-i...ndependent protein export [Herminiimonas arsenicoxydans] YP_001101288.1 2.0 37% ...

  8. The State Authorization Reciprocity Agreement (SARA): A Good Idea Whose Time Has Come

    Science.gov (United States)

    Longanecker, David; Hill, Marshall A.

    2014-01-01

    In this article the authors argue that states need a new way to oversee the delivery of postsecondary distance education across state borders. They assert that the current process is too spotty to assure consistent consumer protection and too cumbersome and expensive for institutions. Because education is not specified in the US Constitution as a…

  9. 75 FR 67770 - Sara Lee Corporation Including On-Site Leased Workers From EDS, Hewitt Packard, Sapphire...

    Science.gov (United States)

    2010-11-03

    ..., Deductions, Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial... this certification to include workers providing shared financial and information technology services at..., Deductions, Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial...

  10. In Ukraine, Fear of Being a Resurgent Russiaѫs Next Target / Nicholas Kulish, Sara Rhodin

    Index Scriptorium Estoniae

    Kulish, Nicholas

    2008-01-01

    Gruusia ja Venemaa vaheline konflikt on suurendanud ebakindlust Venemaa suhtes ka Ukrainas, Poolas ja Balti riikides. Eesti president Toomas Hendrik Ilves leiab, et Gruusia sündmustel on tõsised tagajärjed rahvusvahelise rahu jaoks. Vabariigi President töövisiidil Gruusias 12.-13.08.2008

  11. Feminism and Childcare: A Roundtable with Sara de Benedictis, Gideon Burrows, Tracey Jensen, Jill Rutter and Victoria Showunmi

    OpenAIRE

    Jo Littler; Alison Winch

    2016-01-01

    This is an edited transcript of a roundtable event held at City University London in late 2014. The point of this seminar was to ask: what progress have we made towards men and women equally sharing the childcare? Rearranging the domestic division of labour was a crucial issue foregrounded by second-wave feminism: but how much progress has actually been made since then? Second-wave feminists and beyond have recently been vocal in replying: ‘not so much.’ For example, Bea Campbell has argued t...

  12. Motivating the European voter: Parties, issues and campaigns in European Parliament elections / Sara B. Hobolt, Jae-Jae Spoon

    Index Scriptorium Estoniae

    Hobolt, Sara B.

    2012-01-01

    Valijate käitumisest Euroopa Parlamendi (EP) valimistel liikmesriikides (sh Eesti), valijakäitumise erinevustest võrreldes siseriiklike valimistega ja parteide mõjust valijakäitumisele. Tabelid, joonised

  13. 9 CFR 381.76 - Post-mortem inspection, when required; extent; traditional, Streamlined Inspection System (SIS...

    Science.gov (United States)

    2010-01-01

    ...; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS... (NELS) Inspection System, both of which shall be used only for broilers and cornish game hens; the New... Inspection. (i) The SIS shall be used only for broilers and cornish game hens if: (a) The Administrator...

  14. Larger, Higher-level Academic Institutions in the US Do Not Necessarily Have Better-resourced Library Web Teams. A Review of: Connell, Ruth Sara.

    Directory of Open Access Journals (Sweden)

    Suzanne Lewis

    2008-12-01

    Full Text Available Objective – To discover how library Web teams’ staffing, backgrounds, tools, and professional development differ among various types of academic libraries.Design – Survey.Setting – Academic libraries in the United States.Subjects – Academic library Web team members.Methods – A systematic sample of every twelfth institution on The Carnegie Classification of Institutions of Higher Education list was used to establish a sample group. A Web search was carriedout to identify each institution’s library Web site and contact information for the Web site designer or most appropriate alternative person. Institutions were excluded from the sample if they had no Web site at all, had no library Web site, had a Web site that did not mention a library, or had a Spanish language Web site. In September 2006 an e-mail was sent to the contact for each institution in the sample group asking them to participate in an online survey. A follow up e-mail was sent two weeks later and the survey closed after one month. The survey respondents were asked to identify their institutions so that analysis of the results in relation to the sizeand type of institution could be carried out. The researchers used a simplified version of the Carnegie classification to sort the responding institutions into five main groups.Main Results – The systematic sample consisted of 288 institutions (sample size 6.5%. The profile of the responding institutions was as follows: associate’s colleges (35.5%, baccalaureate colleges (18.2%, master’s colleges and universities (20.9%, doctorate-granting universities (9% and special focus institutions (15.5%. A total of 110 institutions completed the survey, yielding a response rate of 38.19%, although not all respondents answered all the survey questions. The final sample of 110 was 2.5% of the total 4384 institutions on the Carnegielist. Seventy-one per cent of institutions with multiple libraries shared Web teams, with two-year colleges more likely (91.7% to share a Web team than four-year or above institutions (60.9%. The majority of responding institutions (94.4% used in-house library Web site design, with only 5.6% of respondents outsourcing this task.Nearly half (49% of respondents indicated that library Web design was done by one person and even the larger libraries did not necessarily have larger Web teams. Very few Web team members (4.9% had Web design as their primary role; the majority (83.5% indicated that it was just one component of their job. Web team members from master’s- and doctorate-granting institutions were more likely to have taught themselves Web design, while those from associate, baccalaureate and special focus colleges were more likely to have taken Web design courses. For all respondents, the most commonly listed quality for selection to the Web team was an interest in Web design and the most valued skill for library Web designers was the ability to organise information effectively.Knowledge of Web authoring software and basic HTML coding were the most commonly listed knowledge requirements for Web team members. A significant number of respondents indicated that they or other Web team members did not have access to Web authoring (36.9% and image editing (52% software. Generally (except for two very large institutions, the larger institutions were more likely to use database-driven systems for their library Web sites and the smaller institutions were more likely to use content management systems. Associate’s and special focus colleges were less likely than other types of institutions to use either database driven or content management systems. Associate’s institutions were more likely to achieve ADA (Americans with Disabilities Act Web accessibility compliance. Only 48.6% of respondents utilised usability testing during Web site design.Conclusion – The author expected that institutions providing higher levels of education would have better-resourced Web design and training, but the results of the survey did not support this expectation. One reason why associate’s colleges performed better than other institutions in some areas of Web design may be that these colleges tend to offer more Web design and computer technology courses than baccalaureate, master’s and doctorate-granting institutions. Web site design and testing attracted fewer resources than might be expected in academic libraries. Across all types of institutions, Web design tended to be the responsibility of a small team or one person, with most Web designers having other responsibilities apart from the library’s Web site. Just over half of the institutions surveyed did not implement usability testing of their library Web sites.

  15. The National Shipbuilding Research Program, 1990 Ship Production Symposium, Paper No. 4B-1: Solving SARA Compliance with Computerized Hazardous Materials Tracking

    National Research Council Canada - National Science Library

    Johnston, Don; Schoenleber, Dave

    1990-01-01

    ...) has forced facilities to keep track of hazardous materials as never before. EPCRA contains five major reporting requirements including planning notification, emergency release notification, Material Safety Data Sheet (MSDS...

  16. MULTICULTURALISM AND RELIGIOUS-BASED CONFLICT: EVENTS OF CONFLICT BASED ON ETHNICITY, RELIGION, RACE, AND INTER-GROUP RELATIONS (SARA IN THE CITY OF PONTIANAK

    Directory of Open Access Journals (Sweden)

    Lailial Muhtifah

    2013-06-01

    Full Text Available There is a tendency of similar idea that caught the conflict prevention and management efforts nowadays to the articles of the Charter of Medina which was religious-based and containing the theory of civil society. It I mostly on the handling of conflict which tends to take preventive measures and to stop the conflict directly, as well as making a comprehensive synergistic effort to mange conflict. Conflict prevention is a core component of a comprehensive Conflict Management Program. This paper explores the conflict that occurred in Ponianak between a group of people from ethnic Dayak and members of an Islamic organization in 2012 which includes an important lesson for the people of West Kalimantan, both for the government and the community elements especially in dealing with a dispute between different groups of people. An integrative prevention has been proven to be able to answer the question of handling a conflict that has a potential to escalate into a full-scale riot. This work concludes that an integrative conflict handling model may become a viable alternative model to be adopted by the community of West Kalimantan in particular and other societies in general. A synergic integrative conflict handling model that reflects local wisdom of the people of Pontianak is expected to inspire real peace for various communities with a multicultural background. Key words: multicultural, religious-based conflict, ethnicity, religion

  17. THE EFFECT OF OIL POLLUTION FROM THE TANKER "WAFRA ...

    African Journals Online (AJOL)

    "WAFRA" ON THE MARINE FAUNA OF THE CAPE AGULHAS. AREA ... Canyon disaster off the Cornish coast in 1967 and a useful introduction to the problem of .... The dominant marine plants and animals at Cape Agulhas have been.

  18. All About the Protein Foods Group

    Science.gov (United States)

    ... chicken breast half = 3 ounce-equivalents ½ Cornish game hen = 4 ounce-equivalents Seafood 1 ounce cooked ... equivalents Selection Tips Choose lean or low-fat meat and poultry. If higher fat choices are made, ...

  19. Sword or Ploughshare? New Roles for NATO and the Changing Nature of Transatlantic Relations

    Science.gov (United States)

    2008-02-01

    1990/91. On this topic, see Paul Cornish, “European Security: The End of Architecture and the New NATO,” International Affairs, Vol. 72, No. 4...Basingstoke, New York, Palgrave, 2001, Vol. 2, Part V, pp. 29-42 (31). 82 On this topic, see Paul Cornish, “European Security: The End of Architecture ...increasing prosperity, but also due to its leading role in art and literature and their mass dissemination through the medium of cinema , for example

  20. An analysis of decision making and criminal outcomes in sexual offenders

    OpenAIRE

    Pedneault, Amelie

    2015-01-01

    In 1985, Clarke and Cornish proposed the rational choice framework to study criminal decision making. According to their approach, decisions of a criminal nature are not different than any other type of decision, and are thus orientated toward the satisfaction of commonplace needs. We adopted this approach and looked at a sample of 898 male sexual offenders as decision makers, framing their sexually coercive decisions as means to obtain desired outcomes. Clarke and Cornish specifically propos...

  1. Screamy Bird

    DEFF Research Database (Denmark)

    Tarby, Sara; Cermak, Daniel

    2016-01-01

    Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016.......Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016....

  2. Epimural Indicator Phylotypes of Transiently-Induced Subacute Ruminal Acidosis in Dairy Cattle

    OpenAIRE

    Wetzels, Stefanie U.; Mann, Evelyne; Metzler-Zebeli, Barbara U.; Pourazad, Poulad; Qumar, Muhammad; Klevenhusen, Fenja; Pinior, Beate; Wagner, Martin; Zebeli, Qendrim; Schmitz-Esser, Stephan

    2016-01-01

    The impact of a long-term subacute rumen acidosis (SARA) on the bovine epimural bacterial microbiome (BEBM) and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a 1-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA...

  3. Acanthopagrus schlegeli

    Indian Academy of Sciences (India)

    The conditions for amplification were 5 min at 95. ◦. C, fol- lowed by 30 cycles of ... This work was supported by the National Natural Science Foun- dation of China (NSFC) ... Sadovy Y. and Cornish A. S. 2000 Reef fishes of Hong Kong. Hong.

  4. Possibilities of paired comparison of receptor binding parameters obtained in a single experiment

    International Nuclear Information System (INIS)

    Mashilova, K.V.; Kiriakov, G.V.; Malin, K.M.; Rozhanets, V.V.

    1987-01-01

    The authors explore the use of comparing control and experimental groups on the basis of extrapolation parameters obtained from a single pair of experiments. One of the experiments study the parameters of specific binding of 3 H-D-ala-2-enkephelin-5-D-leucine in the striatum of different groups of rats. The analysis was done by the Cornish-Bowden method

  5. Attentional Differences between Groups of Preschool Children Differentiated by Teacher Ratings of Attention and Hyperactivity

    Science.gov (United States)

    Wilding, John; Burke, Kate

    2006-01-01

    This study aimed to extend earlier work (Wilding, Munir, & Cornish, 2001; Wilding, 2003) which showed that children (aged 6-15) who were rated by their teachers as having poor attentional ability made more errors on a visual search task than children rated as having good attentional ability. The present study used a simpler version of the search…

  6. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Synergy between verapamil and other multidrug -resistance modulators in model membranes · Madeleine Castaing Alain Loiseau Athel Cornish-Bowden · More Details Abstract Fulltext PDF. Various cationic lipophilic compounds can reverse the multidrug resistance of cancer cells. Possible interaction between these ...

  7. 40 CFR 131.33 - Idaho.

    Science.gov (United States)

    2010-07-01

    ... KOOTENAI BASIN: Ball Creek, Boundary Creek, Brush Creek, Cabin Creek, Caribou Creek, Cascade Creek, Cooks...), Setzer Creek, Sherlock Creek, Simmons Creek, Siwash Creek, Skookum Creek, Thomas Creek, Thorn Creek... Creek, Cold Creek, Collie Creek, Colt Creek, Cook Creek, Corley Creek, Cornish Creek, Cottonwood Creek...

  8. 75 FR 27288 - New Performance Standards for Salmonella and Campylobacter in Young Chicken and Turkey Slaughter...

    Science.gov (United States)

    2010-05-14

    ... information becomes available, FSIS encourages meat and poultry establishments to follow this guidance. FSIS... responsible for ensuring that the nation's commercial supply of meat, poultry, and processed egg products is... Cornish game hens. The Agency intends to use the same sample collection and analysis procedures that it...

  9. Programme of research into the management and storage of radioactive waste. Aqueous phase transport through granitic rocks

    International Nuclear Information System (INIS)

    Bradbury, M.H.; Green, A.

    1984-01-01

    Three aspects of work on aqueous phase transport by diffusion through porous granites are considered (1) The formation factor and long range connectivity of pore structure. (2) The effect of degraded fissure surfaces on diffusion into the main pore structure. (3) Effect of overburden pressures at depth on diffusion rates. Experiments were conducted on Cornish carnmenellis granite. (U.K.)

  10. Book Review: Commemoration as Conflict: Space, Memory and Identity in Peace Processes

    DEFF Research Database (Denmark)

    McQuaid, Sara Dybris

    2016-01-01

    Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7......Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7...

  11. Butanol/Gasoline Test Plan

    Science.gov (United States)

    2012-03-01

    authorities. METHODS FOR CLEANING UP: Contain spillage and then collect with non-combustible absorbent material, (e.g. sand, soil , diatomaceous earth...SARA 311/312 Hazards: Fire Hazard, Acute Health Hazard, and Chronic Health Hazard CERCLA SECTION 103 and SARA SECTION 304 (RELEASE TO THE ENVIROMENT

  12. En ny flugt ind i skoven

    DEFF Research Database (Denmark)

    Haarder, Jon Helt

    2008-01-01

    Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner......Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner...

  13. Journal of Food Technology in Africa - Vol 7, No 3 (2002)

    African Journals Online (AJOL)

    Identification of Lactic Acid Bacteria isolated from Opaque beer (Chibuku) for potential use as a starter culture. Chamunorwa A Togo, Sara B Sara B. Feresu, Anthony Mutukumira. http://dx.doi.org/10.4314/jfta.v7i3.19239 · Performance of different strains of Pleurotus species under Ghanaian conditions. K Vowotor, M Obodai.

  14. Use and Access of Grey Literature in Special Libraries may be Hindered by Lack of Visibility and Cataloguing. A review of: Ranger, Sara L. “Grey Literature in Special Libraries: Access in Use.” Publishing Research Quarterly 21.1 (Spring 2005: 53-63.

    Directory of Open Access Journals (Sweden)

    David Hook

    2006-03-01

    Full Text Available Objective – To examine the barriers to making grey literature (literature not controlled by commercial publishers easier to access in special libraries. Design – Interviews. Setting – Variety of special libraries (government, corporate and specialized academic in the United States. Subjects – Sixteen librarians from fourteen organizations in Washington, Michigan and Texas were interviewed. Four of the organizations were government libraries, four were corporate libraries and five were specialized academic libraries. One of the interviews was not used because the organization did not maintain a collection of paper‐based grey literature. Methods – Librarians were selected as possible interview subjects via three methods: some were previously familiar with the author; some were referred to the author by friends, family and colleagues; two candidates volunteered in response to a presentation of the project at a professional meeting. Interviews were conducted between February 2002 and May 2003. A standard set of seven questions were used, but often followed with further questions. The interviews were conducted either in the library or the librarian’s office. The interviews were tape‐recorded and the answers were written down. Interviews typically lasted between fifteen and thirty minutes and asked about the current state, holdings, access and use of grey literature in the special library. Main Results – Results from the interviews suggest a wide variance in the percentage of users that access grey literature. Grey literature was used less in the corporate libraries than the academic and government libraries. The percentage of the collection made up of grey literature also varied widely between the different libraries. Reports were found to be the most popular form of grey literature, although most of the libraries reported owning conference proceedings and newsletters in addition to reports. One interesting observation found during the interviews was that most of the users of grey literature are also producers of grey literature. The librarians surveyed reported that some of the reasons for using grey literature included use in research, to write (often more grey literature, interest in the topic, for class assignments, as records of previous practices, for localized studies, and for creating models and practices. Results found that for the libraries surveyed, much of the grey literature remains uncatalogued and what has been catalogued was done using a variety of methods. Over half of the libraries surveyed had their grey literature accessible online. Conclusion – Two main reasons were cited as explanations for why grey literature was not used as much as it should be: lack of cataloguing and visibility. In many of the libraries surveyed, much of the grey literature had not been catalogued, making it difficult to find and use the resources. Reasons cited for not cataloguing grey literature include lack of time, funds and/or knowledge. As well, in many of the libraries surveyed, it was found that the holdings of grey literature were not readily visible to the users, so users were not even aware that it existed. To improve the awareness and accessibility of grey literature, the author recommends regional depositories for grey literature, international standards for cataloguing and more cooperation between special libraries.

  15. REPRESENTASI ANTI DISKRIMINASI PADA FILM KARTUN 3D ZOOTOPIA (KAJIAN SEMIOTIKA ROLAND BARTHES

    Directory of Open Access Journals (Sweden)

    Ali Muqoddas

    2016-12-01

    Full Text Available Isu diskriminasi SARA seperti tiada habisnya terjadi di dunia ini, begitu juga di Indonesia. Hal ini mengakibatkan tema-tema tentang SARA menjadi sensitif ketika dibahas atau pun difilmkan. Hal ini mengakibatkan jarang ditemui film yang mengangkat tentang SARA. Lain halnya dengan Walt Disney. Walt Disney baru-baru ini merilis film kartun 3D yang mengangkat tema anti diskriminasi SARA yang berjudul Zootopia. Film ini menjadi menarik karena isu diskriminasi SARA yang diangkat dibalut dengan konsep yang kreatif hingga sensivitas isu SARA tersebut menjadi berkurang. Representasi anti diskriminasi SARA pada film Zootopia ini selanjutnya dikaji dengan metode semiotika Roland Barthes dengan pendekatan deskriptif kualitatif. Berdasarkan dari analisis, dapat disimpulkan bahwa film Zootopia memuat pesan ideologi tentang anti diskriminasi SARA bahwa kedudukan manusia dimata manusia yang lain pada hakikatnya adalah sama. Setiap manusia berhak dan wajib memperlakukan dan diperlakukan secara bijak tanpa memperdulikan background asal manusia itu sendiri. Penghargaan pada setiap individu tidak didasarkan pada faktor keturunan, ras, suku ataupun agama, namun didasarkan pada prestasi dari individu itu sendiri. Kata Kunci: diskriminasi SARA, Zootopia, Roland Barthes Abstract The issue of racial discrimination as an endless happen in this world, so also in Indonesia. This resulted in the themes of SARA be sensitive when discussed or filmed. This resulted in a rare film that raised about SARA. Another case with Walt Disney. Walt Disney recently released 3D animated film that mengangat theme of anti-discrimination SARA entitled Zootopia. This film is interesting because racial discrimination issues raised wrapped with a creative concept to the sensitivity of the racial issues be reduced. SARA anti-discrimination representation on film Zootopia is further studied with Roland Barthes semiotic methods with qualitative descriptive approach. Based on the analysis, it can

  16. The use of sodic monensin and probiotics for controlling subacute ruminal acidosis in sheep

    Directory of Open Access Journals (Sweden)

    Elizabeth Schwegler

    2015-02-01

    Full Text Available The aim of this work was to validate a protocol for induction of subacute ruminal acidosis (SARA (Experiment 1 and test the efficiency of probiotic Saccharomyces cerevisiae or monensin to avoid pH ruminal drops in sheep (Experiment 2. In Experiment 1, six ewes were fasted for two days and then fed most with concentrate during four days. Ewes in this protocol had ruminal fluid pH below 6.0 and kept it for 75 consecutive hours. In Experiment 2, 18 sheep were distributed into three groups: Control (CG, n = 6, monensin (MG, n = 6 and probiotic group (PG, n = 6. SARA was induced according Experiment 1. PG had lower pH (5.7 ± 0.1 than CG (6.0 ± 0.1 (P = 0.05, while MG (5.7 ± 0.1 was similar to both during SARA induction. SARA induction reduced ruminal protozoa population (P < 0.05 and increased chloride concentrations in ruminal fluid (P < 0.01. In serum, SARA increased concentrations of phosphorus (P < 0.01, AST (P < 0.01 and GGT (P < 0.01, but reduced LDH (P < 0.01. In conclusion, the protocol used for SARA induction was able to maintain ruminal pH between 5.5-6.0 for more than 48 hours. However, monensin and probiotics supplementation was not effective in preventing changes in ruminal and serum parameters during SARA.

  17. Alteration in Fecal Microbiota Associated with Grain-induced Subacute Ruminal Acidosis Challenge in Dairy Cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    in the field are often not detected. Thus, other and better markers of SARA are needed. The purpose of this research was to study the feces microbiome during SARA and assess the possibilities of using feces microbial markers as indicators of SARA. Methods: Six lactating, rumen cannulated, Danish Holstein cows...... were used in a blocked design study including two blocks. In the first block, two cows received control diet and two cows received SARA-challenge diet. In the second block, former control cows received SARA diet while two new cows received control diet. Cows received a total mixed ration (TMR; 24......% concentrate) for four weeks before the trial. SARA was induced by gradual substitution of 40% of TMR with grain pellets (50:50 wheat:barley) over 3 days. Full SARA diet was fed for four days. Rumen pH was measured continuously by indwelling probes (eCow). Feces samples were taken at 9 am and 9 pm on last day...

  18. Breakfast and Energy Drink Consumption in Secondary School Children: Breakfast Omission, in Isolation or in Combination with Frequent Energy Drink Use, is Associated with Stress, Anxiety, and Depression Cross-Sectionally, but not at Six-Month Follow-Up

    OpenAIRE

    Gareth eRichards; Andrew Paul Smith

    2016-01-01

    A considerable amount of research suggests that breakfast omission and the frequent use of caffeinated energy drinks may be associated with undesirable effects, and particularly so in children and adolescents. The current paper presents cross-sectional and longitudinal data from the Cornish Academies Project to investigate the effects of consuming energy drinks and missing breakfast on stress, anxiety, and depression in a cohort of secondary school children from the South West of England. Que...

  19. Breakfast and Energy Drink Consumption in Secondary School Children: Breakfast Omission, in Isolation or in Combination with Frequent Energy Drink Use, is Associated with Stress, Anxiety, and Depression Cross-Sectionally, but not at 6-Month Follow-Up

    OpenAIRE

    Richards, Gareth; Smith, Andrew P.

    2016-01-01

    A considerable amount of research suggests that breakfast omission and the frequent use of caffeinated energy drinks may be associated with undesirable effects, and particularly so in children and adolescents. The current paper presents cross-sectional and longitudinal data from the Cornish Academies Project to investigate the effects of consuming energy drinks and missing breakfast on stress, anxiety, and depression in a cohort of secondary school children from the South West of England. Que...

  20. Heat transfer experiment in a granite formation at Cornwall

    International Nuclear Information System (INIS)

    Bourke, P.J.; Hodgkinson, D.P.

    1985-01-01

    An experiment simulating a waste package was started in 1978 in Cornish granite. To obtain measurable temperature rises through large volumes of rock, an electrical heater at 50m depth was run for four years. The heater was then switched off and the cooling was monitored for another year. The results show that most of the heat transfer was by conduction but that some convection occurred and that temperatures can be predicted with some confidence

  1. Epimural indicator phylotypes of transiently-induced subacute ruminal acidosis in dairy cattle

    Directory of Open Access Journals (Sweden)

    Stefanie Urimare Wetzels

    2016-03-01

    Full Text Available The impact of a long-term subacute rumen acidosis (SARA on the bovine epimural bacterial microbiome (BEBM and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a one-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA isolation (4 sampling time points per cow: at the baseline before concentrate was fed, after the first SARA challenge, after the challenge break, and after the second SARA challenge. Ruminal pH was continuously monitored. The microbiome was determined using Illumina MiSeq sequencing of the 16S rRNA gene (V345 region. In total 1,215,618 sequences were obtained and clustered into 6,833 operational taxonomic units (OTUs. Campylobacter and Kingella were the most abundant OTUs (16.5% and 7.1%. According to ruminal pH dynamics, the second challenge was more severe than the first challenge. Species diversity estimates and evenness increased during the challenge break compared to all other sampling time points (P<0.05. During both SARA challenges, Kingella- and Azoarcus-OTUs decreased (0.5 and 0.4 fold-change and a dominant Ruminobacter-OTU increased during the challenge break (18.9 fold-change; P<0.05. qPCR confirmed SARA-related shifts. During the challenge break noticeably more OTUs increased compared to other sampling time points. Our results show that the BEBM re-establishes the baseline conditions slower after a SARA challenge than ruminal pH. Key phylotypes that were reduced during both challenges may help to establish a bacterial fingerprint to facilitate understanding effects of SARA conditions on the BEBM and their consequences for the ruminant host.

  2. Epimural Indicator Phylotypes of Transiently-Induced Subacute Ruminal Acidosis in Dairy Cattle.

    Science.gov (United States)

    Wetzels, Stefanie U; Mann, Evelyne; Metzler-Zebeli, Barbara U; Pourazad, Poulad; Qumar, Muhammad; Klevenhusen, Fenja; Pinior, Beate; Wagner, Martin; Zebeli, Qendrim; Schmitz-Esser, Stephan

    2016-01-01

    The impact of a long-term subacute rumen acidosis (SARA) on the bovine epimural bacterial microbiome (BEBM) and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a 1-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA isolation (4 sampling time points per cow: at the baseline before concentrate was fed, after the first SARA challenge, after the challenge break, and after the second SARA challenge). Ruminal pH was continuously monitored. The microbiome was determined using Illumina MiSeq sequencing of the 16S rRNA gene (V345 region). In total 1,215,618 sequences were obtained and clustered into 6833 operational taxonomic units (OTUs). Campylobacter and Kingella were the most abundant OTUs (16.5 and 7.1%). According to ruminal pH dynamics, the second challenge was more severe than the first challenge. Species diversity estimates and evenness increased during the challenge break compared to all other sampling time points (P < 0.05). During both SARA challenges, Kingella- and Azoarcus-OTUs decreased (0.5 and 0.4 fold-change) and a dominant Ruminobacter-OTU increased during the challenge break (18.9 fold-change; P < 0.05). qPCR confirmed SARA-related shifts. During the challenge break noticeably more OTUs increased compared to other sampling time points. Our results show that the BEBM re-establishes the baseline conditions slower after a SARA challenge than ruminal pH. Key phylotypes that were reduced during both challenges may help to establish a bacterial fingerprint to facilitate understanding effects of SARA conditions on the BEBM and their consequences for the ruminant host.

  3. Calculation of statistic estimates of kinetic parameters from substrate uncompetitive inhibition equation using the median method

    Directory of Open Access Journals (Sweden)

    Pedro L. Valencia

    2017-04-01

    Full Text Available We provide initial rate data from enzymatic reaction experiments and tis processing to estimate the kinetic parameters from the substrate uncompetitive inhibition equation using the median method published by Eisenthal and Cornish-Bowden (Cornish-Bowden and Eisenthal, 1974; Eisenthal and Cornish-Bowden, 1974. The method was denominated the direct linear plot and consists in the calculation of the median from a dataset of kinetic parameters Vmax and Km from the Michaelis–Menten equation. In this opportunity we present the procedure to applicate the direct linear plot to the substrate uncompetitive inhibition equation; a three-parameter equation. The median method is characterized for its robustness and its insensibility to outlier. The calculations are presented in an Excel datasheet and a computational algorithm was developed in the free software Python. The kinetic parameters of the substrate uncompetitive inhibition equation Vmax, Km and Ks were calculated using three experimental points from the dataset formed by 13 experimental points. All the 286 combinations were calculated. The dataset of kinetic parameters resulting from this combinatorial was used to calculate the median which corresponds to the statistic estimator of the real kinetic parameters. A comparative statistical analyses between the median method and the least squares was published in Valencia et al. [3].

  4. Production measurements affected by x irradiation of chicken semen

    International Nuclear Information System (INIS)

    Zartman, D.L.; Urquhart, N.S.; Francis, D.W.

    1976-01-01

    Single Comb White Leghorn (S.C.W.L.) and Dark Cornish semen was x-irradiated with 1000 R and introduced into S.C.W.L. hens to produce S.C.W.L. and crossbred chicks. The irradiation reduced the fertilizing capacity of the semen about 25% and the hatchability of the embryos about 38%. Semen of the two breeds was affected differently since there was much less alteration of embryonic development among purebred, S.C.W.L. chicks than among Cornish-sired crossbreds. As is typical, crossbred chicks gained weight faster than purebred S.C.W.L. irrespective of radiation damage. After irradiation, live weight was 4% less at 16 weeks of age for the crossbreds but no substantial effect on growth was evident for the S.C.W.L., although they were significantly heavier at hatching in the irradiated population. The rate of egg production in the first 30 days declined 15% under pressure from the irradiation damage. The distribution, as well as the frequency, of embryonic mortalities changed after parental semen irradiation. The majority of embryonic deaths occurred during the first 6 days of incubation with a coincidental decrease in the proportion of deaths occurring late during incubation. Posthatching mortalities were not affected for S.C.W.L. but were doubled for Cornish up to 16 weeks old

  5. Comparative study of laterality in people with fragile X syndrome, people with intellectual disabilities, and people with typical development.

    Science.gov (United States)

    Niort, Jannick; Hernández Vázquez, Francisco Javier

    2017-07-01

    Following on from the studies by McManus and Cornish [(1997). Fractionating handedness in mental retardation: What is the role of the cerebellum? Laterality, 2(2), 81-89] and Cornish, Pigram, and Shaw [(1997). Do anomalies of handedness exist in children with fragile-X syndrome? Laterality, 2(2), 91-101], the aim of this paper was to determine laterality in people with fragile X syndrome (FXS). The sample comprised three study groups: the first with 30 people with FXS (mean age 17.9 years), the second 34 people with various intellectual disabilities (ID, mean age 20.9 years), and the third 160 people with typical development (mean age 14.7 years). Laterality was assessed with a test adapted for this study. The results confirm the preponderance of right-handedness (93.3%) in people with FXS and present new data regarding footedness and sensory dominance (eyedness and earedness), indicating inconsistent footedness and ocular cross-dominance. Almost three-quarters (73.5%) of people with other ID were right-handed. The results corroborate those of McManus and Cornish (1997). People with FXS tend to be right-handed but have ocular cross-dominance.

  6. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-07

    Mar 7, 2018 ... ation with the pump units of various types operating in the optimal and correct mode. ... In the existing irrigation systems of the Sara- ... Journal of Fundamental and Applied Sciences is licensed under a Creative Commons ...

  7. Annual report of the Grenoble Institute of nuclear science

    International Nuclear Information System (INIS)

    Vignon, B.

    1988-01-01

    Research in theoretical nuclear physics; peripheral reactions and intermediate energy physics; characteristics of reaction mechanisms in heavy ion collisions; nuclear structure; fundamental interactions; interdisciplinary studies; experimental methods and instrumentation; and the SARA accelerator is presented [fr

  8. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  9. Preventing Pressure Sores

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  10. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  11. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  12. Hella hingega karmid naised / Krista Kaer

    Index Scriptorium Estoniae

    Kaer, Krista

    1996-01-01

    Tänapäeva kriminaalromaani inglise ja ameerika autoritest (Dame Phyllis Dorothy James, Joan Smith, Lynda La Plante (inglise); Sara Paretsky, Sue Grafton, Patricia Cornwell (ameerika) ja nende poolt loodud naisdetektiivi kujudest

  13. Bridging the gap between farmers and supermarkets in Nicaragua ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2014-07-03

    Jul 3, 2014 ... Elder chose to study smallholder farmers after working in Kenya as an ... Combining this data will help her gain expertise in qualitative and quantitative work. ... Sara Elder interviews smallholder farmers in Nicaragua.

  14. 75 FR 80037 - Poultry Programs; Notice of Request for an Extension and Revision of a Currently Approved...

    Science.gov (United States)

    2010-12-21

    ... DEPARTMENT OF AGRICULTURE Agricultural Marketing Service [Doc. No. AMS-PY-10-0098] Poultry... David Bowden, Jr., Chief, Standards, Promotion, & Technology Branch; Poultry Programs, AMS, U.S.... FOR FURTHER INFORMATION CONTACT: Sara Lutton, Standards, Promotion, & Technology Branch; Poultry...

  15. Investigating Asphaltenes Composition in Crude Oil Samples using ...

    African Journals Online (AJOL)

    MBI

    2015-12-22

    Dec 22, 2015 ... composition of asphaltenes by Iatroscan TLC-FID method was compared with the weight% of asphaltenes precipitated. ... SARA in the crude oil samples were determined in this work ..... Fractionation and characterization of.

  16. Nutrition from aquaculture and home gardens in Cambodia

    International Development Research Centre (IDRC) Digital Library (Canada)

    is about 76% carbohydrate, only 10% protein, and only 14% fat. Foods from animal sources ... to increase and diversify food production and provide low- ... Senior Program Specialist, Ottawa, Canada (awesley@idrc.ca) or. Sara Ahmed, Senior ...

  17. Mind Over Matter: Methamphetamine

    Science.gov (United States)

    ... Teaching Guide and Series / Methamphetamine Mind Over Matter: Methamphetamine (Meth) Print Order Free Publication in: English Spanish ... paranoia, aggressiveness, and hallucinations. The Brain's Response to Methamphetamine Hi, my name's Sara Bellum. Welcome to my ...

  18. Are You Shopping Smart for Prescription Drugs?

    Science.gov (United States)

    ... work well for them through the CR Best Buy Drugs program. Photo courtesy of Sara Jorde Photography A ... National Library of Medicine, the Consumer Reports Best Buy Drugs program helps consumers discuss drug choices with their ...

  19. Policy challenges in modern health care

    National Research Council Canada - National Science Library

    Mechanic, David

    2005-01-01

    ... for the Obesity Epidemic KENNETH E. WARNER 99 8 Patterns and Causes of Disparities in Health DAVID R. WILLIAMS 115 9 Addressing Racial Inequality in Health Care SARA ROSENBAUM AND JOEL TEITELBAU...

  20. Pop / Tõnis Kahu

    Index Scriptorium Estoniae

    Kahu, Tõnis, 1962-

    2008-01-01

    Heliplaatidest: Get Cape. Wear Cape. Fly "Searching For The Hows And Whys", The Black Crowes "Warpaint", Jonny Greenwood "There Will Be Blood", Tegan & Sara "The Con", Teräsbetoni "Myrskyntuoja", REM "Accelerate"

  1. 76 FR 11494 - List of Recipients of Indian Health Scholarships Under the Indian Health Scholarship Program

    Science.gov (United States)

    2011-03-02

    ... Collins, Sara Jane, University of Oklahoma, Cherokee Nation, Oklahoma Cook, David D., Rocky Vista... University, Oglala Sioux Tribe of the Pine Ridge Reservation, South Dakota Jim, Leroy, The Fielding Institute...

  2. 77 FR 44310 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2012-07-27

    ... JACINTA YEUNG CHEONG CHANG MICHAEL YIO-HOW CHENG NICOLAS VINCENT CHI TELLY TAI HSUAN CHINOY SAMIR MUSTAPHA... TONJA YVONNE SU JIN CHIN SU XIAOBO SARA SHAO SUEN SAMSON C. L. SY KEVIN NEIL TAN LAI HING THARALDSEN...

  3. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family ... play_arrow How is the delivery of a child affected by the mother's spinal cord injury? play_ ...

  4. Technical Guidance for Hazardous Analysis, Emergency Planning for Extremely Hazardous Substances

    Science.gov (United States)

    This current guide supplements NRT-1 by providing technical assistance to LEPCs to assess the lethal hazards related to potential airborne releases of extremely hazardous substances (EHSs) as designated under Section 302 of Title Ill of SARA.

  5. the capacity of megasphaera elsdenii strain ncimb 41125 to control ...

    African Journals Online (AJOL)

    David

    SARA include grain treatment to reduce starch degradation, feed additives such as ... Keywords: Megasphaera elsdenii, ruminal acidosis, dairy cattle, beef cattle, sheep, ...... Mastitis. Retained foetal membranes. Metritis/endometritis. Ketosis.

  6. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Kayvan Etebari1 Leila Matindoost2. Department of Sericulture, Faculty of Natural Resources, University of Guilan, Somehe Sara, Iran; Department of Entomology, Faculty of Agriculture, University of Guilan, Rasht, Iran ...

  7. Bacteriophage-antibiotic synergism to control planktonic and biofilm ...

    African Journals Online (AJOL)

    Bacteriophage-antibiotic synergism to control planktonic and biofilm producing clinical isolates of Pseudomonas aeruginosa. Amina Amal Mahmoud Nouraldin, Manal Mohammad Baddour, Reem Abdel Hameed Harfoush, Sara AbdelAziz Mohamed Essa ...

  8. Reforming the American Military Officer Personnel System

    Science.gov (United States)

    2015-12-02

    Lamping Lewis, Henry Leonard, Julia Pollak, Christopher Guo and Bernard Rostker, Tour Lengths, Permanent Changes of Station, and Alternatives for...Raymond E. Conley, Stephanie Young, William A. Williams, Jeffrey Engstrom, Barbara Bicksler, Sara Beth Elson, Joseph Jenkins , Lianne Kennedy

  9. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  10. Preventing Pressure Sores

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  11. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  12. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  13. Review of the Scientific Evidence of Using Population Normative Values for Post-Concussive Computerized Neurocognitive Assessments

    Science.gov (United States)

    2016-02-10

    R, Virginia Commonwealth University  Dr. Chris Giza, Professor of Pediatric Neurology and Neurosurgery, UCLA Brain Injury Research Center October...Sara Higgins , MPH Analyst, Grant Thornton LLP Kendal Brown, MBA Management Analyst, Information Innovators, Inc. Margaret Welsh Management

  14. Eczema (Atopic Dermatitis)Treatment

    Science.gov (United States)

    ... Lubricate or moisturize the skin two to three times a day using ointments such as petroleum jelly. Moisturizers should be ... Freeman Peter Hubbard Sara Jones Tony Lee Lara R. ... Kinyoun Lecture Series 2016 Kinyoun Lecture 2015 Kinyoun Lecture 2014 Kinyoun ...

  15. Depression among Congestive Heart Failure Patients: Results of a Survey from Central China

    Directory of Open Access Journals (Sweden)

    JPMS

    2011-10-01

    Full Text Available Tabish Hussain, Li Yu Shu, Xiang Cheng, Tumenjavkhlan Sosorburam, A.Seid Adji, Sara Tajammul, Aamra Sartaj (Union Hospital, Tongji Medical College, Huazhong University of Sciences and Technology, Wuhan, China (pages 38-42

  16. Assessing the viability of the Species at Risk Act in managing commercial exploitation and recovery of threatened and endangered marine fish in Canada

    OpenAIRE

    Druce, Courtney Danielle

    2012-01-01

    Commercially exploited threatened or endangered marine fish are consistently declined for listing under Canada’s Species at Risk Act (SARA), largely due to predicted socio-economic impacts associated with SARA’s prohibitions. However, commercial exploitation can be exempted from SARA’s general prohibitions. If exemptions were utilized, commercially exploited species could benefit from other aspects of SARA listing, and support continued economic opportunities for fishers. I conducted a litera...

  17. An Investigation into Rumen Fungal and Protozoal Diversity in Three Rumen Fractions, during High-Fiber or Grain-Induced Sub-Acute Ruminal Acidosis Conditions, with or without Active Dry Yeast Supplementation.

    Science.gov (United States)

    Ishaq, Suzanne L; AlZahal, Ousama; Walker, Nicola; McBride, Brian

    2017-01-01

    Sub-acute ruminal acidosis (SARA) is a gastrointestinal functional disorder in livestock characterized by low rumen pH, which reduces rumen function, microbial diversity, host performance, and host immune function. Dietary management is used to prevent SARA, often with yeast supplementation as a pH buffer. Almost nothing is known about the effect of SARA or yeast supplementation on ruminal protozoal and fungal diversity, despite their roles in fiber degradation. Dairy cows were switched from a high-fiber to high-grain diet abruptly to induce SARA, with and without active dry yeast (ADY, Saccharomyces cerevisiae ) supplementation, and sampled from the rumen fluid, solids, and epimural fractions to determine microbial diversity using the protozoal 18S rRNA and the fungal ITS1 genes via Illumina MiSeq sequencing. Diet-induced SARA dramatically increased the number and abundance of rare fungal taxa, even in fluid fractions where total reads were very low, and reduced protozoal diversity. SARA selected for more lactic-acid utilizing taxa, and fewer fiber-degrading taxa. ADY treatment increased fungal richness (OTUs) but not diversity (Inverse Simpson, Shannon), but increased protozoal richness and diversity in some fractions. ADY treatment itself significantly ( P PERMANOVA, P = 0.0001, P = 0.0452, P = 0.0068, Monte Carlo correction, respectively, and location was a significant factor ( P = 0.001, Monte Carlo correction) for protozoa. Diet-induced SARA shifts diversity of rumen fungi and protozoa and selects against fiber-degrading species. Supplementation with ADY mitigated this reduction in protozoa, presumptively by triggering microbial diversity shifts (as seen even in the high-fiber diet) that resulted in pH stabilization. ADY did not recover the initial community structure that was seen in pre-SARA conditions.

  18. Peranan Raja La Maddaremmeng Dalam Penyebaran Islam Di Bone

    Directory of Open Access Journals (Sweden)

    Nasruddin Nasruddin

    2014-06-01

    Full Text Available King Bone to Lamaddaremmeng XIII has a very large role and has the effect of early-early development of Islam in southern Sulawesi. He Maddaremeng is committed to enforce Sharia Law. His efforts were Eliminating slavery, Addition parewa Sara, to revamp the governance structure by adding positions previously unknown structure that positions parewa sara, eradication of idols, eliminating the arbitrary actions on others, Equal rights. Other efforts are trying to eliminate the differences in the degree of the community.

  19. Targets and special materials

    International Nuclear Information System (INIS)

    Blanc, R.; Bouriant, M.; Richaud, J.P.

    1997-01-01

    The target preparation group supplied a large number of samples to nuclear physicists for experiments using SARA and also other accelerators throughout the world. Particular preparation and projects include: 208 Pb, 116 Cd, 6 LiF, 123 Sb, In and Ta targets, strippers for SARA and GANIL, optical silicone disks for POLDER and GRAAL experiments, active participations for the AMS project and finally filament preparation for the GENEPI project. (authors)

  20. Ruminal acidosis: a review with detailed reference to the controlling agent Megasphaera elsdenii NCIMB 41125

    OpenAIRE

    Meissner, H.H.; Henning, P.H.; Horn, C.H.; Leeuw, K-J.; Hagg, F.M.; Fouché, G.

    2010-01-01

    Ruminal acidosis is discussed with reference to causes and economic and health implications. Distinction is made between the acute form which with proper adaptation to high energy diets is seldom encountered and the more problematic chronic or sub-acute form, commonly referred to as sub-acute ruminal acidosis (SARA). Apart from stepwise transition from roughage to concentrates, methods adopted to reduce SARA include grain treatment to reduce starch degradation, feed additives such as buffers ...

  1. Paducah Gaseous Diffusion Plant site environmental report for 1988

    International Nuclear Information System (INIS)

    Rogers, J.G.; Jett, T.G.

    1989-05-01

    Quantities of nonradiological chemical emissions are not included in this report this year. An addendum that will include the information will be published after the Superfund Amendments Reauthorization Act (SARA) Title III report is issued on July 1, 1989. When the addendum is published, probably in late July, a summary of the SARA Title III 313 report will be included. The SARA report provides the community with the opportunity to lean about estimated quantities of certain toxic chemicals used at a facility that are routinely or accidentally released into the environment. The addendum that will be published after the SARA report will summarize the SARA report and is expected to include some additional ''large quantity'' chemicals used or stored at the facilities that are not required to be reported by SARA Title III but are known to be emitted from the facilities. The addendum will not be all inclusive but will provide emissions information on the major chemical emissions to the air, water, or land from processes at the facilities

  2. In vitro residual anti-bacterial activity of difloxacin, sarafloxacin and their photoproducts after photolysis in water

    International Nuclear Information System (INIS)

    Kusari, Souvik; Prabhakaran, Deivasigamani; Lamshoeft, Marc; Spiteller, Michael

    2009-01-01

    Fluoroquinolones like difloxacin (DIF) and sarafloxacin (SARA) are adsorbed in soil and enter the aquatic environment wherein they are subjected to photolytic degradation. To evaluate the fate of DIF and SARA, their photolysis was performed in water under stimulated natural sunlight conditions. DIF primarily degrades to SARA. On prolonged photodegradation, seven photoproducts were elucidated by HR-LC-MS/MS, three of which were entirely novel. The residual anti-bacterial activities of DIF, SARA and their photoproducts were studied against a group of pathogenic strains. DIF and SARA revealed potency against both Gram-positive and -negative bacteria. The photoproducts also exhibited varying degrees of efficacies against the tested bacteria. Even without isolating the individual photoproducts, their impact on the aquatic environment could be assessed. Therefore, the present results call for prudence in estimating the fate of these compounds in water and in avoiding emergence of resistance in bacteria caused by the photoproducts of DIF and SARA. - Assessment of the residual anti-bacterial efficacies of difloxacin, sarafloxacin and their photoproducts in water, and estimating their impact on the aquatic environment in inducing resistance to microorganisms.

  3. Memoirs 2004

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    Titles of the memoirs are: Wheal Hearle, St Just: History and Archaeology; Dabbling in Eskdale Iron Mining; The Meal Mill at Ballygrant; The Grades Coal and Steel Works, Oldbury, Staffordshire; Does Familiarity Breed Contempt? - Age and Accident Frequency in Cornish Non-Ferrous Metal Mining, 1881-1901; Explosives in the Mines of the Alston Block during the 18th and 19th centuries; The Inghams and the Thornhill Collieries Near Dewsbury; A Dispute Over Mining Royalities in the Bolton Area, 1836-1842. 40 figs., 18 photos.

  4. Radiological audit of remedial action activities at the processing site, transfer site, and Cheney disposal site Grand Junction, Colorado: Audit date, August 9--11, 1993

    International Nuclear Information System (INIS)

    1993-08-01

    The Uranium Mill Tailing Remedial Action (UMTRA) Project's Technical Assistance Contractor (TAC) performed a radiological audit of the Remedial Action Contractor (RAC), MK-Ferguson and CWM Federal Environmental Services, Inc., at the processing site, transfer site, and Cheney disposal site in Grand Junction, Colorado. Jim Hylko and Bill James of the TAC conducted this audit August 9 through 11, 1993. Bob Cornish and Frank Bosiljevec represented the US Department of Energy (DOE). This report presents one programmatic finding, eleven site-specific observations, one good practice, and four programmatic observations

  5. Amazing & extraordinary facts the steam age

    CERN Document Server

    Holland, Julian

    2012-01-01

    Respected transport author Julian Holland delves into the intriguing world of steam in his latest book, which is full of absorbing facts and figures on subjects ranging from Cornish beam engines, steam railway locomotives, road vehicles and ships through to traction engines, steam rollers and electricity generating stations and the people who designed and built them. Helped along the way by the inventive minds of James Watt, Richard Trevithick and George Stephenson, steam became the powerhouse that drove the Industrial Revolution in Britain in the late 18th and 19th centuries.

  6. Generation and interaction of solitons in Bose-Einstein condensates

    International Nuclear Information System (INIS)

    Burger, S.; Sengstock, K.; Carr, L.D.; Oehberg, P.; Sanpera, A.

    2002-01-01

    Generation, interaction, and detection of dark solitons in Bose-Einstein condensates are studied. In particular, we focus on the dynamics resulting from phase imprinting and density engineering. We show that solitons slow down significantly when the trap is opened and that soliton phase shifts after binary interactions cannot be observed with present experiments. Finally, motivated by the recent experimental results of Cornish et al. [Phys. Rev Lett. 85, 1795 (2000)], we analyze the stability of dark solitons under changes of the scattering length and thereby demonstrate a new way to detect them. Our theoretical and numerical results compare well with the existing experimental ones and provide guidance for future experiments

  7. Foundations of predictive analytics

    CERN Document Server

    Wu, James

    2012-01-01

    Drawing on the authors' two decades of experience in applied modeling and data mining, Foundations of Predictive Analytics presents the fundamental background required for analyzing data and building models for many practical applications, such as consumer behavior modeling, risk and marketing analytics, and other areas. It also discusses a variety of practical topics that are frequently missing from similar texts. The book begins with the statistical and linear algebra/matrix foundation of modeling methods, from distributions to cumulant and copula functions to Cornish--Fisher expansion and o

  8. Fracture hydrology relevant to radionuclide transport. Field work in a granite formation in Cornwall

    International Nuclear Information System (INIS)

    Bourke, P.J.; Hodgkinson, D.P.; Durrance, E.M.; Heath, M.J.

    1985-01-01

    Separation, orientation, apertures and intersections of water-bearing fractures are the variables which control water flow and affect radionuclide transport through fractured rocks. The need is discussed for information on the distribution of these variables in statistical treatments of flow and transport, because of the inadequacy of permeability and porosity data in continuum treatments. Satisfactory methods of measuring distributions of separation, orientation and apetures have been developed and data for Cornish granite are presented. An estimate of the average distance between fracture intersections is made

  9. A multi-packer technique for investigating resistance to flow through fractured rock and illustrative results

    International Nuclear Information System (INIS)

    Bourke, P.J.; Rae, J.

    1981-01-01

    A multi-packer technique was used to locate twelve discrete fractures in the lower half of a 200 m deep drill hole in Cornish granite. The resistances to water flows into these fractures both singly and together were measured. Geological explanations of the results obtained were sought by examination of core from the hole. Analysis of the results and the further data needed and now being sought to determine resistance to flow over long distances through the pattern of interconnected fractures are discussed. This information is required for the assessment of the safety of burial of radioactive wastes

  10. Fragile X--a challenge to models of the mind and to best clinical practice.

    Science.gov (United States)

    Hay, David A

    2008-06-01

    Cornish et al. (2008, this issue) provide an excellent review of Fragile X a common but very complex cause of intellectual disability. They report on a cohort of such males of normal intelligence quotient (IQ) and socioeconomic status (SES), but who have deficits in selective attention and growing impairment in response inhibition. This paper has theoretical views for our models of the mind and clinical implications for families where Fragile X may never have been considered as a possible cause of some of the problems in male and female family members and possibly as well for other disorders such as attention deficit hyperactivity disorder (ADHD) and autism.

  11. RNA structure alignment by a unit-vector approach.

    Science.gov (United States)

    Capriotti, Emidio; Marti-Renom, Marc A

    2008-08-15

    The recent discovery of tiny RNA molecules such as microRNAs and small interfering RNA are transforming the view of RNA as a simple information transfer molecule. Similar to proteins, the native three-dimensional structure of RNA determines its biological activity. Therefore, classifying the current structural space is paramount for functionally annotating RNA molecules. The increasing numbers of RNA structures deposited in the PDB requires more accurate, automatic and benchmarked methods for RNA structure comparison. In this article, we introduce a new algorithm for RNA structure alignment based on a unit-vector approach. The algorithm has been implemented in the SARA program, which results in RNA structure pairwise alignments and their statistical significance. The SARA program has been implemented to be of general applicability even when no secondary structure can be calculated from the RNA structures. A benchmark against the ARTS program using a set of 1275 non-redundant pairwise structure alignments results in inverted approximately 6% extra alignments with at least 50% structurally superposed nucleotides and base pairs. A first attempt to perform RNA automatic functional annotation based on structure alignments indicates that SARA can correctly assign the deepest SCOR classification to >60% of the query structures. The SARA program is freely available through a World Wide Web server http://sgu.bioinfo.cipf.es/services/SARA/. Supplementary data are available at Bioinformatics online.

  12. Usaha La Sangkuru Patau Dalam Mengembangkan Agama Islam Di Kerajaan Wajo

    Directory of Open Access Journals (Sweden)

    Nasruddin Nasruddin

    2014-12-01

    Full Text Available La Sangkuru Patau is one of the Arung Matoa Wajo has substantial powers. His remarks could be a law and society Wajo stick to what he says. So when La Sangkuru Patau said that he had converted to Islam, the community participated Wajo also embraced Islam. Arung Matoa Wajo La Sangkuru with doing business in developing Islam in Wajo that bring Datu Sulaiman to provide Islamic religious instruction in public Wajo, then set up a sara officers' special charge of handling issues such royal Friday prayers, warnings Islamic holidays , then hold the officer cadre sara 'that will be placed outside the capital of the kingdom (Tosora, sara officers' given the facilities, such as free of taxes, as well as the parallel position to the position of indigenous stakeholders.

  13. Substorm associated radar auroral surges: a statistical study and possible generation model

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available Substorm-associated radar auroral surges (SARAS are a short lived (15–90 minutes and spatially localised (~5° of latitude perturbation of the plasma convection pattern observed within the auroral E-region. The understanding of such phenomena has important ramifications for the investigation of the larger scale plasma convection and ultimately the coupling of the solar wind, magnetosphere and ionosphere system. A statistical investigation is undertaken of SARAS, observed by the Sweden And Britain Radar Experiment (SABRE, in order to provide a more extensive examination of the local time occurrence and propagation characteristics of the events. The statistical analysis has determined a local time occurrence of observations between 1420 MLT and 2200 MLT with a maximum occurrence centred around 1700 MLT. The propagation velocity of the SARAS feature through the SABRE field of view was found to be predominately L-shell aligned with a velocity centred around 1750 m s–1 and within the range 500 m s–1 and 3500 m s–1. This comprehensive examination of the SARAS provides the opportunity to discuss, qualitatively, a possible generation mechanism for SARAS based on a proposed model for the production of a similar phenomenon referred to as sub-auroral ion drifts (SAIDs. The results of the comparison suggests that SARAS may result from a similar geophysical mechanism to that which produces SAID events, but probably occurs at a different time in the evolution of the event.

    Key words. Substorms · Auroral surges · Plasma con-vection · Sub-auroral ion drifts

  14. Perlindungan Hukum Kelompok Teisme dalam Sistem Negara Hukum Pancasila

    Directory of Open Access Journals (Sweden)

    Tomy Michael

    2017-05-01

    Full Text Available Di era global saat ini, suatu bangsa dituntut mampu bersaing dengan negara lain. Agar tidak terlepas dari unsur khas Indonesia maka penguatan Pancasila sebagai ideologi adalah keharusan. Pancasila yang melingkupi keragaman suku, agama, ras dan antar golongan (SARA kurang tercermin dalam UU Nomor 23 Tahun 2006. Permasalahan yang timbul yaitu hilangnya unsur khas Indonesia yaitu kepercayaan atau agama tradisional karena adanya diskriminasi dengan pengosongan kolom agama dalam Kartu Kelurga (KK dan Kartu Tanda Penduduk (KTP (Pasal 61 dan Pasal 64 UU No. 23-2006. Penelitian ini bertujuan untuk menganalisis korelasi hukum UU No. 23 tahun 2016 dengan keberadaan Pancasila dan SARA di Indonesia. Metode penelitian yang digunakan adalah penelitian hukum normatif. Hasil penelitian ini menunjukkan bahwa UU No. 23 Tahun 2006 tidak selaras dengan semangat Pancasila yang mengakui keragaman SARA dan bertentang dengan asas keadilan dalam UU No. 12Tahun 2011. In the global era, a nation supposedly able to compete with other countries. In order not to be separated from the typical elements of Indonesia, the strengthening of Pancasila as an ideology is a must. Pancasila surrounding ethnic, religious, racial and sectarian (SARA less diversity reflected in Law No. 23 of 2006. The problems that arise, namely the loss of the typical elements of Indonesia namely traditional religious beliefs or because of their discrimination by emptying the religion column in Family Card (KK and Identity Card (KTP (Article 61 and Article 64 of Law No. 23-2006. This study aims to analyze the correlation on Law No. 23of 2016 with the existence of Pancasila and SARA in Indonesia. The method used is a normative legal research. The result of this study reveals that the Law No. 23 of 2006 not in line with the spirit of Pancasila that recognizes the diversity of SARA and incompatible with the principles of justice on Law No. 12 of 2011.

  15. Biomimetic photo-actuation: sensing, control and actuation in sun-tracking plants

    International Nuclear Information System (INIS)

    Dicker, M P M; Bond, I P; Weaver, P M; Rossiter, J M

    2014-01-01

    Although the actuation mechanisms that drive plant movement have been investigated from a biomimetic perspective, few studies have looked at the wider sensing and control systems that regulate this motion. This paper examines photo-actuation—actuation induced by, and controlled with light—through a review of the sun-tracking functions of the Cornish Mallow. The sun-tracking movement of the Cornish Mallow leaf results from an extraordinarily complex—yet extremely elegant—process of signal perception, generation, filtering and control. Inspired by this process, a concept for a simplified biomimetic analogue of this leaf is proposed: a multifunctional structure employing chemical sensing, signal transmission, and control of composite hydrogel actuators. We present this multifunctional structure, and show that the success of the concept will require improved selection of materials and structural design. This device has application in the solar-tracking of photovoltaic panels for increased energy yield. More broadly it is envisaged that the concept of chemical sensing and control can be expanded beyond photo-actuation to many other stimuli, resulting in new classes of robust solid-state devices. (paper)

  16. The concentration principle applied to spaceborne solar arrays. AGORA mission: Studies synthesis

    Science.gov (United States)

    Laget, R.

    1986-01-01

    Studies that led to selection of the distributed 25 kW SARA LOUVRE concept for the solar cell generator to be flown on the AGORA asteroid mission, and the major characteristics of such a spaceborne solar array are summarized. In the SARA LOUVRE concept, a parabolic cross section reflector concentrates incident light over the rear face of the identical, preceding reflector dish. The whole set of reflectors is pivotally commanded, thus compensating the effects of depointing. Geometric concentration factor is 10. End of life power level at 2.5 AU is 4.5 kW.

  17. An Investigation into Rumen Fungal and Protozoal Diversity in Three Rumen Fractions, during High-Fiber or Grain-Induced Sub-Acute Ruminal Acidosis Conditions, with or without Active Dry Yeast Supplementation

    Directory of Open Access Journals (Sweden)

    Suzanne L. Ishaq

    2017-10-01

    Full Text Available Sub-acute ruminal acidosis (SARA is a gastrointestinal functional disorder in livestock characterized by low rumen pH, which reduces rumen function, microbial diversity, host performance, and host immune function. Dietary management is used to prevent SARA, often with yeast supplementation as a pH buffer. Almost nothing is known about the effect of SARA or yeast supplementation on ruminal protozoal and fungal diversity, despite their roles in fiber degradation. Dairy cows were switched from a high-fiber to high-grain diet abruptly to induce SARA, with and without active dry yeast (ADY, Saccharomyces cerevisiae supplementation, and sampled from the rumen fluid, solids, and epimural fractions to determine microbial diversity using the protozoal 18S rRNA and the fungal ITS1 genes via Illumina MiSeq sequencing. Diet-induced SARA dramatically increased the number and abundance of rare fungal taxa, even in fluid fractions where total reads were very low, and reduced protozoal diversity. SARA selected for more lactic-acid utilizing taxa, and fewer fiber-degrading taxa. ADY treatment increased fungal richness (OTUs but not diversity (Inverse Simpson, Shannon, but increased protozoal richness and diversity in some fractions. ADY treatment itself significantly (P < 0.05 affected the abundance of numerous fungal genera as seen in the high-fiber diet: Lewia, Neocallimastix, and Phoma were increased, while Alternaria, Candida Orpinomyces, and Piromyces spp. were decreased. Likewise, for protozoa, ADY itself increased Isotricha intestinalis but decreased Entodinium furca spp. Multivariate analyses showed diet type was most significant in driving diversity, followed by yeast treatment, for AMOVA, ANOSIM, and weighted UniFrac. Diet, ADY, and location were all significant factors for fungi (PERMANOVA, P = 0.0001, P = 0.0452, P = 0.0068, Monte Carlo correction, respectively, and location was a significant factor (P = 0.001, Monte Carlo correction for protozoa

  18. Management of Sub-acute Ruminal Acidosis in Dairy Cattle for Improved Production: A Review

    OpenAIRE

    Kafil Hussain; Amjad Ul Islam; Surinder Kumar Gupta

    2011-01-01

    Sub-acute ruminal acidosis (SARA) is a well-recognized digestive disorder that is an increasing health problem in most dairy herds. Feeding diets high in grain and other highly fermentable carbohydrates to dairy cows increases milk production, but also increases the risk of SARA. Sub-acute ruminal acidosis is defined as periods of moderately depressed ruminal pH, from about 5.5 to 5.0. Sub-acute ruminal acidosis may be associated with laminitis and other health problems resulting in decreased...

  19. Implementation of Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) Health Authority by the Agency for Toxic Substances and Disease Registry

    International Nuclear Information System (INIS)

    Siegel, M.R.

    1990-01-01

    The Superfund Amendments and Reauthorization Act (SARA) of 1986 greatly expanded the health authority of the Comprehensive Environmental Response, Compensation, and Liability Act. One of the federal agencies most affected by SARA is the Agency for Toxic Substances and Disease Registry (ATSDR) of the U.S. Public Health Service. Among other responsibilities, ATSDR was mandated to conduct health assessments within strict time frames for each site on or proposed for the U.S. Environmental Protection Agency's National Priorities List. The author will review ATSDR's efforts to address this new statutory mandate, especially for federal facilities, and will focus on different conceptual frameworks for implementing the health assessment program

  20. Assessment Matters: Moving beyond Surveys

    Science.gov (United States)

    Wise, Vicki L.; Barham, Mary Ann

    2012-01-01

    The August 16, 2011, "Chronicle of Higher Education" article "Want Data? Ask Students. Again and Again" by Sara Lipka posits that in higher education there is a culture of oversurveying students and too often relying on surveys as the main, or only, way of assessing the impact of programs and services on student satisfaction and learning. Because…

  1. Some geological processes in the Macro-tidal regime of Gulf of Kachchh, Northwest coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Vora, K.H.; Chauhan, O.S.; Rao, B.R

    of about 150-350 m in the Kandla Creek The Sara, Sanu and Phang creeks exhibit uneven to rugged topography with about 4 to 12 m deep V-shaped channels The seismic profiles across these creeks show 10-15 m thick clays The channels are cutting across...

  2. 78 FR 47408 - Notice of Intent to Prepare an Environmental Impact Statement for Oil and Gas Leasing and...

    Science.gov (United States)

    2013-08-05

    ..., Sacramento, CA 95825 Documents pertinent to this proposal may be examined at the BLM California State Office, 2800 Cottage Way, Sacramento, CA 95825. FOR FURTHER INFORMATION CONTACT: Sara Acridge, Natural Resources Specialist, telephone 916-978-4557; address 2800 Cottage Way, Rm. W- 1623, Sacramento, CA 95825...

  3. The Workplace Literacy System Project (WLS). Final Performance Report.

    Science.gov (United States)

    Poulton, Bruce R.

    The Workplace Literacy System Project (WLS) prepared interactive CD-ROM discs containing about 50 hours of instruction and drill in basic skills presented within the context of the textile/apparel manufacturing industry. The project was conducted at a Sara Lee knit products plant in North Carolina. During the project, literacy task analyses were…

  4. 75 FR 59983 - National Priorities List, Final Rule-Newtown Creek

    Science.gov (United States)

    2010-09-29

    ...? H. May EPA delete portions of sites from the NPL as they are cleaned up? I. What is the Construction...), added by SARA. The revised HRS evaluates four pathways: Ground water, surface water, soil exposure, and... the site are typically not known at the time of listing. Although a CERCLA ``facility'' is broadly...

  5. 78 FR 31417 - National Priorities List, Final Rule No. 56

    Science.gov (United States)

    2013-05-24

    ... would be time-consuming or costly. In other cases, data for scoring some pathways are available, but... NPL as they are cleaned up? I. What is the Construction Completion List (CCL)? J. What is the sitewide... partly in response to CERCLA section 105(c), added by SARA. The revised HRS evaluates four pathways...

  6. 75 FR 9790 - National Priorities List, Final Rule-Gowanus Canal

    Science.gov (United States)

    2010-03-04

    ... of Sites From the NPL as They Are Cleaned Up? I. What Is the Construction Completion List (CCL)? J...), added by SARA. The revised HRS evaluates four pathways: ground water, surface water, soil exposure, and... the site are typically not known at the time of listing. Although a CERCLA ``facility'' is broadly...

  7. 78 FR 75534 - National Priorities List, Proposed Rule No. 59

    Science.gov (United States)

    2013-12-12

    ... portions of sites from the NPL as they are cleaned up? I. What is the Construction Completion List (CCL)? J... to CERCLA section 105(c), added by SARA. The revised HRS evaluates four pathways: ground water... precise nature and extent of the site are typically not known at the time of listing. Although a CERCLA...

  8. 76 FR 67209 - United States v. Grupo Bimbo S.A.B. de C.V., et al.; Proposed Final Judgment and Competitive...

    Science.gov (United States)

    2011-10-31

    ... substitute other bakery or food products for sliced bread for these and other uses. Therefore, a hypothetical... BBU and Sara Lee branded sliced-bread products as their first and second choices in sliced-bread... would be profitable after the acquisition. The same profit motive would apply to an increase in the...

  9. 1984-85 ISN progress report

    International Nuclear Information System (INIS)

    1985-01-01

    This progress report ISN 1984-1985 deals with the following subjects: nuclear physics theory, peripheral and intermediate energy physics, characteristics of reaction mechanisms in heavy ion collisions, nuclear structure, fundamental interactions, experimental methods and new instrumentation, some interdisciplinary research activities and technical activities, the SARA cyclotron and finally, technology transfer and valorisation [fr

  10. Modèles de gestion des ressources forestières du massif ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Expérimentation Participative et Adaptative de Modèles de Gestion des Ressources Forestières dans la Chaine Montagneuse de l'Atlas (Algérie, Maroc, Tunisie) : rapport final (17 mars 2009 au 18 septembre 2012). Download PDF. Reports. Unité de transformation de cire d'abeille (Commune de M'Sara). Download PDF ...

  11. ClassBeacons: designing distributed visualization of teachers’ physical proximity in the classroom.

    NARCIS (Netherlands)

    An, P.; Bakker, S.; Ordanovski, S.; Taconis, R.; Eggen, J.H.

    2018-01-01

    Pengcheng An, Saskia Bakker, Sara Ordanovski, Ruurd Taconis, Berry Eggen. 2018 (accepted at Oct 2017). ClassBeacons: designing distributed visualization of teachers’ physical proximity in the classroom. In Proceedings of Tangible and Embodied Interaction, TEI 2018, Mar 18-21, 2018,

  12. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Low energy neutral atom imaging on the Moon with the SARA instrument ... that will be flown on the first Indian lunar mission Chandrayaan-1. ... Currently at NASA Goddard Space Flight Center, Mail Code 612.2, Greenbelt, MD 20771, USA.

  13. Early Support of Intracranial Perfusion

    Science.gov (United States)

    2009-10-01

    outcomes after traumatic brain injury: A multicenter analysis. Archives of Physical Medicine and Rehabilitation, 84(10), 1441- 1448. Cremer , O. L...Kolesnik Research Assistant 67.5 Sean Jordan Research Assistant 44.5 Sara Wade Research Assistant 90 David Prakash Research Assistant 63.6 Scott Berry

  14. To belong to the living

    DEFF Research Database (Denmark)

    Petersen, Michael Nebeling

    2013-01-01

    Med udgangspunkt i Lee Edelmans polemiske argumentation imod reproduktiv futurisme og Sara Ahmeds fokus på queer attachments analyserer og diskuterer artiklen queer slægtskab, som det fremstilles i den amerikanske spillefilm The Kids Are All Right. Der argumenteres for, at børnenes heteronormative...

  15. "Walking with a Ghost": Arts-Based Research, Music Videos, and the Re-Performing Body

    Science.gov (United States)

    Taylor, Pamela G.; Wilder, Shannon O.; Helms, Kathryn R.

    2007-01-01

    In folk-rock duo Tegan and Sara's 2004 music video "Walking with a Ghost," two women face one another, mirrored images in black and white. One is dressed in black--grunge shirt, pants and boots, while the other stands barefoot in a simple white dress. The black-clad figure removes three red paper hearts from her twin's chest, leaving crimson…

  16. Renewing Head Start's Promise: Invest in What Works for Disadvantaged Preschoolers

    Science.gov (United States)

    Mead, Sara

    2014-01-01

    Since Head Start's last reauthorization in 2007, the Department of Health and Human Services, which oversees Head Start, has implemented significant reforms that are improving the program. In "Renewing Head Start's Promise: Invest in What Works for Disadvantaged Preschoolers," Sara Mead offers several recommendations to enable…

  17. Sensorimotor Assessment and Rehabilitative Apparatus

    Science.gov (United States)

    2016-10-01

    become effective addressing health disparities. Title: Ethnic differences in endogenous pain regulation: PET imaging of opioid receptors Grant Number...campaigns, causing physical , sensory, cognitive, and behavioral/emotional changes. Therefore, a significant population of our wounded veterans suffer...collection. Training included medical screening for vestibular pathology, balance and gait assessments, and SARA testing. ii. Train Physical

  18. Associations between cardiovascular risk factors, hyper- and hypocoagulability

    NARCIS (Netherlands)

    Rafi, S.

    2011-01-01

    Sara Rafi beschrijft verbanden tussen risicofactoren voor hart- en vaatziekten (HVZ) en bloedstolling. Uit calciumneerslag op de aortaboog blijkt dat patiënten met veneuze trombose een verhoogde kans hebben op HVZ. Ook schildklieraandoeningen en het gebruik van ontstekingsremmers en

  19. Oil and gas property transfers: Analyzing the environmental risk through the environmental site assessment process

    International Nuclear Information System (INIS)

    Bratberg, D.; Hocker, S.

    1994-01-01

    The Superfund Act made anyone buying contaminated real estate liable for cleanup costs whether they know about the contamination or contributed to the contamination. In 1986, SARA amended the Superfund Act to include a provision known as the ''Innocent Landowner Defense.'' This provision created a defense for purchasers of contaminated property who did not contribute to the contamination and had no reason to believe that the property was contaminated at the time of the real estate transfer. SARA allows the purchasers and lenders to perform an environmental assessment using ''due diligence'' to identify contamination problems existing at a site. Since the passing of SARA, the environmental site assessment (ESA) process has become commonplace during the transfer of commercial real estate. Since the introduction of SARA, many professional associations, governmental agencies, and proposed federal legislation have struggled to produce a standard for conducting Phase 1 ESAs. Only recently has a standard been produced. Until recently, the domestic oil and gas industry has been relatively unconcerned about the Superfund liability issues. This approach was created by Congress's decision in 1980 to temporarily exempt the majority of oil and gas exploration and production wastes from federal hazardous waste rulings. However, new stringent rules governing oil and gas waste management practices are being considered by federal and state regulatory agencies. Based upon this knowledge and the awakening of public awareness, the use of ESAs for oil and gas transactions is increasing

  20. Near East/South Asia Report, No. 2778.

    Science.gov (United States)

    1983-07-08

    alternative had not been satis- factory. In that speech he also warned Europe about the U.S.A. Europe is the U.S.A’s sacrificial lamb , he claimed, and...to wait and let the Aguda members " stew in their own juices" until they would agree to the lowest price possible for voting in Sara Doron. The Price

  1. Workplace Stress Relief (A Cup of Health with CDC)

    Centers for Disease Control (CDC) Podcasts

    2014-07-31

    The stress of everyday life can lead to all kinds of health problems. It’s particularly a problem at work. In this podcast, Dr. Sara Luckhaupt discusses the health impact of work-related stress.  Created: 7/31/2014 by MMWR.   Date Released: 7/31/2014.

  2. 2015 Liquid Crystals Gordon Research Conference and Gordon Research Seminar

    Science.gov (United States)

    2015-10-20

    Faculdade de Ciências e Tecnologia , Universidade Nova de Lisboa, Portugal) "Joule-Heating Effect: A New Route to PDLCs Memory Removal" 9:55 am - 10...Madison Poster Presenter Registered Carvalho, Sara F UNINOVA, Faculdade de Ciências e Tecnologia , Universidade Nova de Lisboa Speaker Registered Cha

  3. Selecting, Evaluating and Creating Policies for Computer-Based Resources in the Behavioral Sciences and Education.

    Science.gov (United States)

    Richardson, Linda B., Comp.; And Others

    This collection includes four handouts: (1) "Selection Critria Considerations for Computer-Based Resources" (Linda B. Richardson); (2) "Software Collection Policies in Academic Libraries" (a 24-item bibliography, Jane W. Johnson); (3) "Circulation and Security of Software" (a 19-item bibliography, Sara Elizabeth Williams); and (4) "Bibliography of…

  4. Demonstration and Commercialization of the Sediment Ecosystem Assessment Protocol (SEAP)

    Science.gov (United States)

    2017-07-09

    31  6.1.1  Performance Objective #1: Water Quality Maintenance...green represents where a thin- layer sand cap was installed in April 2014. .................................................................12  Figure...device(s) PSNS Puget Sound Naval Shipyard QA/QC Quality Assurance/ Quality Control SARA Superfund Amendments and Reauthorization Act SCCWRP

  5. Ecology and Conservation of Acacia senegal in the Rangelands ...

    African Journals Online (AJOL)

    Ecology and Conservation of Acacia senegal in the Rangelands ofLuwero and Nakasongola Districts. Jacob Godfrey Agea, Joseph Obua, Sara Namirembe, Mukadasi Buyinza, Daniel Waiswa. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL ...

  6. Agroforestry potential of Acacia senegal in the rangelands of luwero ...

    African Journals Online (AJOL)

    Agroforestry potential of Acacia senegal in the rangelands of luwero and Nakasongola districts. Jacob Godfrey Agea, Joseph Obua, Sara Namirembe, Mukadasi Buyinza, Daniel Waiswa. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  7. The Relationships among Writing Skills, Writing Anxiety and Metacognitive Awareness

    Science.gov (United States)

    Balta, Elif Emine

    2018-01-01

    The purpose of this study was to investigate the relationships among students' argumentative text writing skills, writing anxiety, and metacognitive awareness. The participants were composed of 375 8th graders in six middle schools in Sivas. Metacognitive Awareness Inventory (B Form) which was adapted in to Turkish by Karakelle & Saraç (2007)…

  8. Measuring the socio-economic impacts of agroforestry projects in the Philippines

    Science.gov (United States)

    Evan Mercer; Belita Vega; Hermie Francisco; Robin Maille

    1994-01-01

    Conventional wisdom suggests that agroforestry projects can provide both ecological and economic benefits. Most agroforestry project evaluations, however, have failed to adequately assess the soci0-economic impacts. For example, a review of 108 agroforestry project impact evaluations by Sara Scherr of IFPRJ reported that only 8% assessed economic costs or benefits, 5%...

  9. Disease: H01705 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H01705 Bilateral sudden sensorineural hearing loss Bilateral sudden sensorineural ...hearing loss (SNHL) represents a rare disease entity, constituting less than 5 % of all sudden SNHL cases. U...nlike unilateral disease, bilateral sudden SNHL appears to be mostly related to serious systemic pathology, ...543 603629 601072 600965 PMID:24331736 ... AUTHORS ... Sara SA, Teh BM, Friedland P ... TITLE ... Bilateral sud

  10. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    Enhanced antibacterial performance of Fe 3 O 4 –Ag and MnFe 2 O 4 –Ag ... Department of Chemistry, Fatih University, 34500 Buyukcekmece-Istanbul, Turkey ... Chemicals and Chemical Industry Trade Company, Saraçlar Industrial Zone, No.

  11. Numerical analysis of a one-dimensional multicomponent model of the in-situ combustion process

    DEFF Research Database (Denmark)

    Nesterov, Igor; Shapiro, Alexander; Stenby, Erling Halfdan

    2013-01-01

    , the model is based on SARA representation of a petroleum mixture (saturates–aromatics–resins–asphaltenes), which may react differently with oxygen and produce other components (for example, light oils and coke). In total, the model contains 14 components, which may undergo 15 chemical reactions. The set...

  12. African Journal of Biotechnology - Vol 15, No 33 (2016)

    African Journals Online (AJOL)

    Micropropagation of caçari under different nutritive culture media, antioxidants, and levels of agar and pH · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Maria Da Conceicao Da Rocha Araujo, Edvan Alves Chagas, Maria Isabel Ribeiro Garcia, Sara Thiele Sobral ...

  13. Browse Title Index

    African Journals Online (AJOL)

    ... hemorrhage mimicking a pneumopathy: a rare complication of dual antiplatelet therapy for ST elevation myocardial infarction, Abstract PDF. Sara Oualim, Charafeddine Ait Elharda, Dounia Benzeroual, Mustapha El Hattaoui. Vol 12, No 1 (2012), Pulmonary epidermoid carcinoma in a patient with acromegaly: a rare entity ...

  14. Our Immune System

    Science.gov (United States)

    Our Immune System A story for children with primary immunodeficiency diseases Written by Sara LeBien IMMUNE DEFICIENCY FOUNDATION A note ... who are immune deficient to better understand their immune system. What is a “ B-cell, ” a “ T-cell, ” ...

  15. Leveraging Existing Laboratory Capacity towards Universal Health ...

    African Journals Online (AJOL)

    Adequately equipped clinical laboratories should provide early warning signals of health risks. The Assessment categorized the laboratories at three levels relating to the type of facility, these being hospital, health center and health post. This study used results from the SARA to determine the ability to make timely diagnosis ...

  16. Banana nectar as a medium for testing pollen viability and ...

    African Journals Online (AJOL)

    Administrator

    2007-05-16

    May 16, 2007 ... The accession TMB2x 8075 - 7 showed no significant pollen germination in nectar and sucrose. Eleven genotypes (55%) showed significant increase in pollen ..... SAS (1999) SAS Institute Inc. Cary, USA. Sara CC, José OF, ...

  17. Human Aspects of Library Automation: Helping Staff and Patrons Cope. Papers presented at the Annual Clinic on Library Applications of Data Processing (22nd, Urbana, Illinois, April 14-16, 1985).

    Science.gov (United States)

    Shaw, Debora, Ed.

    This collection explores the human aspect of the automation and reautomation of library functions as both library staff and library users are expected to adapt to and use computers. A brief introduction by Debora Shaw sets the stage for the following papers: (1) "Terminal Paralysis, or Showdown at the Interface" (Sara Fine); (2)…

  18. Avgang 2017: Sommerkonsert i Aulaen

    OpenAIRE

    2017-01-01

    Avgangsstudenter fra MA2 opera og studenter fra MA1 holder konsert med sang fra operaer, lieder og fra operetter. MA2 sangere: Hanne Korsbrekke Askeland, Dagfinn Andersen, Sara Aasen. MA1 sangere: Eilert Egil Taugbøl Hasseldal, Marcela Randem, Nora Oleanne Sårheim, Tina Therese Tuven

  19. 77 FR 62562 - Self-Regulatory Organizations; ICE Clear Credit LLC; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2012-10-15

    ... two single names (The Hillshire Brands Company and DE US, Inc.). II. Self-Regulatory Organization's... the Sara Lee Corporation's successor companies, The Hillshire Brands Company and DE US, Inc. This... things, that the rules of a clearing agency be designed to promote the prompt and accurate clearance and...

  20. Corporate social responsibility in the coffee sector: The dynamics of MNC responses and code development

    NARCIS (Netherlands)

    Kolk, A.

    2005-01-01

    Since the collapse of the international coffee agreement in 1989, attention has increasingly focused on the role of multinational corporations in this sector. As the main actors in the international coffee chain, companies such as Sara Lee/Douwe Egberts, Nestlé and Kraft have been pressurised to

  1. Student Pressure Subject of Debate

    Science.gov (United States)

    Gewertz, Catherine

    2006-01-01

    This article discusses student pressure as a subject of debate. The latest debate about schoolwork is being fueled by three recent books: "The Homework Myth" by Alfie Kohn, "The Case Against Homework" by Sara Bennett and Nancy Kalish, and "The Overachievers", by Alexandra Robbins, which depicts overextended high…

  2. Kanuti gildi saalis toimub kuni 24. XI festival "Continental Breakfast Tallinn"

    Index Scriptorium Estoniae

    2005-01-01

    Korraldajad: Anders Härm, Priit Raud. 4. XI Tellervo Kalleineni (Soome) performance "Lase mind/Let me". 5. XI Saralundeni (Sara Lunden, Rootsi) muusikaline performance "Sweet Beat Tour". 8. ja 9. XI esineb babaLAN (Vlado Gotvan Repnik, Sloveenia) multimeedia-performance'iga

  3. State Authorization Reciprocity Agreement: Participation and Access to Higher Education

    Science.gov (United States)

    Onwuameze, Nkechi

    2017-01-01

    The State Authorization Reciprocity Agreement initiative was launched in 2014 to provide a uniform standard for the regulation of distance education across states in the United States. The system established by the National Council for State Authorization Reciprocity Agreement (NC-SARA) allows willing post-secondary institutions to participate…

  4. Mapping the transcription start points of the Staphylococcus aureus eap, emp, and vwb promoters reveals a conserved octanucleotide sequence that is essential for expression of these genes.

    Science.gov (United States)

    Harraghy, Niamh; Homerova, Dagmar; Herrmann, Mathias; Kormanec, Jan

    2008-01-01

    Mapping the transcription start points of the eap, emp, and vwb promoters revealed a conserved octanucleotide sequence (COS). Deleting this sequence abolished the expression of eap, emp, and vwb. However, electrophoretic mobility shift assays gave no evidence that this sequence was a binding site for SarA or SaeR, known regulators of eap and emp.

  5. VES magas Riias

    Index Scriptorium Estoniae

    2002-01-01

    Valie Export Society (Kadi Estland, Killu Sukmit, Marko Laimre, Meelis Salujärv) osales 9.-11. V Riias toimunud rahvusvahelisel üritusel "6th element" remake-aktsiooniga. Performance'itega esinesid Sara Lunden Rootsist, Kate Pendry Norrast, Jenia Svetlova Venemaalt, Solomia Savtshuk ja Natalia Golibroda Ukrainast

  6. Spazio ASI, INFN e Nobel Ting a caccia di antimateria

    CERN Document Server

    Boz,

    2003-01-01

    "Una apparecchiatura per la ricerca dell' antimateria che nell'autunno del 2005 sara' installata sulla Stazione Spaziale e' al centro di un accordo di collaborazione tra l'Agenzia Spaziale Italiana e il Nobel Samuel Ting, del Mit e del Cern di Ginevra, firmato oggi a Roma (1 page).

  7. Mapping the Heart

    Science.gov (United States)

    Hulse, Grace

    2012-01-01

    In this article, the author describes how her fourth graders made ceramic heart maps. The impetus for this project came from reading "My Map Book" by Sara Fanelli. This book is a collection of quirky, hand-drawn and collaged maps that diagram a child's world. There are maps of her stomach, her day, her family, and her heart, among others. The…

  8. An electronic health record for infertility clinics | Coetsee | South ...

    African Journals Online (AJOL)

    Objective. To design a user-friendly electronic health record system for infertility clinics (EHRIC) to capture quality data that will allow advanced audit and practice analysis, and to use the captured data for the South African Register of Assisted Reproductive Techniques (SARA) database and as a clinical research function.

  9. Towards a sustainable coffee market: paradoxes faced by a multinational company

    NARCIS (Netherlands)

    Kolk, A.

    2012-01-01

    This paper examines the case of sustainable coffee as faced by Sara Lee's International Coffee and Tea Division (SL), asking which strategic direction the company should take considering its regulatory, competitive, and societal contexts. More than a decade after sustainable coffee became a

  10. "Who Wants to Be Sad Over and Over Again?": Emotion Ideologies in Contemporary German Education about the Holocaust

    Science.gov (United States)

    Krieg, Lisa Jenny

    2015-01-01

    Based on an ethnographic field study in Cologne, this article discusses the connection between memory practices and emotion ideologies in Holocaust education, using Sara Ahmed's concept of affective economies. Moral goals, political demands, and educators' care for their students lead to tensions in the education process. Two case studies…

  11. Record of Decision for the Ford Building Waste Unit (643-11G) Operable Unit; FINAL

    International Nuclear Information System (INIS)

    Fraley, S.

    2002-01-01

    This decision document presents the selected remedial for the Ford Building Waste Unit (FBWU), in Aiken, South Carolina, which was chosen in accordance with CERCLA, as amended by SARA, and, to the extent practical, the National Oil and Hazardous Substances Pollution Contingency Plan (NCP). This decision is based on the Administrative Record File for this specific RCRA/CERCLA site

  12. The Economic Costs of Childhood Disability

    Science.gov (United States)

    Stabile, Mark; Allin, Sara

    2012-01-01

    Childhood disabilities entail a range of immediate and long-term economic costs that have important implications for the well-being of the child, the family, and society but that are difficult to measure. In an extensive research review, Mark Stabile and Sara Allin examine evidence about three kinds of costs--direct, out-of-pocket costs incurred…

  13. 75 FR 78944 - Proposed Establishment of the Pine Mountain-Mayacmas Viticultural Area; Comment Period Reopening

    Science.gov (United States)

    2010-12-17

    ...://www.ttb.gov/wine/wine-rulemaking.shtml under Notice No. 105. You also may view copies of all published... Bureau (TTB) received a petition from Sara Schorske of Compliance Service of America, prepared and filed on her own behalf and on behalf of local wine industry members, to establish the 4,600-acre ``Pine...

  14. Temporal dynamics of in-situ fiber-adherent bacterial community under ruminal acidotic conditions determined by 16S rRNA gene profiling.

    Directory of Open Access Journals (Sweden)

    Renee M Petri

    Full Text Available Subacute rumen acidotic (SARA conditions are a consequence of high grain feeding. Recent work has shown that the pattern of grain feeding can significantly impact the rumen epimural microbiota. In a continuation of these works, the objective of this study was to determine the role of grain feeding patterns on the colonization and associated changes in predicted functional properties of the fiber-adherent microbial community over a 48 h period. Eight rumen-cannulated Holstein cows were randomly assigned to interrupted or continuous 60%-grain challenge model (n = 4 per model to induce SARA conditions. Cows in the continuous model were challenged for 4 weeks, whereas cows of interrupted model had a 1-wk break in between challenges. To determine dynamics of rumen fiber-adherent microbial community we incubated the same hay from the diet samples for 24 and 48 h in situ during the baseline (no grain fed, week 1 and 4 of the continuous grain feeding model as well as during the week 1 following the break in the interrupted model. Microbial DNA was extracted and 16SrRNA amplicon (V3-V5 region sequencing was done with the Illumina MiSeq platform. A significant decrease (P 0.1% relative abundance in the rumen, 18 of which were significantly impacted by the feeding challenge model. Correlation analysis of the significant OTUs to rumen pH as an indicator of SARA showed genus Succiniclasticum had a positive correlation to SARA conditions regardless of treatment. Predictive analysis of functional microbial properties suggested that the glyoxylate/dicarboxylate pathway was increased in response to SARA conditions, decreased between 24h to 48h of incubation, negatively correlated with propanoate metabolism and positively correlated to members of the Veillonellaceae family including Succiniclasticum spp. This may indicate an adaptive response in bacterial metabolism under SARA conditions. This research clearly indicates that changes to the colonizing fiber

  15. Altered TGF-β endocytic trafficking contributes to the increased signaling in Marfan syndrome.

    Science.gov (United States)

    Siegert, Anna-Maria; Serra-Peinado, Carla; Gutiérrez-Martínez, Enric; Rodríguez-Pascual, Fernando; Fabregat, Isabel; Egea, Gustavo

    2018-02-01

    The main cardiovascular alteration in Marfan syndrome (MFS) is the formation of aortic aneurysms in which augmented TGF-β signaling is reported. However, the primary role of TGF-β signaling as a molecular link between the genetic mutation of fibrillin-1 and disease onset is controversial. The compartmentalization of TGF-β endocytic trafficking has been shown to determine a signaling response in which clathrin-dependent internalization leads to TGF-β signal propagation, and caveolin-1 (CAV-1) associated internalization leads to signal abrogation. We here studied the contribution of endocytic trafficking compartmentalization to increased TGF-β signaling in vascular smooth muscle cells (VSMC) from MFS patients. We examined molecular components involved in clathrin- (SARA, SMAD2) and caveolin-1- (SMAD7, SMURF2) dependent endocytosis. Marfan VSMC showed higher recruitment of SARA and SMAD2 to membranes and their increased interaction with TGF-β receptor II, as well as higher colocalization of SARA with the early endosome marker EEA1. We assessed TGF-β internalization using a biotinylated ligand (b-TGF-β), which colocalized equally with either EEA1 or CAV-1 in VSMC from Marfan patients and controls. However, in Marfan cells, colocalization of b-TGF-β with SARA and EEA1 was increased and accompanied by decreased colocalization with CAV-1 at EEA1-positive endosomes. Moreover, Marfan VSMC showed higher transcriptional levels and membrane enrichment of RAB5. Our results indicate that increased RAB5-associated SARA localization to early endosomes facilitates its TGF-β receptor binding and phosphorylation of signaling mediator SMAD2 in Marfan VSMC. This is accompanied by a reduction of TGF-β sorting into multifunctional vesicles containing cargo from both internalization pathways. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. Disparities in availability of essential medicines to treat non-communicable diseases in Uganda: A Poisson analysis using the Service Availability and Readiness Assessment.

    Science.gov (United States)

    Armstrong-Hough, Mari; Kishore, Sandeep P; Byakika, Sarah; Mutungi, Gerald; Nunez-Smith, Marcella; Schwartz, Jeremy I

    2018-01-01

    Although the WHO-developed Service Availability and Readiness Assessment (SARA) tool is a comprehensive and widely applied survey of health facility preparedness, SARA data have not previously been used to model predictors of readiness. We sought to demonstrate that SARA data can be used to model availability of essential medicines for treating non-communicable diseases (EM-NCD). We fit a Poisson regression model using 2013 SARA data from 196 Ugandan health facilities. The outcome was total number of different EM-NCD available. Basic amenities, equipment, region, health facility type, managing authority, NCD diagnostic capacity, and range of HIV services were tested as predictor variables. In multivariate models, we found significant associations between EM-NCD availability and region, managing authority, facility type, and range of HIV services. For-profit facilities' EM-NCD counts were 98% higher than public facilities (p < .001). General hospitals and referral health centers had 98% (p = .004) and 105% (p = .002) higher counts compared to primary health centers. Facilities in the North and East had significantly lower counts than those in the capital region (p = 0.015; p = 0.003). Offering HIV care was associated with 35% lower EM-NCD counts (p = 0.006). Offering HIV counseling and testing was associated with 57% higher counts (p = 0.048). We identified multiple within-country disparities in availability of EM-NCD in Uganda. Our findings can be used to identify gaps and guide distribution of limited resources. While the primary purpose of SARA is to assess and monitor health services readiness, we show that it can also be an important resource for answering complex research and policy questions requiring multivariate analysis.

  17. GC-MS analysis of the ruminal metabolome response to thiamine supplementation during high grain feeding in dairy cows.

    Science.gov (United States)

    Xue, Fuguang; Pan, Xiaohua; Jiang, Linshu; Guo, Yuming; Xiong, Benhai

    2018-01-01

    Thiamine is known to attenuate high-concentrate diet induced subacute ruminal acidosis (SARA) in dairy cows, however, the underlying mechanisms remain unclear. The major objective of this study was to investigate the metabolic mechanisms of thiamine supplementation on high-concentrate diet induced SARA. Six multiparous, rumen-fistulated Holstein cows were used in a replicated 3 × 3 Latin square design. The treatments included a control diet (CON; 20% starch, dry matter basis), a SARA-inducing diet (SAID; 33.2% starch, dry matter basis) and SARA-inducing diet supplemented with 180 mg of thiamine/kg of dry matter intake (SAID + T). On d21 of each period, ruminal fluid samples were collected at 3 h post feeding, and GC/MS was used to analyze rumen fluid samples. PCA and OPLS-DA analysis demonstrated that the ruminal metabolite profile were different in three treatments. Compared with CON treatment, SAID feeding significantly decreased rumen pH, acetate, succinic acid, increased propionate, pyruvate, lactate, glycine and biogenic amines including spermidine and putrescine. Thiamine supplementation significantly decreased rumen content of propionate, pyruvate, lactate, glycine and spermidine; increase rumen pH, acetate and some medium-chain fatty acids. The enrichment analysis of different metabolites indicated that thiamine supplementation mainly affected carbohydrates, amino acids, pyruvate and thiamine metabolism compared with SAID treatment. These findings revealed that thiamine supplementation could attenuate high-concentrate diet induced SARA by increasing pyruvate formate-lyase activity to promote pyruvate to generate acetyl-CoA and inhibit lactate generation. Besides, thiamine reduced biogenic amines to alleviate ruminal epithelial inflammatory response.

  18. Seismic Amplitude Ratio Analysis of the 2014-2015 Bár∂arbunga-Holuhraun Dike Propagation and Eruption

    Science.gov (United States)

    Caudron, Corentin; White, Robert S.; Green, Robert G.; Woods, Jennifer; Ágústsdóttir, Thorbjörg; Donaldson, Clare; Greenfield, Tim; Rivalta, Eleonora; Brandsdóttir, Bryndís.

    2018-01-01

    Magma is transported in brittle rock through dikes and sills. This movement may be accompanied by the release of seismic energy that can be tracked from the Earth's surface. Locating dikes and deciphering their dynamics is therefore of prime importance in understanding and potentially forecasting volcanic eruptions. The Seismic Amplitude Ratio Analysis (SARA) method aims to track melt propagation using the amplitudes recorded across a seismic network without picking the arrival times of individual earthquake phases. This study validates this methodology by comparing SARA locations (filtered between 2 and 16 Hz) with the earthquake locations (same frequency band) recorded during the 2014-2015 Bár∂arbunga-Holuhraun dike intrusion and eruption in Iceland. Integrating both approaches also provides the opportunity to investigate the spatiotemporal characteristics of magma migration during the dike intrusion and ensuing eruption. During the intrusion SARA locations correspond remarkably well to the locations of earthquakes. Several exceptions are, however, observed. (1) A low-frequency signal was possibly associated with a subglacial eruption on 23 August. (2) A systematic retreat of the seismicity was also observed to the back of each active segment during stalled phases and was associated with a larger spatial extent of the seismic energy source. This behavior may be controlled by the dike's shape and/or by dike inflation. (3) During the eruption SARA locations consistently focused at the eruptive site. (4) Tremor-rich signal close to ice cauldrons occurred on 3 September. This study demonstrates the power of the SARA methodology, provided robust site amplification; Quality Factors and seismic velocities are available.

  19. Systems analysis programs for hands-on integrated reliability evaluations (SAPHIRE) version 5.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Kvarfordt, K.J.; Skinner, N.L.; Wood, S.T.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs), primarily for nuclear power plants. This volume is the reference manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA database contains PRA data primarily for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility databases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs that may be printed for reports. A preliminary version of the SARA program was completed in August 1985 and has undergone several updates in response to user suggestions and to maintain compatibility with the other SAPHIRE programs. Version 5.0 of SARA provides the same capability as earlier versions and adds the ability to process unlimited cut sets; display fire, flood, and seismic data; and perform more powerful cut set editing

  20. Analysis Of Ultra Compact Ionized Hydrogen Regions Within The Northern Half Of The Galactic Disk

    Science.gov (United States)

    Bruce, John

    2011-01-01

    From a catalog of 199 candidate ultra compact (UC) HII regions 123 sources included in the the intersection of the GLIMPSE (8 μm),Cornish (6 cm), and Bolocam ( 1.1 mm) galactic plane surveys (BGPS) were analyzed. The sources were sorted based on 6 cm morphology and coincidence with 8 μm bubbles. The 1.1 mm flux attributes were measured and calculations were performed to determine the ionized hydrogen contributions to the 1.1 mm flux. The category averages and frequencies were obtained as well. Significant differences in HII percentages were present among the morphology groups but ranged widely, without apparent distinction, between the bubble forming and triggered source categories.

  1. Culture: copying, compression, and conventionality.

    Science.gov (United States)

    Tamariz, Mónica; Kirby, Simon

    2015-01-01

    Through cultural transmission, repeated learning by new individuals transforms cultural information, which tends to become increasingly compressible (Kirby, Cornish, & Smith, ; Smith, Tamariz, & Kirby, ). Existing diffusion chain studies include in their design two processes that could be responsible for this tendency: learning (storing patterns in memory) and reproducing (producing the patterns again). This paper manipulates the presence of learning in a simple iterated drawing design experiment. We find that learning seems to be the causal factor behind the increase in compressibility observed in the transmitted information, while reproducing is a source of random heritable innovations. Only a theory invoking these two aspects of cultural learning will be able to explain human culture's fundamental balance between stability and innovation. Copyright © 2014 Cognitive Science Society, Inc.

  2. La evolución cultural del lenguaje entra en el laboratorio

    Directory of Open Access Journals (Sweden)

    Mónica Tamariz

    2013-03-01

    Full Text Available Según estudios recientes, algunas propiedades estructurales fundamentales del lenguaje pueden ser debidas no a factores biológicos sino a la transmisión cultural: el hecho de que las lenguas se difunden de generación en generación mediante el aprendizaje social. Los procesos de transmisión cultural suponen un filtro que favorece ciertas estructuras más que otras. Para detectar estos sesgos, Kirby, Cornish y Smith (2008 idearon el método experimental del aprendizaje iterado, en el que la información que produce un participante se usa para entrenar al siguiente. Los resultados son sorprendentes.

  3. Water flow and solute transport through fractured rock

    International Nuclear Information System (INIS)

    Bolt, J.E.; Bourke, P.J.; Pascoe, D.M.; Watkins, V.M.B.; Kingdon, R.D.

    1990-09-01

    In densely fractured slate at the Nirex research site in Cornwall, the positions, orientations and hydraulic conductivities of the 380 fractures intersecting a drill hole between 9 and 50 m depth have been individually measured. These data have been used: to determine the dimensions of statistically representative volumes of the network of fractures and to predict, using discrete flow path modelling and the NAPSAC code, the total flows into the fractures when large numbers are simultaneously pressurised along various lengths of the hole. Corresponding measurements, which validated the NAPSAC code to factor of two accuracy for the Cornish site, are reported. Possibilities accounting for this factor are noted for experimental investigation, and continuing, more extensive, inter hole flow and transport measurements are outlined. The application of this experimental and theoretical approach for calculating radionuclide transport in less densely fractured rock suitable for waste disposal is discussed. (Author)

  4. Attempted induction of gynogenesis in chickens

    International Nuclear Information System (INIS)

    Zartman, D.L.

    1975-01-01

    Dark Cornish and White Leghorn hens were divided into a virgin group and a group inseminated with semen that had been irradiated with 5,000 R of X rays. Two replicate trials were performed, one during winter and the second during summer. Two parthenogenetic embryos were found among 1,417 virgin eggs incubated for 24 hours. No other development was seen in eggs from this group. The three chicks produced by the inseminated group were not gynogenetic. Their heterozygous coloration showed them to be normal fertilization products. Fertility of 1,500 eggs was only about 5 percent and survival was almost nil for eggs from hens artificially inseminated with semen irradiated at 5,000 R. Most embryonic development consisted of membranous growth with occasional blood cells. The frequency of detectable embryonic development in abortive eggs was half as great after seven days incubation compared to the frequency after only 24 hours incubation

  5. Risk management at hazardous waste sites

    International Nuclear Information System (INIS)

    Travis, C.C.; Doty, C.B.

    1990-01-01

    The Superfund Amendments and Reauthorization Act of 1986 (SARA) provided the Environmental Protection Agency (EPA) with additional resources and direction for the identification, evaluation, and remediation of hazardous waste sites in the United States. SARA established more stringent requirements for the Superfund program, both in terms of the pace of the program and the types of remedial alternatives selected. The central requirement is that remedial alternatives be ''protective of public health and the environment'' and ''significantly and permanently'' reduce the toxicity, mobility, or volume of contaminants. The mandate also requires that potential risk be considered in the decision-making process. This document discusses risk management at hazardous waste sites. Topics include selection of sites for placement on the National Priority List, risk assessment and the decision process, risk reduction and remedial alternative selection, and aquifer restoration. 10 refs., 2 figs

  6. Briefing paper -- Remedial Action Assessment System

    International Nuclear Information System (INIS)

    Buelt, J.L.

    1990-04-01

    Congress has mandated a more comprehensive management of hazardous wastes with the Resource Conservation and Recovery Act (RCRA), the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA or ''Superfund'') and the Superfund Amendment and Reauthorization Act (SARA). This mandate includes restoration of disposal sites contaminated through past disposal practices. This mandate applies to facilities operated for and by the Department of Energy (DOE), just as it does to industrial and other institutions. To help implement the CERCLA/SARA remedial investigation and feasibility study (RI/FS) process in a consistent, timely, and cost-effective manner, a methodology needs to be developed that will allow definition, sorting, and screening of remediation technologies for each operable unit (waste site). This need is stated specifically in Section 2.2.2.1 of the October 1989 Applied Research, Development, Demonstration, Testing, and Evaluation (RDDT ampersand E) Plan of the DOE. This Briefing Paper is prepared to respond to this need. 1 fig

  7. Soil treatment technologies combined

    International Nuclear Information System (INIS)

    Davis, K.J.; Russell, D.J.

    1993-01-01

    The Superfund Amendments and Reauthorization Act (SARA) presents a legislative mandate to select effective and long-term remediation options. SARA has spurred the development of innovative technologies and other remedial alternatives that can be applied to the diverse contaminated media at hazardous waste sites. Even though many treatment technologies have been investigated for use at hazardous waste sites, only a few have been used successfully. Soil vapor extraction and soil composting have achieved cleanup goals at sites with soils contaminated with solvents, aromatic hydrocarbons and petroleum derivatives. With the increased use of innovative on-site technologies, the integration of multiple technologies to remediate sites with complex contaminants becomes a viable and cost-effective remedial alternative. Soil vapor extraction and composting have been applied successfully as individual technologies at hazardous waste sites. An integration of these two technologies also has been used to remediate a complex contaminated site

  8. Time-To-Complete Prediction for Data Transfers

    CERN Document Server

    Toler, Wesley

    2016-01-01

    Currently, there is no prediction provided to users for the amount of time a particular data transfer from one site in the Worldwide LHC Computing Grid to another will take to complete. To develop a time-to-complete prediction, network performance data and per-file information is gathered from two separate databases and fused, and the resulting cleaned data is fitted using random forest regression. Results are shown for two separate links: the link from CERN Data Centre to Brookhaven National Laboratory’s ATLAS data center, and the link from CERN Data Centre to SARA-MATRIX in Amsterdam. A total RMS error of 25.93 minutes between predicted and test data is found for the CERN-PROD -> BNL-ATLAS link, while the CERN-PROD -> SARA-MATRIX link yields a total RMS error of 3.00 minutes.

  9. Pneumonia por varicela associada com síndrome da angústia respiratória aguda: relato de dois casos Varicella pneumonia complicated with acute respiratory distress syndrome: two cases report

    OpenAIRE

    Marcelo Moreno; Ricardo Castelão; Susana Orrico Peres; Suzana Margareth Lobo

    2007-01-01

    JUSTIFICATIVA E OBJETIVOS: A varicela é uma doença exantemática causada pela infecção primária do vírus varicela zoster (VVZ). A pneumonia pelo VVZ complicada com a síndrome da angústia respiratória aguda (SARA) é rara e associa-se a altas taxas de morbimortalidade. O objetivo deste estudo foi apresentar dois casos de pneumonia por varicela que evoluíram com SARA e outras disfunções orgânicas. RELATO DOS CASOS: Paciente de 15 anos, imunocomprometido com a síndrome da imunodeficiência adquirid...

  10. Application of the luminescence single-aliquot technique for dose estimation in the Marmara Sea

    International Nuclear Information System (INIS)

    Tanir, Guenes; Sencan, Emine; Boeluekdemir, M. Hicabi; Tuerkoez, M. Burak; Tel, Eyuep

    2005-01-01

    The aim of this study is to obtain the equivalent dose, which is the important quantity for all the studies related to the use of luminescence in dating sediments. Recent advances in luminescence dating have led to increasing application of the technique to sediment from the depositional environmental samples. The sample used in this study is the active main fault sample that was collected from the Sea of Marmara in NW Turkey. Equivalent dose was measured using both the multiple-aliquots and the single-aliquot techniques. In this study single aliquot regeneration on additive dose (SARA) procedure was also used. The result obtained was not in agreement with the results evaluated from the multiple-aliquots procedure. So a simple modification was suggested for SARA procedure. In our modified procedure the calculated dose (D) values were obtained by using the additive dose protocol instead of regeneration protocol

  11. Spectral characterization of crude oil using fluorescence (synchronous and time-resolved) and NIR (Near Infrared Spectroscopy); Caracterizacao espectral do petroleo utilizando fluorescencia (sincronizada e resolvida no tempo) e NIR (Near Infrared Spectroscopy)

    Energy Technology Data Exchange (ETDEWEB)

    Falla Sotelo, F.; Araujo Pantoja, P.; Lopez-Gejo, J.; Le Roux, G.A.C.; Nascimento, C.A.O. [Universidade de Sao Paulo (USP), SP (Brazil). Dept. de Engenharia Quimica. Lab. de Simulacao e Controle de Processos; Quina, F.H. [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Quimica. Centro de Capacitacao e Pesquisa em Meio Ambiente (CEPEMA)

    2008-07-01

    The objective of the present work is to evaluate the performance of two spectroscopic techniques employed in the crude oil characterization: NIR spectroscopy and fluorescence spectroscopy (Synchronous fluorescence - SF and Time Resolved Fluorescence - TRF) for the development of correlation models between spectral profiles of crude oil samples and both physical properties (viscosity and API density) and physico-chemical properties (SARA analysis: Saturated, Aromatic, Resins and Asphaltenes). The better results for viscosity and density were obtained using NIR whose prediction capacity was good (1.5 cP and 0.5 deg API, respectively). For SARA analysis, fluorescence spectroscopy revealed its potential in the model calibration showing good results (R2 coefficients greater than 0.85). TRF spectroscopy had better performance than SF spectroscopy. (author)

  12. Reseñas. Books Review

    Directory of Open Access Journals (Sweden)

    Díaz, Liliana

    2014-10-01

    Full Text Available TORRE, Claudia, El otro desierto de la nación argentina. Antología de narrativa expedicionaria, Bernal, Argentina, Editorial Universidad de Quilmes, 2011, 387 pp. MAURO, Diego y LICHTMAJER, Leandro (compiladores, Los costos de la política. Del Centenario al primer peronismo, Imago Mundi, Buenos Aires, 2014, 130 pp. DE MARCO; Miguel Ángel (h. Ciudad Puerto, Universidad y Desarrollo Regional, Rosario, 1919-1968. CEHDRE, Rosario, 2013, 542 pp. GUARDIA, Sara Beatriz. Primer Congreso Internacional. Las mujeres en los procesos de Independencia de América Latina. Lima, Perú. Sara Beatriz Guardia Edición, CEMHAL, UNESCO, USMP, 2014. 495 pp

  13. The technical status of the supersara project at its termination

    International Nuclear Information System (INIS)

    Markovina, A.; Randles, J.

    1987-01-01

    On March 10th 1983 the Council of Ministers of the European Community adopted the decision to abandon the SuperSARA project. In the frame of this decision, the Management of the SuperSARA project formulated the guidelines to close the project, which included the preparation of the present final report. This report presents the final status of the project, which means that it reflects the situation in March 1983, with a few updates introduced shortly afterwards in conformity with the safety requirements which were being revised at that time. The aim of this report is to give a general description of activities which were carried on to implement the experimental programme and to illustrate some important achievements reached in specific areas. In addition, it is also intended to provide the access key to the documentation which was produced in the past years, so as to make the most significant technical material easily available for any possible future use

  14. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0: Models and Results Database (MAR-D) reference manual. Volume 8

    International Nuclear Information System (INIS)

    Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs), primarily for nuclear power plants. The primary function of MAR-D is to create a data repository for completed PRAs and Individual Plant Examinations (IPEs) by providing input, conversion, and output capabilities for data used by IRRAS, SARA, SETS, and FRANTIC software. As probabilistic risk assessments and individual plant examinations are submitted to the NRC for review, MAR-D can be used to convert the models and results from the study for use with IRRAS and SARA. Then, these data can be easily accessed by future studies and will be in a form that will enhance the analysis process. This reference manual provides an overview of the functions available within MAR-D and step-by-step operating instructions

  15. A survey of formal methods for determining functional joint axes.

    Science.gov (United States)

    Ehrig, Rainald M; Taylor, William R; Duda, Georg N; Heller, Markus O

    2007-01-01

    Axes of rotation e.g. at the knee, are often generated from clinical gait analysis data to be used in the assessment of kinematic abnormalities, the diagnosis of disease, or the ongoing monitoring of a patient's condition. They are additionally used in musculoskeletal models to aid in the description of joint and segment kinematics for patient specific analyses. Currently available methods to describe joint axes from segment marker positions share the problem that when one segment is transformed into the coordinate system of another, artefacts associated with motion of the markers relative to the bone can become magnified. In an attempt to address this problem, a symmetrical axis of rotation approach (SARA) is presented here to determine a unique axis of rotation that can consider the movement of two dynamic body segments simultaneously, and then compared its performance in a survey against a number of previously proposed techniques. Using a generated virtual joint, with superimposed marker error conditions to represent skin movement artefacts, fitting methods (geometric axis fit, cylinder axis fit, algebraic axis fit) and transformation techniques (axis transformation technique, mean helical axis, Schwartz approach) were classified and compared with the SARA. Nearly all approaches were able to estimate the axis of rotation to within an RMS error of 0.1cm at large ranges of motion (90 degrees ). Although the geometric axis fit produced the least RMS error of approximately 1.2 cm at lower ranges of motion (5 degrees ) with a stationary axis, the SARA and Axis Transformation Technique outperformed all other approaches under the most demanding marker artefact conditions for all ranges of motion. The cylinder and algebraic axis fit approaches were unable to compute competitive AoR estimates. Whilst these initial results using the SARA are promising and are fast enough to be determined "on-line", the technique must now be proven in a clinical environment.

  16. Subacute ruminal acidosis reduces sperm quality in beef bulls.

    Science.gov (United States)

    Callaghan, M J; McAuliffe, P; Rodgers, R J; Hernandez-Medrano, J; Perry, V E A

    2016-08-01

    Breeding bulls are commonly fed high-energy diets, which may induce subacute ruminal acidosis (SARA). In this experiment, 8 Santa Gertrudis bulls (age 20 ± 6 mo) were used to evaluate the extent and duration of effects of SARA on semen quality and the associated changes in circulating hormones and metabolites. The bulls were relocated and fed in yards with unrestricted access to hay and daily individual concentrate feeding for 125 d before SARA challenge. Semen was collected and assessed at 14-d intervals before the challenge to ensure acclimatization and the attainment of a stable spermiogram. The challenge treatments consisted of either a single oral dose of oligofructose (OFF; 6.5 g/kg BW) or an equivalent sham dose of water (Control). Locomotion, behavior, respiratory rate, and cardiovascular and gastrointestinal function were intensively monitored during the 24-h challenge period. Rumen fluid samples were retained for VFA, ammonia, and lactate analysis. After the challenge, semen was then collected every third day for a period of 7 wk and then once weekly until 12 wk, with associated blood collection for FSH, testosterone, inhibin, and cortisol assay. Percent normal sperm decreased in bulls dosed with OFF after the challenge period ( < 0.05) and continued to remain lower on completion of the study at 88 d after challenge. There was a corresponding increase in sperm defects commencing from 16 d after challenge. These included proximal cytoplasmic droplets ( < 0.001), distal reflex midpieces ( = 0.01), and vacuole and teratoid heads ( < 0.001). Changes in semen quality after challenge were associated with lower serum testosterone ( < 0.001) and FSH ( < 0.05). Serum cortisol in OFF bulls tended to be greater ( = 0.07) at 7 d after challenge. This study shows that SARA challenge causes a reduction in sperm quality sufficient to preclude bulls from sale as single sire breeding animals 3 mo after the event occurred.

  17. Pradinių klasių moksleivių mokymosi motyvacija, psichologinė savijauta ir mokyklinis nerimastingumas

    OpenAIRE

    Pileckaitė-Markovienė, Margarita

    2001-01-01

    This article deals with problem of learning motivation, school anxiety and well-being in middle childhood. The aim of investigation was to analyse inner consistency of Learning Motivation Scale, structure of learning motivation of primary school children and it's interrelations with school anxiety and well-being. Learning Motivation Scale (Zambacevičienė, Janulytė, 1998), Semantic Differential Type Scale for well-being in school (Beresnevičienė, 1995) and Test Anxiety Scale for children (Sara...

  18. Annual report 1979

    International Nuclear Information System (INIS)

    1980-01-01

    The research and development activities of the ISN for 1979 are reported. The main thrust is directed towards the SARA (Rhone-Alpes Accelerator System) project and the various technical and experimental aspects. Research work was carried out in the following areas: nuclear spectroscopy, giant resonances, reaction processes, experiments at ILL, intermediate energy physics and for the theoretical group: nuclear structure, nuclear reactions, three-body problem, thermal neutron capture and hypernuclear spectroscopy [fr

  19. Progress report of the Nuclear Physics Department (1.10.1983 - 30.9.1984)

    International Nuclear Information System (INIS)

    1985-01-01

    This progress report presents the experiments and the technological studies carried out at the Nuclear Physics Department of Saclay from October 1, 1983 to September 20, 1984. These studies concern the structure of nuclei and the nuclear reaction mechanisms. The experiments have been carried at the 9 MV tandem Van de Graaff, the 700 MeV electron linac, the synchrotron SATURNE, the heavy ion accelerator GANIL, the SARA facility at Grenoble, and the secondary beams at CERN [fr

  20. Use of Synthetic Peptides and Anti-Idiotypes for Controlling Human Immunodeficiency Virus Infections

    Science.gov (United States)

    1993-08-27

    example, studies by others have suggested that Iy-I. isolates which readily form syncytia in vitro may be associated with a more rapid rate of disease ...isolates which readily form syncytia in vitro may be associated with a more rapid rate of disease progression in vivo. Using fluorescent intracellular...will be useful reagents in testing sara for neutralizing activity in vitro. 0. Longitudinal analysis of the humoral inmune response to RIV-I gPi60

  1. Trading Nets for Guns: The Impact of Illegal Fishing on Piracy in Somalia

    Science.gov (United States)

    2010-09-01

    and World Order, Draft, Royal Irish Academy, National University of Ireland , Galway (Galway: Centr for Ocean Policy Studies, 2009), 26–27...Kismayo.75 Thus, piracy was transformed by warlord entrepreneurship , in its organization, targets, tactics, and potential profitability beginning in...World Order, Draft, Royal Irish Academy, National University of Ireland , Galway (Galway: Centr for Ocean Policy Studies, 2009), 26–27. Percy, Sara

  2. Progress report of the Nuclear Physics Department (1.10.1982 - 30.9.1983)

    International Nuclear Information System (INIS)

    1984-04-01

    This progress report presents the experiments and the technological studies carried out at the Nuclear Physics Department of Saclay from October 1, 1982 to September 30, 1983. These studies concern the structure of nuclei and hypernuclei and various reaction mechanisms. They have been performed with the 9 MV tandem Van de Graaff, with the 700 MeV electron linac, at the synchrotron SATURNE, the heavy ion accelerator GANIL, the SARA facility at Grenoble and the secondary beams at CERN [fr

  3. The role of synthetic fuels in natural gas global market; Il ruolo dei combustibili sintetici nello scenario mondiale del gas naturale

    Energy Technology Data Exchange (ETDEWEB)

    Urban, R. [Rome Univ. La Sapienza, Rome (Italy). Dipt. di Strategie delle politiche energetiche

    2001-09-01

    The paper examines the dilemma risen within the oil companies about the role the synthetic fuels will play in the context of the world energy scenery. [Italian] L'articolo e' basato sul dilemma che si e' proposto all'interno delle societa' petrolifere sul ruolo che sara' esercitato negli anni a venire dai combustibili sintetici all'interno del panorama energetico mondiale.

  4. DEVELOPMENT OF FINE MOTOR COORDINATION AND VISUAL-MOTOR INTEGRATION IN PRESCHOOL CHILDREN

    OpenAIRE

    MEMISEVIC Haris; HADZIC Selmir

    2015-01-01

    Fine motor skills are prerequisite for many everyday activities and they are a good predictor of a child's later academic outcome. The goal of the present study was to assess the effects of age on the development of fine motor coordination and visual-motor integration in preschool children. The sample for this study consisted of 276 preschool children from Canton Sara­jevo, Bosnia and Herzegovina. We assessed children's motor skills with Beery Visual Motor Integration Test and Lafayette Pegbo...

  5. A new approach to maternal mortality: the role of HIV in pregnancy

    OpenAIRE

    Gorman, Sara E

    2013-01-01

    Sara E GormanDepartment of Epidemiology, Harvard University, Boston, MA, USAAbstract: As 2015 quickly approaches, we have been made increasingly aware of our progress toward Millennium Development Goals (MDGs). However, one MDG has been particularly recalcitrant to progress: MDG 5, namely, improving maternal health. Few countries are on track to achieve the first part of MDG 5's goals, reducing maternal mortality by 75%. This article addresses the key priority issues of maternal healt...

  6. Supercritical solvent extraction of oil sand bitumen

    Science.gov (United States)

    Imanbayev, Ye. I.; Ongarbayev, Ye. K.; Tileuberdi, Ye.; Mansurov, Z. A.; Golovko, A. K.; Rudyk, S.

    2017-08-01

    The supercritical solvent extraction of bitumen from oil sand studied with organic solvents. The experiments were performed in autoclave reactor at temperature above 255 °C and pressure 29 atm with stirring for 6 h. The reaction resulted in the formation of coke products with mineral part of oil sands. The remaining products separated into SARA fractions. The properties of the obtained products were studied. The supercritical solvent extraction significantly upgraded extracted natural bitumen.

  7. Die räumliche Dimension von Herrschaftsverhältnissen

    Directory of Open Access Journals (Sweden)

    Ruben Marc Hackler

    2006-11-01

    Full Text Available Sara Mills stellt in klarer Sprache ein Konzept vor, sexistische, rassistische und klassenbezogene Herrschaftspraxen in den Kolonien des British Empire hinsichtlich ihrer räumlichen Dimension zu analysieren. Ihr Ansatz soll möglichst viele Formen von Herrschaft integrieren, offen bleibt aber die Frage, ob dabei das von ihr verwendete Habituskonzept Bourdieus die passende Erklärung hierzu liefert.

  8. Status Report on Speech Research. A Report on the Status and Progress of Studies on the Nature of Speech, Instrumentation for Its Investigation, and Practical Applications.

    Science.gov (United States)

    1985-10-01

    Kay Arlyne Russo Sara Basson Noriko Kobayashi Richard C. Schmidt "..’ Eric Bateson Rena A. Krakow John Scholz ... . Suzanne Boyce Deborah Kuglitsch...greater accuracy than isolated vowels ( Gottfried & Strange, 1980; Rakerd et al., 1984; Strange, Edman, & Jenkins, 1976; Strange, Verbrugge, Shankweiler...Perceptual structure of monophthongs and diphthongs in "" English. Language and Speech, 26, 21-59. Gottfried , T. L., & Strange, W. (1980

  9. Proceedings of the Canadian society of allergy and clinical immunology annual scientific meeting 2015

    OpenAIRE

    C?t?, Marie-?ve; Boulay, Marie-?ve; Plante, Sophie; Chakir, Jamila; Boulet, Louis-Philippe; Ahmed, Hanan; Ospina, Maria-Beatriz; Sideri, Kyriaki; Vliagoftis, Harissios; Johnson, Sara F.; Woodgate, Roberta L.; Cros, Guilhem; Teira, Pierre; Cellot, Sonia; Bittencourt, Henrique

    2016-01-01

    Table of contents A1 Role of fibrocytes in allergic rhinitis Marie-?ve C?t?, Marie-?ve Boulay, Sophie Plante, Jamila Chakir, Louis-Philippe Boulet A2 Patterns of aeroallergens sensitization in Northern Alberta Hanan Ahmed, Maria-Beatriz Ospina, Kyriaki Sideri, Harissios Vliagoftis A3 Addressing acceptable risk for adolescents with Food-Induced Anaphylaxis (FIA) Sara F. Johnson, Roberta L. Woodgate A4 Outcomes of matched related and unrelated bone marrow transplantation after reduced-toxicity ...

  10. Sigma Factor SigB Is Crucial to Mediate Staphylococcus aureus Adaptation during Chronic Infections.

    Directory of Open Access Journals (Sweden)

    Lorena Tuchscherr

    2015-04-01

    Full Text Available Staphylococcus aureus is a major human pathogen that causes a range of infections from acute invasive to chronic and difficult-to-treat. Infection strategies associated with persisting S. aureus infections are bacterial host cell invasion and the bacterial ability to dynamically change phenotypes from the aggressive wild-type to small colony variants (SCVs, which are adapted for intracellular long-term persistence. The underlying mechanisms of the bacterial switching and adaptation mechanisms appear to be very dynamic, but are largely unknown. Here, we analyzed the role and the crosstalk of the global S. aureus regulators agr, sarA and SigB by generating single, double and triple mutants, and testing them with proteome analysis and in different in vitro and in vivo infection models. We were able to demonstrate that SigB is the crucial factor for adaptation in chronic infections. During acute infection, the bacteria require the simultaneous action of the agr and sarA loci to defend against invading immune cells by causing inflammation and cytotoxicity and to escape from phagosomes in their host cells that enable them to settle an infection at high bacterial density. To persist intracellularly the bacteria subsequently need to silence agr and sarA. Indeed agr and sarA deletion mutants expressed a much lower number of virulence factors and could persist at high numbers intracellularly. SigB plays a crucial function to promote bacterial intracellular persistence. In fact, ΔsigB-mutants did not generate SCVs and were completely cleared by the host cells within a few days. In this study we identified SigB as an essential factor that enables the bacteria to switch from the highly aggressive phenotype that settles an acute infection to a silent SCV-phenotype that allows for long-term intracellular persistence. Consequently, the SigB-operon represents a possible target to develop preventive and therapeutic strategies against chronic and therapy

  11. Sigma Factor SigB Is Crucial to Mediate Staphylococcus aureus Adaptation during Chronic Infections.

    Science.gov (United States)

    Tuchscherr, Lorena; Bischoff, Markus; Lattar, Santiago M; Noto Llana, Mariangeles; Pförtner, Henrike; Niemann, Silke; Geraci, Jennifer; Van de Vyver, Hélène; Fraunholz, Martin J; Cheung, Ambrose L; Herrmann, Mathias; Völker, Uwe; Sordelli, Daniel O; Peters, Georg; Löffler, Bettina

    2015-04-01

    Staphylococcus aureus is a major human pathogen that causes a range of infections from acute invasive to chronic and difficult-to-treat. Infection strategies associated with persisting S. aureus infections are bacterial host cell invasion and the bacterial ability to dynamically change phenotypes from the aggressive wild-type to small colony variants (SCVs), which are adapted for intracellular long-term persistence. The underlying mechanisms of the bacterial switching and adaptation mechanisms appear to be very dynamic, but are largely unknown. Here, we analyzed the role and the crosstalk of the global S. aureus regulators agr, sarA and SigB by generating single, double and triple mutants, and testing them with proteome analysis and in different in vitro and in vivo infection models. We were able to demonstrate that SigB is the crucial factor for adaptation in chronic infections. During acute infection, the bacteria require the simultaneous action of the agr and sarA loci to defend against invading immune cells by causing inflammation and cytotoxicity and to escape from phagosomes in their host cells that enable them to settle an infection at high bacterial density. To persist intracellularly the bacteria subsequently need to silence agr and sarA. Indeed agr and sarA deletion mutants expressed a much lower number of virulence factors and could persist at high numbers intracellularly. SigB plays a crucial function to promote bacterial intracellular persistence. In fact, ΔsigB-mutants did not generate SCVs and were completely cleared by the host cells within a few days. In this study we identified SigB as an essential factor that enables the bacteria to switch from the highly aggressive phenotype that settles an acute infection to a silent SCV-phenotype that allows for long-term intracellular persistence. Consequently, the SigB-operon represents a possible target to develop preventive and therapeutic strategies against chronic and therapy-refractory infections.

  12. MAAGINEN SANASÄKKI : Toiminnallinen menetelmä esikouluikäisten lasten kielelliseen tukemiseen

    OpenAIRE

    George, Sara

    2017-01-01

    George, Sara. Maaginen sanasäkki. Toiminnallinen menetelmä esikouluikäisten lasten kielelliseen tukemiseen. Kevät 2017, 39s., 1 liite. Diakonia- ammattikorkeakoulu, Sosiaalialan koulutusohjelma, Sosiaali- ja kasvatusalan suuntautumisvaihtoehto, sosionomi (AMK) + lastentarhanopettajan kelpoisuus. Opinnäytetyön tarkoituksena oli juurruttaa suomi toisena kielenä -opetukseen uusi suomen kieltä tukeva Maaginen sanasäkki -menetelmä. Maaginen sanasäkki -menetelmä korostaa kielenoppimisessa aisti...

  13. Tselluloidi aura ja kaasaegne kunst / Hanno Soans

    Index Scriptorium Estoniae

    Soans, Hanno, 1974-

    2004-01-01

    Muutustest filmitegemises ja filmiesteetikas. Filmi sarnanemisest tehniliselt üha enam videoga. Kunstnike tegelemisest filmiga. 26. XI näeb kinos "Sõprus" "1+1=1" raames kaasaegsete kunstnike teoseid laiekraanil: Eija-Liisa Ahtila "If 6 was 9" (1995), "Today" (1996-97), "Consolation Service" (1999); Sara Lunden ja Henry Moore Selder (sünd. 1973, Stockholm) "Deadly Boring" (2001), "She is Dead" (2003)

  14. Jeter des ponts entre les agriculteurs et les supermarchés au ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    3 juil. 2014 ... Eric Smith. Que sont-ils devenus ? Sara Elder a reçu du financement qui lui a permis de poursuivre sur le terrain des travaux de recherche doctorale sur la façon dont les petits exploitants agricoles sont touchés par le fait qu'ils doivent vendre leurs produits à des supermarchés modernes plutôt qu'à des ...

  15. Til forsvar for surheden

    DEFF Research Database (Denmark)

    Monrad, Merete

    2012-01-01

    den australsk-britiske kulturkritiker Sara Ahmed i bogen The Promise of Happiness rammende beskriver, et så oplagt gode, at det kan være svært at problematisere glæde og kravet om at være glad. Vi bør være glade, for derved fremmer vi også andres glæde. Brok ødelægger den gode stemning, og ingen...

  16. Decay of new mass-separated neutron-deficient La and Ce isotopes

    International Nuclear Information System (INIS)

    Genevey, J.; Gizon, A.; Idrissi, N.; Weiss, B.; Beraud, R.; Charvet, A.; Duffait, R.; Emsallem, A.; Meyer, M.; Ollivier, T.; Redon, N.

    1987-01-01

    By use of a He jet system coupled to a Bernas-Nier ion-source, several new mass-separated A = 122 - 127 isotopes reached in heavy ion fusion reactions at SARA have been identified and studied. From experimental decay properties of La isotopes, systematics of low-lying energy levels have been extended for even-even and odd-A barium. New informations on Ce decay schemes are briefly reported

  17. Case report

    African Journals Online (AJOL)

    abp

    saraïque et le tronc porte (Figure 1). Une héparinothérapie associée à une antibiothérapie étaient démarrées. Une laparotomie médiane était réalisée en urgence, et l'exploration chirurgicale trouvait un appendice scléreux avec.

  18. Natsionalistlike meeleolude kaardistamine jätkub / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2008-01-01

    "Public Preparation Social Club. Natsionalismi sümptomid ja kriitika kaasaegses kunstis" 11. VII Pärnu Kunstnike Majas ja 12.-16. VII Pärnumaal. Korraldas ja modereeris Rael Artel, ettekannetega esinesid Kendra Ballingall (Winnipeg), Remco de Blaaij (Eindhoven), Övül Durmusoglu (Istanbul/Viin), Ronen Eidelman (Tel Aviv/Weimar), Claire Feeley (Dublin), Erden Kosova (Istanbul), Johannes Paul Raether (Berliin), Sara Stenczer (Budapest/Pariis) ja Tamara Zlobina (Kiiev)

  19. Annual report 1981

    International Nuclear Information System (INIS)

    1982-01-01

    This progress report reviews the research activities in the Institute of Nuclear Sciences for the year 1981; in experimental nuclear physics: nuclear spectroscopy, giant resonances, reaction processes, weak interactions, perinuclear research. In nuclear theory, studies were carried out on nuclear structure, nuclear reactions and the 3 quarks bound states problem. The setting-up of Sara facilities was going on the whole year through and the first beams are now accelerated [fr

  20. Loglines. May-June 2014

    Science.gov (United States)

    2014-06-01

    Kathleen T. Rhem Editor: Jacob Boyer Layout/Design: Paul Henry Crank Writers: Beth Reece Sara Moore Amanda Neumann Loglines is prepared...www.logisticsinformationservice.dla.mil dla.tng@dla.mil Jake Logan , a maintenance employee from the U.S. Army Corps of Engineers’ Greers Ferry Project...of their expertise. “The Joint Petroleum Seminar is designed to gather joint petroleum Defense, both incoming and incumbent, and expose them to

  1. VizieR Online Data Catalog: BVRI light curves of GR Boo (Wang+, 2017)

    Science.gov (United States)

    Wang, D.; Zhang, L.; Han, X. L.; Lu, H.

    2017-11-01

    We observed the eclipsing binary GR Boo on May 12, 22 and 24 in 2015 using the SARA 90-cm telescope located at Kitt Peak National Observatory, Arizona, USA. This telescope was equipped with an ARC CCD camera with a resolution of 2048x2048pixels but used at 2x2 binning, resulting in 1024x1024pixels. We used the Bessel BVRI filters. (1 data file).

  2. The importance of a culture of openness.

    Science.gov (United States)

    2016-06-15

    Revamping the counselling service at Birmingham Children's Hospital, as well as offering wa 24/7 telephone service and face-to-face counselling, led to reduced work-related stress - as stated in Nursing Management. Sara Brown, deputy chief officer for workforce at the hospital, says a culture of openness is essential for tackling the demands of nursing. She says nurses in management positions are responsible for supporting the daily demands of service delivery.

  3. punktum. Juni 2004

    OpenAIRE

    Aeschlimann, Heidi; Aeberli-Niquille, Christian Louis; Allemann, Rolf; Arnet, Esther; Burri Sharani, Barbara; Grünwald, Hugo Stephan; Gugger, Peter; Hürlimann, Fred W.; Meyer, Peter Michael; Meyer, Sara; Raeder, Sabine; Ruh, Hans; Schenker, Sybille; Wüthrich, Doris

    2004-01-01

    Meyer, Sara: Neue Lebensräume Arnet, Esther: Lebensraum Öffentlichkeit, Dürfen Politikerinnen Visionen haben? Burri Sharani, Barbara: Lebensraum Kosova, Die Frau des Bruders der Frau des ... Ruh, Hans (Prof.): Lebensraum Zeit, Höher weiter schneller länger? Meyer, Paul Michael: Lebensraum Schule, Warum ist hier möglich, was dort unmöglich scheint? Raeder Sabine (Dr.): Lebensraum Arbeit, Flexible Identitäten in flexibilisierten Arbeitsverhältnissen Gugger, Peter: Lebensraum...

  4. Proceedings of the 3rd Biennial Conference of the Society for Implementation Research Collaboration (SIRC) 2015: advancing efficient methodologies through community partnerships and team science

    OpenAIRE

    Lewis, Cara; Darnell, Doyanne; Kerns, Suzanne; Monroe-DeVita, Maria; Landes, Sara J.; Lyon, Aaron R.; Stanick, Cameo; Dorsey, Shannon; Locke, Jill; Marriott, Brigid; Puspitasari, Ajeng; Dorsey, Caitlin; Hendricks, Karin; Pierson, Andria; Fizur, Phil

    2016-01-01

    Table of contents Introduction to the 3rd Biennial Conference of the Society for Implementation Research Collaboration: advancing efficient methodologies through team science and community partnerships Cara Lewis, Doyanne Darnell, Suzanne Kerns, Maria Monroe-DeVita, Sara J. Landes, Aaron R. Lyon, Cameo Stanick, Shannon Dorsey, Jill Locke, Brigid Marriott, Ajeng Puspitasari, Caitlin Dorsey, Karin Hendricks, Andria Pierson, Phil Fizur, Katherine A. Comtois A1: A behavioral economic perspective ...

  5. Robot-assisted laparoscopic myomectomy: current status

    OpenAIRE

    Arian,Sara; Munoz,Jessian; Kim,Suejin; Falcone,Tommaso

    2017-01-01

    Sara E Arian, Jessian L Munoz, Suejin Kim, Tommaso Falcone Department of Obstetrics, Gynecology, and Women’s Health Institute, Cleveland Clinic, Cleveland, OH, USA Abstract: Robotic-assisted surgery has seen a rapid development and integration in the field of gynecology. Since the approval of the use of robot for gynecological surgery and considering its several advantages over conventional laparoscopy, it has been widely incorporated especially in the field of reproductive surgery....

  6. Interim action record of decision remedial alternative selection: TNX area groundwater operable unit

    International Nuclear Information System (INIS)

    Palmer, E.R.

    1994-10-01

    This document presents the selected interim remedial action for the TNX Area Groundwater Operable Unit at the Savannah River Site (SRS), which was developed in accordance with CERCLA of 1980, as amended by the Superfund Amendments and Reauthorization Act (SARA) of 1986, and to the extent practicable, the National Oil and Hazardous Substances Pollution contingency Plan (NCP). This decision is based on the Administrative Record File for this specific CERCLA unit

  7. Optical photometry of TX0506+056

    Science.gov (United States)

    Keel, William; Santander, Marcos

    2017-10-01

    The blazar TX0506+056 has attracted recent attention through its location in the error box of a high-energy Ice Cube neutrino detection (https://gcn.gsfc.nasa.gov/gcn3/21916.gcn3) and gamma-ray flaring (Atel #10791) We report recent photometry of TX0506+056 obtained in Johnson V and Cousins R passbands using the 1-meter Kapteyn telescope at La Palma, operated remotely by the SARA consortium.

  8. Detection of Ebola Virus RNA through Aerosol Sampling of Animal Biosafety Level 4 Rooms Housing Challenged Nonhuman Primates

    Science.gov (United States)

    2016-08-02

    Rooms Housing Challenged Nonhuman Primates 10 11 12 13 14 15 David E. Harbourt1*, Sara C. Johnston1, James Pettitt2, Travis K. Warren1 and...Sampling of ABSL-4 Rooms Housing Challenged Nonhuman 10 Primates for publication in an edition of The Journal of Infectious Disease. This 11 manuscript...embedded in the texts. This is the first report demonstrating detection of Ebola virus 17 RNA from animal rooms housing infected nonhuman primates and

  9. 1977 Annual report

    International Nuclear Information System (INIS)

    This report of the Nuclear Sciences Institute at Grenoble gives a general survey of the scientific and technical activities in 1977. The post-accelerator program SARA is described. In nuclear experimental physics, the research areas are heavy ion nuclear reactions, nuclear structure, nuclear spectroscopy; in collaboration with other laboratories pion scattering experiments and p invariance confirmation. In theoretical physics, reaction processes, three-body problem, nuclear structure and high energy pion collisions have been studied [fr

  10. Annual report 1983

    International Nuclear Information System (INIS)

    1984-01-01

    The research activities have in 1983 been centered in theoretical physics around particle models, symmetry groups and for intermediate energy physics around the π-N-N system and nuclear structure; in experimental physics, for high energy around experiments at CERN ISR and LEP, ALS and SATURNE and for nuclear physics in collaboration with SARA and GANIL. In the interdisciplinary studies: atomic collisions in solids, surfaces and interfaces, electronic structure, solids, amorphous [fr

  11. Brivaracetam: review of its pharmacology and potential use as adjunctive therapy in patients with partial onset seizures

    OpenAIRE

    Russo, Emilio; Mumoli,Laura; Palleria,Caterina; Gasparini,Sara; Citraro,Rita; Labate,Angelo; Ferlazzo,Edoardo; Gambardella,Antonio; De Sarro,Giovambattista

    2015-01-01

    Laura Mumoli,1 Caterina Palleria,2 Sara Gasparini,1 Rita Citraro,2 Angelo Labate,1 Edoardo Ferlazzo,1 Antonio Gambardella,1 Giovambattista De Sarro,2 Emilio Russo2 1Institute of Neurology, 2Institute of Pharmacology, University Magna Græcia, Catanzaro, Italy Abstract: Brivaracetam (BRV), a high-affinity synaptic vesicle protein 2A ligand, reported to be 10–30-fold more potent than levetiracetam (LEV), is highly effective in a wide range of experimental models of focal an...

  12. Properties of solar generators with reflectors and radiators

    Science.gov (United States)

    Ebeling, W. D.; Rex, D.; Bierfischer, U.

    1980-06-01

    Radiation cooled concentrator systems using silicon and GaAs cells were studied. The principle of radiation cooling by the reflector surfaces is discussed for cylindrical parabolic reflectors (SARA), truncated hexagonal pyramids, and a small trough configuration. Beam paths, collection properties for imperfect orientation, and thermal optimization parameters were analyzed. The three concentrating systems with radiation cooling offer advantages over the plane panel and over the large trough. With silicon solar cells they exhibit considerably lower solar cell consumption per Kw and also lower mass per kW. With GaAs cells the SARA system reduces the number of solar cells needed per kW to less than 10%. Also in all other cases SARA offers the best values for alpha and F sub sol, as long as narrow angular tolerances of the panel orientation can be met. Analysis of the energy collecting properties for imperfect orientation shows the superiority of the hexagonal concentrator. This device can produce power for even large angles between the sun and the panel normal.

  13. Development of a biofilm inhibitor molecule against multidrug resistant Staphylococcus aureus associated with gestational urinary tract infections

    Directory of Open Access Journals (Sweden)

    Balamurugan eP

    2015-08-01

    Full Text Available Urinary Tract Infection (UTI is a globally widespread human infection caused by an infestation of uropathogens. Eventhough, Escherichia coli is often quoted as being the chief among them, Staphylococcus aureus involvement in UTI especially in gestational UTI is often understated. Staphylococcal accessory regulator A (SarA is a quorum regulator of S. aureus that controls the expression of various virulence and biofilm phenotypes. Since SarA had been a focussed target for antibiofilm agent development, the study aims to develop a potential drug molecule targeting the SarA of S. aureus to combat biofilm associated infections in which it is involved. In our previous studies, we have reported the antibiofilm activity of SarA based biofilm inhibitor, (SarABI with a 50% minimum biofilm inhibitory concentration (MBIC50 value of 200 µg/mL against S. aureus associated with vascular graft infections and also the antibiofilm activity of the root ethanolic extracts of Melia dubia against uropathogenic E. coli. In the present study, in silico design of a hybrid molecule composed of a molecule screened from M. dubia root ethanolic extracts and a modified SarA based inhibitor (SarABIM was undertaken. SarABIM is a modified form of SarABI where the fluorine groups are absent in SarABIM. Chemical synthesis of the hybrid molecule, 4-(Benzylaminocyclohexyl 2-hydroxycinnamate (henceforth referred to as UTI Quorum-Quencher, UTIQQ was then performed, followed by in vitro and in vivo validation. The MBIC¬50 and MBIC90 of UTIQQ were found to be 15 µg/mL and 65 µg/mL respectively. Confocal laser scanning microscopy (CLSM images witnessed biofilm reduction and bacterial killing in either UTIQQ or in combined use of antibiotic gentamicin and UTIQQ. Similar results were observed with in vivo studies of experimental UTI in rat model. So, we propose that the drug UTIQQ would be a promising candidate when used alone or, in combination with an antibiotic for staphylococcal

  14. Trends in extinction risk for imperiled species in Canada.

    Directory of Open Access Journals (Sweden)

    Brett Favaro

    Full Text Available Protecting and promoting recovery of species at risk of extinction is a critical component of biodiversity conservation. In Canada, the Committee on the Status of Endangered Wildlife in Canada (COSEWIC determines whether species are at risk of extinction or extirpation, and has conducted these assessments since 1977. We examined trends in COSEWIC assessments to identify whether at-risk species that have been assessed more than once tended to improve, remain constant, or deteriorate in status, as a way of assessing the effectiveness of biodiversity conservation in Canada. Of 369 species that met our criteria for examination, 115 deteriorated, 202 remained unchanged, and 52 improved in status. Only 20 species (5.4% improved to the point where they were 'not at risk', and five of those were due to increased sampling efforts rather than an increase in population size. Species outcomes were also dependent on the severity of their initial assessment; for example, 47% of species that were initially listed as special concern deteriorated between assessments. After receiving an at-risk assessment by COSEWIC, a species is considered for listing under the federal Species at Risk Act (SARA, which is the primary national tool that mandates protection for at-risk species. We examined whether SARA-listing was associated with improved COSEWIC assessment outcomes relative to unlisted species. Of 305 species that had multiple assessments and were SARA-listed, 221 were listed at a level that required identification and protection of critical habitat; however, critical habitat was fully identified for only 56 of these species. We suggest that the Canadian government should formally identify and protect critical habitat, as is required by existing legislation. In addition, our finding that at-risk species in Canada rarely recover leads us to recommend that every effort be made to actively prevent species from becoming at-risk in the first place.

  15. Structure of Rot, a global regulator of virulence genes in Staphylococcus aureus.

    Science.gov (United States)

    Zhu, Yuwei; Fan, Xiaojiao; Zhang, Xu; Jiang, Xuguang; Niu, Liwen; Teng, Maikun; Li, Xu

    2014-09-01

    Staphylococcus aureus is a highly versatile pathogen that can infect human tissue by producing a large arsenal of virulence factors that are tightly regulated by a complex regulatory network. Rot, which shares sequence similarity with SarA homologues, is a global regulator that regulates numerous virulence genes. However, the recognition model of Rot for the promoter region of target genes and the putative regulation mechanism remain elusive. In this study, the 1.77 Å resolution X-ray crystal structure of Rot is reported. The structure reveals that two Rot molecules form a compact homodimer, each of which contains a typical helix-turn-helix module and a β-hairpin motif connected by a flexible loop. Fluorescence polarization results indicate that Rot preferentially recognizes AT-rich dsDNA with ~30-base-pair nucleotides and that the conserved positively charged residues on the winged-helix motif are vital for binding to the AT-rich dsDNA. It is proposed that the DNA-recognition model of Rot may be similar to that of SarA, SarR and SarS, in which the helix-turn-helix motifs of each monomer interact with the major grooves of target dsDNA and the winged motifs contact the minor grooves. Interestingly, the structure shows that Rot adopts a novel dimerization model that differs from that of other SarA homologues. As expected, perturbation of the dimer interface abolishes the dsDNA-binding ability of Rot, suggesting that Rot functions as a dimer. In addition, the results have been further confirmed in vivo by measuring the transcriptional regulation of α-toxin, a major virulence factor produced by most S. aureus strains.

  16. Poly-N-acetylglucosamine production in Staphylococcus aureus is essential for virulence in murine models of systemic infection.

    Science.gov (United States)

    Kropec, Andrea; Maira-Litran, Tomas; Jefferson, Kimberly K; Grout, Martha; Cramton, Sarah E; Götz, Friedrich; Goldmann, Donald A; Pier, Gerald B

    2005-10-01

    The contribution of the Staphylococcus aureus surface polysaccharide poly-N-acetylglucosamine (PNAG) to virulence was evaluated in three mouse models of systemic infection: bacteremia, renal abscess formation, and lethality following high-dose intraperitoneal (i.p.) infection. Deletion of the intercellular adhesin (ica) locus that encodes the biosynthetic enzymes for PNAG production in S. aureus strains Mn8, Newman, and NCTC 10833 resulted in mutant strains with significantly reduced abilities to maintain bacterial levels in blood following intravenous or i.p. injection, to spread systemically to the kidneys following i.p. injection, or to induce a moribund/lethal state following i.p. infection. In the bacteremia model, neither growth phase nor growth medium used to prepare the S. aureus inoculum affected the conclusion that PNAG production was needed for full virulence. As the SarA regulatory protein has been shown to affect ica transcription, PNAG synthesis, and biofilm formation, we also evaluated S. aureus strains Mn8 and 10833 deleted for the sarA gene in the renal infection model. A decrease in PNAG production was seen in sarA mutants using immunoblots of cell surface extracts but was insufficient to reduce the virulence of sarA-deleted strains in this model. S. aureus strains deleted for the ica genes were much more susceptible to antibody-independent opsonic killing involving human peripheral blood leukocytes and rabbit complement. Thus, PNAG confers on S. aureus resistance to killing mediated by these innate host immune mediators. Overall, PNAG production by S. aureus appears to be a critical virulence factor as assessed in murine models of systemic infection.

  17. The Continuing Search for Variability Among Cool White Dwarfs

    Science.gov (United States)

    Schaefer, J. J.; Oswalt, T. D.; Johnston, K. B.; Rudkin, M.; Heinz, T.

    2002-12-01

    The Continuing Search for Variability Among Cool White Dwarfs Justin J. Schaefer University of Wyoming Department of Physics and Astronomy P.O. Box 3905 Laramie, Wyoming 82071 USA (schaefju@uwyo.edu) Terry D. Oswalt, Kyle Johnston, Merissa Rudkin, Tamalyn Heinz Florida Institute of Technology and the SARA Observatory Department of Physics & Space Sciences 150 West University Boulevard Melbourne, Florida 32901 USA (oswalt@luyten.astro.fit.edu, kyjohnst@fit.edu, mrudkin@astro.fit.edu, theinz@fit.edu) ABSTRACT We present BVRI photometry of eleven binaries with white dwarf (WD) components. The observations were obtained at the SARA 0.9-meter telescope on Kitt Peak during the summer of 2002. Standard system (B-V), (V-R) and (R-I) color indices of four white dwarfs were determined. This data will be used to estimate the WD cooling ages in wide WD+dM binaries, as part of our ongoing research program to determine the chromospheric activity-age relation for M dwarf stars. Time-series differential photometry was also collected for eight cool white dwarfs as part of a program to explore the variability in the low luminosity, low temperature regime of the WD cooling track. We failed to detect any variability greater than ~0.04 magnitudes in these stars. Several nights of differential photometry data were collected on the DAO WD + K dwarf short-period variable HS1136+6646. From the light variations we determined a likely orbital period of 0.825 +/-0.009 days. Strong evidence is presented for two other possible periods within this light curve, possibly indicative of rotational modulation by the WD component. We gratefully acknowledge support from the National Science Foundation, which funds the SARA Research Experiences for Undergraduates program via grant AST-0097616 to Florida Tech. One of us (TDO) also acknowledges partial support for this work from NASA (subcontract Y701296) and the NSF (AST 0206115).

  18. Histamine Induces Bovine Rumen Epithelial Cell Inflammatory Response via NF-κB Pathway

    Directory of Open Access Journals (Sweden)

    Xudong Sun

    2017-06-01

    Full Text Available Background/Aims: Subacute ruminal acidosis (SARA is a common disease in high-producing lactating cows. Rumenitis is the initial insult of SARA and is associated with the high concentrations of histamine produced in the rumen of dairy cows during SARA. However, the exact mechanism remains unclear. The objective of the current study is to investigate whether histamine induces inflammation of rumen epithelial cells and the underlying mechanism of this process. Methods: Bovine rumen epithelial cells were cultured and treated with different concentrations of histamine and pyrrolidine dithiocarbamate (PDTC, an NF-κB inhibitor cultured in different pH medium (pH 7.2 or 5.5. qRT-PCR, Western-blotting, ELISA and immunocytofluorescence were used to evaluate whether histamine activated the NF-κB pathway and inflammatory cytokines. Results: The results showed that histamine significantly increased the activity of IKK β and the phosphorylation levels of IκB α, as well as upregulated the mRNA and protein expression levels of NF-κB p65 in the rumen epithelial cells cultured in neutral (pH=7.2 and acidic (pH=5.5 medium. Furthermore, histamine treatment also significantly increased the transcriptional activity of NF-κB p65. High expression and transcriptional activity of NF-κB p65 significantly increased the mRNA expressions and concentrations of inflammatory cytokines, tumor necrosis factor alpha (TNF-α, interleukin 6 (IL-6 and interleukin 1 beta (IL-1β, thereby inducing the inflammatory response in bovine rumen epithelial cells. However, inhibition of NF-κB p65 by PDTC significantly decreased the expressions and concentrations of the inflammatory cytokines induced by histamine in the rumen epithelial cells cultured in the neutral and acidic medium. Conclusion: The present data indicate that histamine induces the inflammatory response of bovine rumen epithelial cells through the NF-κB pathway.

  19. Bovine rumen epithelium undergoes rapid structural adaptations during grain-induced subacute ruminal acidosis.

    Science.gov (United States)

    Steele, Michael A; Croom, Jim; Kahler, Melissa; AlZahal, Ousama; Hook, Sarah E; Plaizier, Kees; McBride, Brian W

    2011-06-01

    Alterations in rumen epithelial structure and function during grain-induced subacute ruminal acidosis (SARA) are largely undescribed. In this study, four mature nonlactating dairy cattle were transitioned from a high-forage diet (HF; 0% grain) to a high-grain diet (HG; 65% grain). After feeding the HG diet for 3 wk, the cattle were transitioned back to the original HF diet, which was fed for an additional 3 wk. Continuous ruminal pH was measured on a weekly basis, and rumen papillae were biopsied during the baseline and at the first and final week of each diet. The mean, minimum, and maximum daily ruminal pH were depressed (P < 0.01) in the HG period compared with the HF period. During the HG period, SARA was diagnosed only during week 1, indicating ruminal adaptation to the HG diet. Microscopic examination of the papillae revealed a reduction (P < 0.01) in the stratum basale, spinosum, and granulosum layers, as well as total depth of the epithelium during the HG period. The highest (P < 0.05) papillae lesion scores were noted during week 1 when SARA occurred. Biopsied papillae exhibited a decline in cellular junctions, extensive sloughing of the stratum corneum, and the appearance of undifferentiated cells near the stratum corneum. Differential mRNA expression of candidate genes, including desmoglein 1 and IGF binding proteins 3, 5, and 6, was detected between diets using qRT-PCR. These results suggest that the structural integrity of the rumen epithelium is compromised during grain feeding and is associated with the differential expression of genes involved in epithelial growth and structure.

  20. PENANGANAN ORAL HIDRASI DAN KEJADIAN DEHIDRASI ANAK DIARE

    Directory of Open Access Journals (Sweden)

    Fera Dwi Purwanti

    2013-08-01

    Full Text Available Background: Many deaths due to diarrheal dehydration. While the primary treatment of diarrhea itself is overcome the dehydration. Rehydration therapy is highly effective for reducing mortality due to diarrheal dehydration. One factors that may affect the status of the child's diarrhea is rehidration of the parents in the treatment of oral hydration. There are 4 old men in rehydration in children with diarrhea is to provide a liquid, but with the amount, frequency and type of fluid that is not in accordance with the fluids the body needs. Research Objectives: To determine the relationship behavior parents in handling with oral hydration with events dehydration in children with diarrhea in RSUD Saras Husada Purworejo. Research Methods: This research uses method descriptive analytical using design cross sectional. Engineering samples are used by non-probability sampling using technique Accidental Sampling. Data collection by questionnaire. The number of samples is 24 parents of children with diarrhea. Analysis of test data used was the Kendall Tau. Results: The behavior of parents in the treatment of oral hydration of children suffering from diarrhea for lack of a majority of as many as 58,3%. Dehydration status of child diarrhea with dehydration diarrhea mostly mild / moderate as many as 45,8%. Results analysis Kendall Tau of -0,443 with level a significance of 0,020. The results showed a p-value less than 0,05 (0,020 < 0,05 which means there is a relationship between behavior parents' in the treatment of oral hydration with the incidence of dehydration in children with diarrhea in RSUD Saras Husada Purworejo. Conclusion: There is a relationship between behavior parents' in the treatment of oral hydration with the incidence of dehydration in children with diarrhea in RSUD Saras Husada Purworejo.

  1. A Surfactant-Induced Functional Modulation of a Global Virulence Regulator from Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Sukhendu Mandal

    Full Text Available Triton X-100 (TX-100, a useful non-ionic surfactant, reduced the methicillin resistance in Staphylococcus aureus significantly. Many S. aureus proteins were expressed in the presence of TX-100. SarA, one of the TX-100-induced proteins, acts as a global virulence regulator in S. aureus. To understand the effects of TX-100 on the structure, and function of SarA, a recombinant S. aureus SarA (rSarA and its derivative (C9W have been investigated in the presence of varying concentrations of this surfactant using various probes. Our data have revealed that both rSarA and C9W bind to the cognate DNA with nearly similar affinity in the absence of TX-100. Interestingly, their DNA binding activities have been significantly increased in the presence of pre-micellar concentration of TX-100. The increase of TX-100 concentrations to micellar or post-micellar concentration did not greatly enhance their activities further. TX-100 molecules have altered the secondary and tertiary structures of both proteins to some extents. Size of the rSarA-TX-100 complex appears to be intermediate to those of rSarA and TX-100. Additional analyses show a relatively moderate interaction between C9W and TX-100. Binding of TX-100 to C9W has, however, occurred by a cooperative pathway particularly at micellar and higher concentrations of this surfactant. Taken together, TX-100-induced structural alteration of rSarA and C9W might be responsible for their increased DNA binding activity. As TX-100 has stabilized the somewhat weaker SarA-DNA complex effectively, it could be used to study its structure in the future.

  2. Inclusion levels of sweet potato root meal in the diet of broilers I. Effect on performance, organ weights, and carcass quality.

    Science.gov (United States)

    Beckford, R C; Bartlett, J R

    2015-06-01

    The amount of corn available for animal and poultry feed has been unpredictable in recent years due to the increased use of corn for ethanol production. As a consequence, there has been an increase in the price of feed, chicken, and chicken products. Researchers are exploring alternative feed sources to substitute for corn in poultry ration. This study evaluated the performance and carcass quality of broilers fed diets containing sweet potato root meal (SPRM). After a complete nutrient analysis of the SPRM, diets were formulated where 0, 10, 20, and 30% of corn was substituted with SPRM. The study utilized 360 1-d-old Cornish X Rock male broiler chickens randomly assigned to one of 4 treatments; 0%, 10%, 20%, and 30% SPRM. Body weights and feed intake (FI) were monitored weekly for 7 wk. Birds were slaughtered on d 50 and FI, BW gain, ADG, ADFI, abdominal fat, dressing percentage, and organ weights measured. White (breast) and dark (leg and thigh) meat were evaluated for nutrient content (protein, moisture, fat, and ash). Results showed birds fed 20% SPRM had lower (Pdressing percentage among treatments. Abdominal fat was highest (PPoultry Science Association.

  3. Inhibition of β-Secretase Activity by Monoterpenes, Sesquiterpenes, and C13 Norisoprenoids.

    Science.gov (United States)

    Marumoto, Shinsuke; Okuno, Yoshiharu; Miyazawa, Mitsuo

    2017-08-01

    Inhibition of β-secretase (BACE1) is currently regarded as the leading treatment strategy for Alzheimer's disease. In the present study, we aimed to screen the in vitro inhibitory activity of 80 types of aroma compounds (monoterpenes, sesquiterpenes, and C 13 norisoprenoids), including plant-based types, at a 200-μM concentration against a recombinant human BACE1. The results showed that the most potent inhibitor of BACE1 was geranyl acetone followed by (+)-camphor, (-)-fenchone, (+)-fenchone, and (-)-camphor with the half-maximal inhibitory concentration (IC 50 ) values of 51.9 ± 3.9, 95.9 ± 11.0, 106.3 ± 14.9, 117.0 ± 18.6, and 134.1 ± 16.4 μM, respectively. Furthermore, the mechanism of inhibition of BACE1 by geranyl acetone was analyzed using Dixon kinetics plus Cornish-Bowden plots, which revealed mixed-type mode. Therefore aroma compounds may be used as potential lead molecules for designing anti-BACE1 agents.

  4. An outbreak of Bacillus cereus food poisoning--are caterers supervised sufficiently.

    Science.gov (United States)

    Slaten, D D; Oropeza, R I; Werner, S B

    1992-01-01

    Bacillus cereus is an uncommonly reported cause of foodborne illness in the United States. In May 1989, an outbreak of B. cereus gastroenteritis occurred among 140 guests who had attended a catered wedding reception in Napa, CA. Investigation established Cornish game hens served at the event as the vehicle for disease transmission (OR = 29, P = 0.0001). Although the spores of B. cereus are ubiquitous, large numbers of toxin-producing organisms (more than 10(5) per gram of food) are required for illness to occur. In the Napa outbreak, bacterial multiplication was facilitated at several points during the preparation and transportation of the food. While a licensed restaurant kitchen was used, the facilities were clearly inadequate for the event. At present, the California Health and Safety Code does not address the scope of catering operations. As caterers increase in number, there will be a growing need for governmental oversight to ensure that food production on a large scale is conducted safely. PMID:1641447

  5. Caffeine consumption and self-assessed stress, anxiety, and depression in secondary school children

    Science.gov (United States)

    Richards, Gareth; Smith, Andrew

    2015-01-01

    Previous research suggests that effects of caffeine on behaviour are positive unless one is investigating sensitive groups or ingestion of large amounts. Children are a potentially sensitive subgroup, and especially so considering the high levels of caffeine currently found in energy drinks. The present study used data from the Cornish Academies Project to investigate associations between caffeine (both its total consumption, and that derived separately from energy drinks, cola, tea, and coffee) and single-item measures of stress, anxiety, and depression, in a large cohort of secondary school children from the South West of England. After adjusting for additional dietary, demographic, and lifestyle covariates, positive associations between total weekly caffeine intake and anxiety and depression remained significant, and the effects differed between males and females. Initially, effects were also observed in relation to caffeine consumed specifically from coffee. However, coffee was found to be the major contributor to high overall caffeine intake, providing explanation as to why effects relating to this source were also apparent. Findings from the current study increase our knowledge regarding associations between caffeine intake and stress, anxiety, and depression in secondary school children, though the cross-sectional nature of the research made it impossible to infer causality. PMID:26508718

  6. Signal perception, transduction, and gene expression involved in anthocyanin biosynthesis

    International Nuclear Information System (INIS)

    Mol, J.; Jenkins, G.; Schäfer, E.; Weiss, D.

    1996-01-01

    Anthocyanin pigments provide fruits and flowers with their bright red and blue colors and are induced in vegetative tissues by various signals. The biosynthetic pathway probably represents one of the best‐studied examples of higher plant secondary metabolism. It has attracted much attention of plant geneticists because of the dispensable nature of the compounds it produces. Not unexpectedly, several excellent reviews on anthocyanin biosynthesis have been published over the last 5 years (Dooner et al., 1991; Martin and Gerats, 1993a, 1993b; Koes et al., 1994; Holton and Cornish, 1995). These reviews emphasize the late steps of pigment biosynthesis rather than the early and intermediate events of signal perception and transduction. This review is broader and not only covers the identification of components of the anthocyanin signal perception/transduction networks but also provides a description of our current understanding of how they evoke the responses that they do. Progress has derived from a combination of biochemical, molecular and genetic studies. We discuss a range of relevant research to highlight the different experimental approaches being used and the diverse biological systems under investigation. (author)

  7. Cohesion as interaction in ELF spoken discourse

    Directory of Open Access Journals (Sweden)

    T. Christiansen

    2013-10-01

    Full Text Available Hitherto, most research into cohesion has concentrated on texts (usually written only in standard Native Speaker English – e.g. Halliday and Hasan (1976. By contrast, following on the work in anaphora of such scholars as Reinhart (1983 and Cornish (1999, Christiansen (2011 describes cohesion as an interac­tive process focusing on the link between text cohesion and discourse coherence. Such a consideration of cohesion from the perspective of discourse (i.e. the process of which text is the product -- Widdowson 1984, p. 100 is especially relevant within a lingua franca context as the issue of different variations of ELF and inter-cultural concerns (Guido 2008 add extra dimensions to the complex multi-code interaction. In this case study, six extracts of transcripts (approximately 1000 words each, taken from the VOICE corpus (2011 of conference question and answer sessions (spoken interaction set in multicultural university con­texts are analysed in depth by means of a qualitative method.

  8. Breakfast and Energy Drink Consumption in Secondary School Children: Breakfast Omission, in Isolation or in Combination with Frequent Energy Drink Use, is Associated with Stress, Anxiety, and Depression Cross-Sectionally, but not at Six-Month Follow-Up

    Directory of Open Access Journals (Sweden)

    Gareth eRichards

    2016-02-01

    Full Text Available A considerable amount of research suggests that breakfast omission and the frequent use of caffeinated energy drinks may be associated with undesirable effects, and particularly so in children and adolescents. The current paper presents cross-sectional and longitudinal data from the Cornish Academies Project to investigate the effects of consuming energy drinks and missing breakfast on stress, anxiety, and depression in a cohort of secondary school children from the South West of England. Questionnaires were administered at two time-points (spaced six months apart to collect information relating to diet and lifestyle over the previous six months, demographic and school data were acquired through the School Information Management System, and single-item measures of stress, anxiety, and depression were administered at the second time-point only. Associations between breakfast and energy drink consumption and stress, anxiety, and depression were investigated, and a multivariate approach was taken so that additional variance from diet, demography, and lifestyle could be controlled for statistically. Cross-sectional analyses showed that breakfast omission was consistently associated with negative outcomes, and that this was largely observed for both those who frequently consumed energy drinks and those who did not. However, cross-lag analyses showed that neither breakfast omission or energy drink consumption, alone or in combination, was predictive of stress, anxiety, or depression at six-month follow-up. This suggests that associations between breakfast and mental health may be bi-directional rather than breakfast being the causal factor.

  9. Migration of gases through fractured argillaceous rocks: experimental work at the Reskajeage Farm Quarry site, Cornwall

    International Nuclear Information System (INIS)

    Elliot, T.; Tomlinson, M.J.; Holbrough, D.J.; Searle, D.M.; Foxford, K.A.

    1989-03-01

    The objective of the fieldwork in the Cornish slate site was to attempt in-situ testing of gas permeabilities of single fracture systems in the formation using a downhole packer. Complementary hydraulic studies at the same site are currently in process, conducted by B Watkins of Elcon Western (electrical) Ltd, Redruth. Two boreholes, BH2 and BH14 have been gas flow tested at depths between 9.85-13.30 m and 22.40-28.00 m, respectively, using oxygen-free nitrogen. Altogether 24 flow sections have been logged and continuously flow-tested over periods ranging from 1-10 hours. Seven of these flow sections were tested until steady-state flow conditions had been achieved, and at six of these levels rising/falling pressure tests were then conducted. Pressure decay tests have been performed at four test levels which had been logged as having little or no measurable gas flow. For both boreholes the recovered core has been fully logged for fracture and lithological variations, and the identified flow sections have been correlated with these logs. In the case of BH14, successful impression packering of fracture/vein patterns in the borehole wall from 5.01-18.02 m depth has been made. The fractures recorded in the impressions have been correlated with fractures logged in the recovered core over the same section of the borehole. (author)

  10. Probabilistic Load-Flow Analysis of Biomass-Fuelled Gas Engines with Electrical Vehicles in Distribution Systems

    Directory of Open Access Journals (Sweden)

    Francisco J. Ruiz-Rodríguez

    2017-10-01

    Full Text Available Feeding biomass-fueled gas engines (BFGEs with olive tree pruning residues offers new opportunities to decrease fossil fuel use in road vehicles and electricity generation. BFGEs, coupled to radial distribution systems (RDSs, provide renewable energy and power that can feed electric vehicle (EV charging stations. However, the combined impact of BFGEs and EVs on RDSs must be assessed to assure the technical constraint fulfilment. Because of the stochastic nature of source/load, it was decided that a probabilistic approach was the most viable option for this assessment. Consequently, this research developed an analytical technique to evaluate the technical constraint fulfilment in RDSs with this combined interaction. The proposed analytical technique (PAT involved the calculation of cumulants and the linearization of load-flow equations, along with the application of the cumulant method, and Cornish-Fisher expansion. The uncertainties related to biomass stock and its heating value (HV were important factors that were assessed for the first time. Application of the PAT in a Spanish RDS with BFGEs and EVs confirmed the feasibility of the proposal and its additional benefits. Specifically, BFGEs were found to clearly contribute to the voltage constraint fulfilment. The computational cost of the PAT was lower than that associated with Monte-Carlo simulations (MCSs.

  11. HINTW, a W-chromosome HINT gene in chick, is expressed ubiquitously and is a robust female cell marker applicable in intraspecific chimera studies.

    Science.gov (United States)

    Nagai, Hiroki; Sezaki, Maiko; Bertocchini, Federica; Fukuda, Kimiko; Sheng, Guojun

    2014-05-01

    Grafting and transplantation experiments in embryology require proper distinction between host and donor tissues. For the avian model this has traditionally been achieved by using two closely related species (e.g., chick and quail) followed by species-specific antibody staining. Here, we show that an in situ hybridization probe against the HINTW gene is a robust and reliable marker for female-derived chicken cells. At all pre-circulation stages tested, all cells in female embryos, independently confirmed by PCR analysis, were strongly positive for HINTW, whereas all male embryos were negative. This probe is broadly applicable in intra-specific chick/chick chimera studies, and as a proof of principle, we utilized this probe to detect female cells in three experimental settings: (1) to mark female donor cells in a node transplantation assay; (2) to distinguish female cells in male/female twins generated by the Cornish pasty culture; and (3) to detect female half of the embryo in artificially generated bilateral gynandromorphs. A rapid, PCR based pre-screening step increases the efficiency of obtaining desired donor/host sex combination from 25% to 100%. For most avian chimera studies, this female-specific in situ probe is a low cost alternative to the commonly used QCPN antibody and to ubiquitous-GFP chicken strains which are not widely available to the research community. © 2014 Wiley Periodicals, Inc.

  12. Protein energy landscapes determined by five-dimensional crystallography

    International Nuclear Information System (INIS)

    Schmidt, Marius; Srajer, Vukica; Henning, Robert; Ihee, Hyotcherl; Purwar, Namrta; Tenboer, Jason; Tripathi, Shailesh

    2013-01-01

    Barriers of activation within the photocycle of a photoactive protein were extracted from comprehensive time courses of time resolved crystallographic data collected at multiple temperature settings. Free-energy landscapes decisively determine the progress of enzymatically catalyzed reactions [Cornish-Bowden (2012 ▶), Fundamentals of Enzyme Kinetics, 4th ed.]. Time-resolved macromolecular crystallography unifies transient-state kinetics with structure determination [Moffat (2001 ▶), Chem. Rev.101, 1569–1581; Schmidt et al. (2005 ▶), Methods Mol. Biol.305, 115–154; Schmidt (2008 ▶), Ultrashort Laser Pulses in Medicine and Biology] because both can be determined from the same set of X-ray data. Here, it is demonstrated how barriers of activation can be determined solely from five-dimensional crystallography, where in addition to space and time, temperature is a variable as well [Schmidt et al. (2010 ▶), Acta Cryst. A66, 198–206]. Directly linking molecular structures with barriers of activation between them allows insight into the structural nature of the barrier to be gained. Comprehensive time series of crystallographic data at 14 different temperature settings were analyzed and the entropy and enthalpy contributions to the barriers of activation were determined. One hundred years after the discovery of X-ray scattering, these results advance X-ray structure determination to a new frontier: the determination of energy landscapes

  13. Breakfast and Energy Drink Consumption in Secondary School Children: Breakfast Omission, in Isolation or in Combination with Frequent Energy Drink Use, is Associated with Stress, Anxiety, and Depression Cross-Sectionally, but not at 6-Month Follow-Up.

    Science.gov (United States)

    Richards, Gareth; Smith, Andrew P

    2016-01-01

    A considerable amount of research suggests that breakfast omission and the frequent use of caffeinated energy drinks may be associated with undesirable effects, and particularly so in children and adolescents. The current paper presents cross-sectional and longitudinal data from the Cornish Academies Project to investigate the effects of consuming energy drinks and missing breakfast on stress, anxiety, and depression in a cohort of secondary school children from the South West of England. Questionnaires were administered at two time-points (spaced 6 months apart) to collect information relating to diet and lifestyle over the previous 6 months. Demographic and school data were acquired through the School Information Management System, and single-item measures of stress, anxiety, and depression were administered at the second time-point only. Associations between breakfast and energy drink consumption and stress, anxiety, and depression were investigated, and a multivariate approach was taken so that additional variance from diet, demography, and lifestyle could be controlled for statistically. Cross-sectional analyses showed that breakfast omission was consistently associated with negative outcomes, and that this was largely observed for both those who frequently consumed energy drinks and those who did not. However, cross-lag analyses showed that neither breakfast omission or energy drink consumption, alone or in combination, was predictive of stress, anxiety, or depression at 6-month follow-up. This suggests that associations between breakfast and mental health may be bi-directional rather than breakfast being the causal factor.

  14. Los precipitadores situacionales del delito: otra mirada a la interacción persona-ambiente

    Directory of Open Access Journals (Sweden)

    Pedro Campoy Torrente

    2015-12-01

    Full Text Available Los precipitadores situacionales del delito (Wortley, 2008 han recibido poca atención por la literatura criminológica en lengua española, y con frecuencia son subsumidos dentro de la perspectiva de la elección racional (Cornish & Clarke, 2003. Sin embargo, el estudio independiente de estos conceptos nos ofrece una oportunidad para profundizar en el proceso mediante el cual los delincuentes pasan al acto en sí. El objetivo de este estudio es sintetizar la evidencia en relación con los precipitadores situacionales del delito, los cuales ofrecen una nueva manera de examinar la interacción entre persona y ambiente en materia de delincuencia. La metodología empleada consiste en una revisión sistemática de la literatura de trabajos empíricos realizados a partir del 2007. Los resultados sugieren que es necesario profundizar en el proceso de toma de decisiones del delincuente desde una perspectiva integrada a nivel teórico, en lugar de hacerlo desde un punto de vista atomizado. Se concluye con una discusión de los resultados, después de considerar las características y limitaciones de los estudios observados.

  15. The impact of the 'Sea Empress' oil spill on seabass recruitment

    International Nuclear Information System (INIS)

    Lancaster, J.E.; Pawson, M.G.; Pickett, G.D.; Jennings, S.

    1998-01-01

    Young-of-the-year (O-group) sea bass (Dicentrarchus labrax L.) were collected during 1996 from 12 inshore sites in the Bristol Channel in order to investigate possible effects of the Sea Empress oil spill on their growth and survival. O-group bass were more abundant on the south side of the Bristol Channel than in South Wales nurseries, and particularly scarce within Milford Haven. Some bass caught in nursery areas on the north Cornish coast had spawned in early March, but only fish spawned after late April appeared in South Wales nurseries, where the first arrival data of bass post-larvae was later than in nursery areas in north Devon and Cornwall. O-group bass grew faster within the latter nurseries than in the north coast of the Bristol Channel, where a much higher proportion of fish failed to reach 60 mm, the critical length for survival through the first winter. There were no significant differences in fish condition or in the weight of their stomach contents between sites. Whilst the Sea Empress oil spill may have contributed to the differences in the survival of early-spawned bass larvae and the abundance of O-group bass in nursery areas on either side of the Bristol Channel, these differences are likely to be less significant than the year to year variation due to natural causes. (author)

  16. Prevalence of Presenting Conditions in Grey Seal Pups (Halichoerus grypus Admitted for Rehabilitation

    Directory of Open Access Journals (Sweden)

    Marc A. C. Silpa

    2015-01-01

    Full Text Available A retrospective survey was performed on the presenting conditions of 205 live grey seal pups (Halichoerus grypus admitted to the Cornish Seal Sanctuary in Gweek, United Kingdom between May 2005 and March 2011. The purpose of the survey was to examine the prevalence of various presenting signs at the sanctuary. The presenting signs were classified into nine non-mutually exclusive categories: ocular disorders, nasal disorders, oral disorders, respiratory disorders, orthopaedic disorders, puncture wounds, abrasions, netting injuries, and onychia. The sex ratio of seal pups in this study was 1.35 males per female. Of the 205 examined for rehabilitation, 22 (10.73% did not survive to release. 68.78% of grey seal pups presented with puncture wounds, 47.80% with respiratory disorders, 46.34% with ocular disorders, 42.63% malnourished, 36.59% with abrasions, 25.37% with oral disorders, 23.90% with nasal disorders, 11.71% with orthopaedic disorders, 9.27% with onychia, and 3.41% presented with netting injuries. 52% were normothermic, 42% were hyperthermic, and 5% were hypothermic. Associations between gender, outcome of rehabilitation, hospitalisation time and presenting disorders were examined. In addition, admissions rates were found to display seasonality. The results of this study will aid in future preparation of grey seal rehabilitation facilities.

  17. Progress report of the Nuclear Physics Department

    International Nuclear Information System (INIS)

    1983-01-01

    The experiments and the technological studies carried out at the Nuclear Physics Department of Saclay from October 1, 1981 to September 30, 1982 are presented. These studies concern the structure of nuclei and hypernuclei and various reaction mechanisms. They have been performed with the 8.5 MV tandem Van de Graaff, with the 600 MeV electron linac, at the synchrotron SATURNE and with different accelerators belonging to other laboratories, in particular the SARA facility at Grenoble, the boosted tandem at Heidelberg and the secondary beams at CERN [fr

  18. Os desenhos animados e as crianças : um estudo multicaso sobre as preferências de desenhos animados por crianças do 1º ciclo do ensino básico

    OpenAIRE

    Morais, Sandra Araújo Martins

    2008-01-01

    Dissertação de mestrado em Estudos da Criança (área de especialização em Tecnologias de Informação e Comunicação) Em diversos estudos efectuados, nomeadamente no de Bredorode Santos (1991), Sara Pereira (2002) e Ana Maria Magalhães e Isabel Alçada (1993), as crianças indicam os desenhos animados como a programação específica na qual costumam despender mais tempo de visionamento, quer durante a semana, quer ao fim-de-semana. Todavia, a partir da revisão da literatura, verifi...

  19. Ear Acupuncture versus  local anaestethic for pain relief during perineal repair - a randomised controlled trial

    DEFF Research Database (Denmark)

    Kindberg, Sara

    2007-01-01

    ACUPUNCTURE OR LOCAL ANAESTETICS FOR PAIN RELIEF DURING PERINEAL REPAIR AFTER VAGINAL DELIVERY: A RANDOMISED CONTROLLED TRIAL.   By:  Sara Kindberg. Midwife and PhD student, Sønderborg Hospital, Denmark. Objective: To evaluate acupuncture as a new method of pain relief for postpartum perineal...... as photos of the acupuncture points. Perspectives:  Basic midwifery services such as providing sufficient pain relief during perineal repair still need improvement. Clinical practice should be improved continuously and thus produce reliable evidence on different pain relief methods. Website:        http...

  20. Proposed plan for the United Nuclear Corporation Disposal Site at the Oak Ridge Y-12 Plant, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1991-03-01

    The US Department of Energy (DOE) in compliance with Section 117(a) of the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) of 1980, as amended by the Superfund Amendments and Reauthorization Act (SARA) of 1986, is releasing the proposed plan for remedial action at the United Nuclear Corporation (UNC) Disposal Site located at the DOE Oak Ridge Operations (ORO) Y-12 Plant, Oak Ridge, Tennessee. The purpose of this document is to present and solicit for comment to the public and all interested parties the ''preferred plan'' to remediate the UNC Disposal Site. However, comments on all alternatives are invited

  1. Annual report 1982

    International Nuclear Information System (INIS)

    This annual report describes the work during 1982 of the Nuclear Physics Institute of Lyon. The achievement of SARA postaccelerator in Grenoble, realized in collaboration with the Nuclear Science Institute, permits to pursue new lines of research in heavy ion physics. A new isotope separator was realized by the nuclear spectroscopy group and the high energy experimental group cooperates with the LAPP to build in international collaboration the L3 detector for LEP. The topics covered include theoretical physics, high energy and intermediate energy physics, nuclear physics and interdisciplinary physics, such as solid state physics and neutronics [fr

  2. Neutrons and light nuclei detectors realization for the 4π multidetector amphora

    International Nuclear Information System (INIS)

    Pastor, C.

    1987-01-01

    Detection of light charged particles emitted in reactions induced by heavy ions has been studied. Several types of detectors are presented as phoswiches of scintillators, single scintillators or combinations of scintillators having different functions (either detection of charged particles only or detection of charged particles and neutrons). The AMPHORA 4 π detection array has been designed and built as a set of 140 of these cells. Il covers a solid angle of 82 % out of 4 π around a target bombarded by ion beams delivered by the SARA facility in Grenoble [fr

  3. Validating the Patient Experience with Treatment and Self-Management (PETS), a patient-reported measure of treatment burden, in people with diabetes

    OpenAIRE

    Rogers,Elizabeth; Yost,Kathleen; Rosedahl,Jordan; Linzer,Mark; Boehm,Deborah; Thakur,Azra; Poplau,Sara; Anderson,Roger; Eton,David

    2017-01-01

    Elizabeth A Rogers,1,2 Kathleen J Yost,3 Jordan K Rosedahl,3 Mark Linzer,4 Deborah H Boehm,5 Azra Thakur,5 Sara Poplau,5 Roger T Anderson,6 David T Eton3 1Department of Medicine, University of Minnesota Medical School, Minneapolis, MN, USA; 2Department of Pediatrics, University of Minnesota Medical School, Minneapolis, MN, USA; 3Department of Health Services Research, Mayo Clinic, Rochester, MN, USA; 4Department of Medicine, Hennepin County Medical Center, Minneapolis, MN, USA; 5Minneapolis M...

  4. New Editors Appointed for Sections of Journal of Geophysical Research

    Science.gov (United States)

    2009-04-01

    New editors have been appointed for the Atmospheres, Biogeosciences, and Oceans sections of the Journal of Geophysical Research (JGR). Joost de Gouw (NOAA, Boulder, Colo.) and Renyi Zhang (Texas A&M, College Station) are filling the vacancies of retiring Atmospheres section editors John Austin and Jose Fuentes. De Gouw and Zhang join the continuing editors Steven Ghan and Yinon Rudich. Sara Pryor (Indiana University, Bloomington) is joining the Atmospheres section editorial board as an associate editor now; she will transition to editor in January 2010.

  5. Der er en særlig plads i Helvede for dovne børn

    DEFF Research Database (Denmark)

    Eriksen, Camilla Bruun

    2015-01-01

    in the process. Inspired also by Sara Ahmed and her claim that emotions are cultural practices that hold affective power and organize our modes of life, this article is interested in the ways the ‘healthy’ body is understood as tied to life and therefore gets to count as life. The article concludes that health...... are made (im)possible through the game’s strong narrative about Hell, death and health. The article will show how this narrative helps create ’healthy’ and ’liveable’ subject positions (for some) while understandings (of what health is or could be) that differ from the game’s view are stigmatized...

  6. KOULUIKÄISEN LAPSEN PELON HELPOTTAMINEN LEI-KIN KEINOIN SAIRAALASSA : Kuvaileva kirjallisuuskatsaus

    OpenAIRE

    Hietanen, Sara

    2017-01-01

    Hietanen, Sara. Kuvaileva kirjallisuuskatsaus kouluikäisen lapsen pelon helpottamisesta leikin keinoin sairaalassa. Kirjallisuuskatsaus. 27 sivua, 2 liitettä. Hel-sinki, kevät 2017. Diakonia-ammattikorkeakoulu, Hoitotyön koulutusohjelma, sai-raanhoitaja (AMK). Opinnäytetyön tarkoituksena oli kuvata leikin keinoja, joiden avulla voidaan hel-pottaa lasten pelkoja ja ahdistusta sairaalassa. Tavoitteena oli kartoittaa muualla maailmalla käytettäviä leikkiin liittyviä työmuotoja ja -menetelmiä...

  7. Archivos y bibliotecas en la antigüedad

    OpenAIRE

    Calderón Rondón, Homero A.

    2005-01-01

    SUMARIO Presentación Olmos Reverón, Sara M. Artículos Primera Parte Archivos y bibliotecas en la antigüedad Archives and libraries in ancient times Calderón Rondón, Homero A. Algunos aspectos sobre los libros y las bibliotecas en la Edad Media Some considerations on Medieval books and libraries Pérez Medina, Guillermo Amado Pérez Medina, Simón Vladimir La Farmacia del Alma. Primera Biblioteca de la Universidad de Los Andes The soul p...

  8. Pneumonia por varicela associada com síndrome da angústia respiratória aguda: relato de dois casos Varicella pneumonia complicated with acute respiratory distress syndrome: two cases report

    Directory of Open Access Journals (Sweden)

    Marcelo Moreno

    2007-03-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A varicela é uma doença exantemática causada pela infecção primária do vírus varicela zoster (VVZ. A pneumonia pelo VVZ complicada com a síndrome da angústia respiratória aguda (SARA é rara e associa-se a altas taxas de morbimortalidade. O objetivo deste estudo foi apresentar dois casos de pneumonia por varicela que evoluíram com SARA e outras disfunções orgânicas. RELATO DOS CASOS: Paciente de 15 anos, imunocomprometido com a síndrome da imunodeficiência adquirida (SIDA e uma paciente do sexo feminino imunocompetente, foram admitidos na UTI com quadro clínico de varicela, SARA, trombocitopenia e acidose graves. Além disso, disfunção cardiovascular e falência renal ocorreram no primeiro e segundo casos, respectivamente. Foram tratados com aciclovir além de ventilação mecânica protetora. CONCLUSÕES: Os dois casos de pneumonia por varicela, que apresentaram SARA e disfunções de múltiplos órgãos, obtiveram boa evolução clínica.BACKGROUNG AND OBJECTIVES: Varicella is an exantematic disease caused by varicella-zoster virus. Varicella pneumonia complicated with acute respiratory distress syndrome (ARDS is very rare in adults and is associated with high morbimortality. We report two cases of ARDS secondary to varicella-zoster virus pneumonia. CASES REPORT: We report two cases of ARDS and multiple organ dysfunction syndrome (MODS secondary to varicella-zoster virus pneumonia. A 15-year-old man with human immunodeficiency virus (HIV infection and a 29-year-old immunocompetent female were admitted in the ICU with primary varicella infection and pneumonia. Both cases progressed towards ARDS, severe thrombocytopenia and acidosis. In addition cardiovascular and renal failure occurred in the first and second patients, respectively. Treatment consisted of immediate administration of intravenous acyclovir and a lung-protective ventilation strategy. CONCLUSIONS: Both cases of varicella

  9. Epidemiology of cerebral palsy in Southern Denmark

    DEFF Research Database (Denmark)

    Frøslev-Friis, Christina; Dunkhase-Heinl, Ulrike; Andersen, Johnny Dohn Holmgren

    2015-01-01

    INTRODUCTION: The aim of this study was to describe the prevalence, subtypes, severity and neuroimaging findings of cerebral palsy (CP) in a cohort of children born in Southern Denmark. Risk factors were analysed and aetiology considered. METHODS: A population-based cohort study covering 17...... prevention of CP is possible if the numbers of preterm births and multiple pregnancies can be reduced. FUNDING: The Danish Cerebral Palsy Follow-up Programme is supported by the foundation "Ludvig og Sara Elsass Fond". TRIAL REGISTRATION: 2008-58-0034....

  10. The Mysidacea of the Andaman Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    Press 2002 The Mysidacea of the Andaman Sea S. U. PANAMPUNNAYIL NATIONAL INSTITUTE OF OCEANOGRAPHY, REGIONAL CENTRE, COCHIN ., INDIA E-MAIL: sara@niokochi.org Fifteen species belonging to eight genera were collected from the shallow waters (0–150 m... the distal border of the telson (Figures 2C,D) the middle is longer while in female the apex is slightly expanded and the outer two pairs are longer and subequal (Figures 2E,F). In Hansen’s and Pillai’s speci- mens the middle pair of spines is the longest...

  11. Symposium on Molecular Spectroscopy (40th) Held at Columbus, Ohio on 17-21 June 1985.

    Science.gov (United States)

    1985-06-21

    INFRARED-MICROWAVE SIDEBAND LASER SPECTROSCOPY OF THE v, AND 2v,*v, BANDS OF 1𔃽CHF’ SANG LEE, R. H. SCHWENDEMAN, AND GOTTFRIED MAGERL Approximately...University, Mississippi State, Mississippi 39762 FA6. (9:4 FORCE CONSTANTS FOR THE CYCLOPROPENYL CATION NORMAN C. CRAIG, JULIANTO PRANATA, SARA JAMIE...WHJO RA14 MAESSEN, B.--RFl4, RF15 HEAVEN, M. C. --MG7, MG8, MG9, KENNY,’ J. E.--MF9, M[FlO, M_7l1 MAGERL, GOTTFRIED --RF5 Presiding over Session MG

  12. The unattainable attempt to avoid the casus irreducibilis for cubic equations Gerolamo Cardano's De Regula Aliza

    CERN Document Server

    Confalonieri, Sara

    2015-01-01

    Sara Confalonieri presents an overview of Cardano's mathematical treatises and, in particular, discusses the writings that deal with cubic equations. The author gives an insight into the latest of Cardano's algebraic works, the De Regula Aliza (1570), which displays the attempts to overcome the difficulties entailed by the casus irreducibilis. Notably some of Cardano's strategies in this treatise are thoroughly analyzed. Far from offering an ultimate account of De Regula Aliza, by one of the most outstanding scholars of the 16th century, the present work is a first step towards a better understanding.

  13. International Migration, US Immigration Law and Civil Society: From the Pre-Colonial Era to the 113th Congress (Edited by Leonir Mario Chiarello and Donald Kerwin, Scalabrini International Migration Network, 2014

    Directory of Open Access Journals (Sweden)

    Breana George

    2014-09-01

    Full Text Available International Migration, US Immigration Law and Civil Society: From the Pre-Colonial Era to the 113th Congress, published by the Scalabrini International Migration Network in collaboration with the Center for Migration Studies of New York, offers an overview of immigration law and policy that contextualizes the present challenges in reaching policy consensus in the immigration debate. This book review highlights the debate on executive action in relation to a chapter on the evolution of US immigration laws by Charles Wheeler and a chapter on the role of civil society in immigration policymaking by Sara Campos. 

  14. Location-based games

    DEFF Research Database (Denmark)

    Ejsing-Duun, Stine

    In this dissertation, it is explored which prerequisites are necessary in location-based games (LBGs) to make meaningful the meeting between players and spatiality with an emphasis on physical locations. Throughout the dissertation, it has been shown that LBGs affect players’ perception of and be...... possible. The practical contribution is my creation of the LBG Visions of Sara. People continue to play this game in Odense more than two years after its launch, and DJEEO uses it as a showcase, enabling the company to sell similar LBGs....

  15. Shameful Separations and Embarrassing Proximities

    DEFF Research Database (Denmark)

    Frederiksen, Maja Bissenbakker

    2012-01-01

    state of the subject or a mere social construct, this thinking enables an understanding of shame as performative acts that constitute the very positions that a subject may occupy and experience. Using examples from the on-going Danish debate on prostitution, the article suggests an analysis of “what...... structures, and when does it stigmatize the sex workers whom the speakers purport to protect? Inspired by Sara Ahmed’s work on affect, the article concludes that shame can play interestingly together with activist strategies when its ability to “stick” certain subject positions and subject matters together...

  16. Love Without Borders?

    DEFF Research Database (Denmark)

    Bissenbakker, Mons; Myong, Lene

    2016-01-01

    the idealized version of love promoted by LWB happened to take the form of romantic intimacy predominantly consisting of straight, young and white-brown couples oriented towards reproduction. Our main argument is that despite its good intentions of supporting migration the activist campaign ‘Love without...... and to the political system in ways that sustain white hegemony. Building mainly on Sara Ahmed's and Laurent Berlant's reflections on love as cultural politics the article analyzes posters, viral videos and newspaper debates in its discussion of the promises and pitfalls of love as an affective political tool....

  17. El Sistema inspirerede projekter

    DEFF Research Database (Denmark)

    Holst, Finn; Chemi, Tatiana

    Rapporten er resultat af pilotprojektet ”Forundersøgelse El Sistema DK” gennemført af Ph.D. Finn Holst (DPU, Aarhus Universitet) og Ph.D. Tatiana Chemi (Aalborg Universitet) i 2015. I rapporten indgår desuden bidrag fra Sofie Holm, Sara Fink Søndergaard og Stine Møgelbjerg Johansen. Pilotprojektet...... er gennemført for DMKLs El Sistema-udvalg med støtte fra Statens Kunstfond, Projektstøtteudvalget for Musik....

  18. Strange culinary cncounters:

    DEFF Research Database (Denmark)

    Leer, Jonatan; Kjær, Katrine Meldgaard

    Strange Culinary Encounters: Stranger Fetishism in Cooking Shows In this paper, we will examine the ways in which the encountering of 'other' food cultures is played out in the two travelogue cooking shows Gordon's Great Escape and Jamie's Italian Escape, arguing that despite their ‘noble......’ intentions and ‘enlightened’ cosmopolitan approach to meeting the other (culinary culture), ultimately, Jamie and Gordon's respective culinary adventures work to create a social hierarchy in their own favor. Inspired by Sara Ahmed’s work on stranger fetishism, we will investigate how the two protagonist...

  19. Progress report of the nuclear physics department

    International Nuclear Information System (INIS)

    1987-01-01

    This progress report presents the experiments and the technological studies carried out at the Nuclear Physics Department of Saclay from October 1, 1985 to September 30, 1986. These studies concern the structure of nuclei, the nuclear reaction mechanisms and, more and more, mesic processes in nuclear dynamics. The experiments have been carried at the 700 MeV electron linac, the synchrotron SATURNE, the heavy ion accelerator GANIL, the SARA facility at Grenoble. An important technical activity has been devoted to the construction of the supraconducting booster of the 9 MV tandem [fr

  20. Talking about Life

    Science.gov (United States)

    Impey, Chris

    2010-08-01

    Preface; Part I. Introduction Timothy Ferris, Iris Fry, Steven Dick, Ann Druyan, Pinky Nelson, Neil Tyson, Steve Benner and William Bains; Part II. Earth Roger Buick, Lynn Rothschild, John Baross, Joe Kirschvink, Andrew Knoll, Simon Conway Morris, Roger Hanlon and Lori Marino; Part III. Solar System Chris McKay, David Grinspoon, Jonathan Lunine, Carolyn Porco, Laurie Leshin, Guy Consolmagno and Peter Smith; Part IV. Exoplanets Alan Boss, Geoff Marcy, Debra Fischer, Sara Seager, David Charbonneau and Vikki Meadows; Part V. Frontiers Jill Tarter, Seth Shostak, Ray Kurzweil, Nick Bostrom, Paul Davies, Martin Rees, Ben Bova and Jennifer Michael Hecht; Reading list; Glossary; Index.

  1. Automated accountability of hazardous materials at AlliedSignal Inc., Kansas City Division

    International Nuclear Information System (INIS)

    Depew, P.L.

    1993-12-01

    The Department of Energy's (DOE) Kansas City Plant (KCP), currently operated by AlliedSignal Inc. has developed a comprehensive Hazardous Material Information System (HMIS). The purpose of this system is to provide a practical and automated method to collect, analyze and distribute hazardous material information to DOE, KCP associates, and regulatory agencies. The drivers of the HMIS are compliance with OSHA Hazard Communications, SARA reporting, pollution prevention, waste minimization, control and tracking of hazards, and emergency response. This report provides a discussion of this system

  2. Oculomotor and Vestibular Findings in Gaucher Disease Type 3 and Their Correlation with Neurological Findings

    Directory of Open Access Journals (Sweden)

    Tatiana Bremova-Ertl

    2018-01-01

    Full Text Available ObjectivesTo evaluate the function of the oculomotor and vestibular systems and to correlate these findings with the clinical status of patients with Gaucher disease type 3 (GD3. The goal of this cross-sectional and longitudinal study was to find oculomotor biomarkers for future clinical trials.MethodsTwenty-six patients with GD3 were assessed for eligibility and 21 were able to perform at least one task. Horizontal and vertical reflexive saccades, smooth pursuit, gaze-holding, optokinetic nystagmus, and horizontal vestibulo-ocular reflex (VOR were examined by video-oculography/video-head impulse test and compared concurrently with 33 healthy controls. The Scale for the Assessment and Rating of Ataxia (SARA, the modified Severity Scoring Tool (mSST, and Grooved Pegboard Test (GPT were administered to assess overall neurological function. Eleven patients were also re-assessed after 1 year.ResultsNine out of 17 patients exhibited gaze-holding deficits. One patient had upbeat nystagmus. Three patients presented with bilateral abducens palsy in combination with central oculomotor disorders, suggesting a bilateral involvement of the abducens nucleus. Horizontal angular VOR gain was reduced in all patients (0.66 ± 0.37 compared with controls (1.1 ± 0.11, p < 0.001. Most strongly correlated with clinical rating scales were peak velocity of downward saccades (SARA: ρ = −0.752, p < 0.0005; mSST: ρ = −0.611, p = 0.003; GPT: ρ = −0.649, p = 0.005 and duration of vertical saccades (SARA: ρ = 0.806, p < 0.001; mSST: ρ = 0.700, p < 0.0005; GPT: ρ = 0.558, p = 0.02 together with the VOR gain (SARA: ρ = −0.63, p = 0.016; mSST: ρ = −0.725, p = 0.003; GPT: ρ = −0.666, p = 0.004. Vertical smooth pursuit gain decreased significantly at follow-up.InterpretationThis study shows neuronal degeneration of the brainstem and cerebellum with combined involvement of

  3. Research Implementation and Quality Assurance Project Plan: An Evaluation of Hyperspectral Remote Sensing Technologies for the Detection of Fugitive Contamination at Selected Superfund Hazardous Waste Sites

    Science.gov (United States)

    Slonecker, E. Terrence; Fisher, Gary B.

    2009-01-01

    This project is a research collaboration between the U.S. Environmental Protection Agency (EPA) Office of Inspector General (OIG) and the U.S. Geological Survey (USGS) Eastern Geographic Science Center (EGSC), for the purpose of evaluating the utility of hyperspectral remote sensing technology for post-closure monitoring of residual contamination at delisted and closed hazardous waste sites as defined under the Comprehensive Environmental Response Compensation and Liability Act [CERCLA (also known as 'Superfund')] of 1980 and the Superfund Amendments and Reauthorization Act (SARA) of 1986.

  4. Avgang 2017: Don Giovanni i Operaen

    OpenAIRE

    2017-01-01

    Opera av W.A. Mozart, med våre MA-studenter og gjester. Medvirkende: Dagfinn Andersen (MA2), Emil Havold Næshagen (MA1), Hanne Korsbrekke Askeland (MA2), Nora Oleanne Sårheim (MA2?), Sara Aasen (MA2), Marcela Randem (MA1), Eilert Hasseldal (MA1). Gjester: Eirik Grøtvedt, Per Lindström, Pavels Trofimiks. Kostymer: Fredrik Straum Floen. Dessuten medvirker kor (NMH), strykere (Ensemble Allegri) og blåsere (Stabsmusikken i Oslo)

  5. Reviews of recent publications

    Directory of Open Access Journals (Sweden)

    1994-06-01

    Full Text Available Bjornson, Richard. The African Quest for Freedom and Identity: Cameroonian Writing and the National Experience by Thomas A. Hale Cixous, Hélène. 'Coming to Wrting' and Other Essays by Randi Brox Birn Derwin, Susan. The Ambivalence of Form: Lukacs, Freud, and the Novel by Eva L. Corredor Kaminsky, Amy K. Reading the Body Politic: Feminist Criticism and Latin American Women Writers by Naomi Lindstrom Nägele, Rainer. Theater, Theory, Speculation: Walter Benjamin and the Scenes of Modernity by Alice A. Kuzniar Tomlinson, John. Cultural Imperialism by Michael Filcher Weisberg, Richard. Poethics and Other Strategies of Law and Literature by Sara B. Blair

  6. Representasi Budaya Popular dalam Video Parodi Jokowi-Ahok di Youtube Selama Pemilukada DKI Jakarta 2012

    OpenAIRE

    Wulansari, Amalia Ayu; Lukmantoro, Triyono; Hasfi, Nurul

    2013-01-01

    Representation of Popular Culture in Jokowi-Ahok's Video Parodyson Youtube During Pemilukada DKI Jakarta 2012AbstractPemilukada DKI Jakarta 2012 was marked by the rise of videos that related toGovernor and Vice Governor candidates of DKI Jakarta 2012 on internet mediaYoutube, such as videos which is purposely made for campaign, or videos withSARA (etnic, religion, race and inter-group) issue, that attack one of the pair'scabdidates. The interesting point is videos made by partisipants and vol...

  7. GOLD and the fixed ratio

    Directory of Open Access Journals (Sweden)

    Vestbo J

    2012-09-01

    Full Text Available Jørgen VestboUniversity of Manchester, Manchester, UKI read with interest the paper entitled "Diagnosis of airway obstruction in the elderly: contribution of the SARA study" by Sorino et al in a recent issue of this journal.1 Being involved in the Global Initiative for Obstructive Lung Diseases (GOLD, it is nice to see the interest sparked by the GOLD strategy document. However, in the paper by Sorino et al, there are a few misunderstandings around GOLD and the fixed ratio (forced expiratory volume in 1 second/forced volume vital capacity < 0.70 that need clarification.View original paper by Sorino and colleagues.

  8. The prevalence and causes of decreased visual acuity – a study based on vision screening conducted at Enukweni and Mzuzu Foundation Primary Schools, Malawi

    OpenAIRE

    Thom L; Jogessar S; McGowan SL; Lawless F

    2016-01-01

    Leaveson Thom,1 Sanchia Jogessar,1,2 Sara L McGowan,1 Fiona Lawless,1,2 1Department of Optometry, Mzuzu University, Mzuzu, Malawi; 2Brienholden Vision Institute, Durban, South Africa Aim: To determine the prevalence and causes of decreased visual acuity (VA) among pupils recruited in two primary schools in Mzimba district, northern region of Malawi.Materials and methods: The study was based on the vision screening which was conducted by optometrists at Enukweni and Mzuzu Foundation Primary Sc...

  9. The prevalence and causes of decreased visual acuity – a study based on vision screening conducted at Enukweni and Mzuzu Foundation Primary Schools, Malawi

    OpenAIRE

    Thom,Leaveson; Jogessar,Sanchia; McGowan,Sara L; Lawless,Fiona

    2016-01-01

    Leaveson Thom,1 Sanchia Jogessar,1,2 Sara L McGowan,1 Fiona Lawless,1,2 1Department of Optometry, Mzuzu University, Mzuzu, Malawi; 2Brienholden Vision Institute, Durban, South Africa Aim: To determine the prevalence and causes of decreased visual acuity (VA) among pupils recruited in two primary schools in Mzimba district, northern region of Malawi.Materials and methods: The study was based on the vision screening which was conducted by optometrists at Enukweni and Mzuzu Foundation Primary Sc...

  10. Development, characterization, and skin delivery studies of related ultradeformable vesicles: transfersomes, ethosomes, and transethosomes

    OpenAIRE

    Ascenso, Andreia; Raposo, Sara; Batista, Cátia; Cardoso, Pedro; Mendes, Tiago; Praça, Fabíola Garcia; Bentley, Maria Vitória Lopes Badra; Simões, Sandra

    2015-01-01

    Andreia Ascenso,1 Sara Raposo,1 Cátia Batista,2 Pedro Cardoso,2 Tiago Mendes,2 Fabíola Garcia Praça,3 Maria Vitória Lopes Badra Bentley,3 Sandra Simões1 1Instituto de Investigação do Medicamento (iMed.ULisboa), 2Faculdade de Farmácia, Universidade de Lisboa, Lisboa, Portugal; 3Faculdade de Ciências Farmacêuticas de Ribeirão Preto, Universidade de São Paulo, Monte ...

  11. Progress report of the nuclear physics department

    International Nuclear Information System (INIS)

    1986-01-01

    This progress report presents the experiments and the technological studies carried out at the Nuclear Physics Department of Saclay from October 1, 1984 to September 30, 1985. These studies concern the structure of nuclei, the nuclear reaction mechanisms and, more and more, mesic processes in nuclear dynamics. The experiments have been carried at the 700 MeV electron linac, the synchrotron SATURNE, the heavy ion accelerator GANIL, the SARA facility at Grenoble, and the antiproton beams at CERN. An important technical activity has been devoted to the construction of the supraconducting booster of the 9 MV tandem [fr

  12. Nova Talenta: 2014-2015

    OpenAIRE

    Aguilera Velandia, Mónica Natalia; Álvarez Rodríguez, María Isabel; Báez Millán, Christian Danilo; Cuestas Díaz, Andrea Patricia; Escobar Campos, Lina Marcela; Galindo Londoño, Ana María; García Sierra, María Camila; García, Lina María; Jaramillo Barrios, María Paola; Mesa Torres, Karen Eliana; Mora Barrero, Daniel; Morales Morales, Ángela Beatriz; Moreno, Ana María; Naranjo Pinilla, Juan Sebastian; Ochoa Rodríguez, Ángela Marcela

    2015-01-01

    Contenido Introducción 1. Inteligencia emocional, liderazgo transformacional y género: factores que influencian el desempeño organizacional / Ana María Galindo Londoño, Sara Urrego Mayorga; Director: Juan Carlos Espinosa Méndez. 2. El rol de la mujer en el liderazgo / Andrea Patricia Cuestas Díaz; Directora: Francoise Venezia Contreras Torres. 3. Liderazgo transformacional, clima organizacional, satisfacción laboral y desempeño. Una revisión de la literatura / Juliana Restrepo O...

  13. Early Life Processes, Endocrine Mediators, and Number of Susceptible Cells in Relation to Breast Cancer Risk

    Science.gov (United States)

    2011-04-01

    maternal and fetal adrenal glands are enzymatically converted in the placenta to androstene- dione and testosterone, which are then aromatized to...androgens). The attenu- ation in the group differences for estriol with androstene- dione in the model could also result if androstenedione was...Jianjun Liu2, Rulla M Tamimi3,4, Sara Lindström5, David J Hunter3, Celine M Vachon6, Fergus J Couch7, Christopher G Scott6, Pagona Lagiou4,8, Per Hall1

  14. Lección clínica ortopédica

    OpenAIRE

    Leiva Pereira, Lisandro

    2011-01-01

    Historia Clínica N° 14247Servicio de Ortopedia y Cirugía de Urgencia.Sala de Mujeres.Lección clínica dictada por el Profesor L. Leyva Pereira el 23 dejunio de 1.939. (Version taquigráfica de la señorita Sara Elvia Calderón, mecano-tuquígrafa de dicha Clínica)."Nombre de la enferma : Leonor Peña.Edad: 60 afios.Estado civil: Viuda.Entró al servicio el 28 de diciembre de 1938.Antecedentes personales y hereditarios : Sin importancia.

  15. A new method for the automatic calculation of prosody

    International Nuclear Information System (INIS)

    GUIDINI, Annie

    1981-01-01

    An algorithm is presented for the calculation of the prosodic parameters for speech synthesis. It uses the melodic patterns, composed of rising and falling slopes, suggested by G. CAELEN, and rests on: 1. An analysis into units of meaning to determine a melodic pattern 2. the calculation of the numeric values for the prosodic variations of each syllable; 3. The use of a table of vocalic values for the three parameters for each vowel according to the consonantal environment and of a table of standard duration for consonants. This method was applied in the 'SARA' program of synthesis with satisfactory results. (author) [fr

  16. Synteny of human chromosomes 14 and 15 in the platyrrhines (Primates, Platyrrhini)

    Science.gov (United States)

    2009-01-01

    In order to study the intra- and interspecific variability of the 14/15 association in Platyrrhini, we analyzed 15 species from 13 genera, including species that had not been described yet. The DNA libraries of human chromosomes 14 and 15 were hybridized to metaphases of Alouatta guariba clamitans, A. caraya, A. sara, Ateles paniscus chamek, Lagothrix lagothricha, Brachyteles arachnoides, Saguinus midas midas, Leontopithecus chrysomelas, Callimico goeldii, Callithrix sp., Cebus apella, Aotus nigriceps, Cacajao melanocephalus,Chiropotes satanas and Callicebus caligatus. The 14/15 hybridization pattern was present in 13 species, but not in Alouatta sara that showed a 14/15/14 pattern and Aotus nigriceps that showed a 15/14/15/14 pattern. In the majority of the species, the HSA 14 homologue retained synteny for the entire chromosome, whereas the HSA 15 homologue displayed fragmented segments. Within primates, the New World monkeys represent the taxon with the highest variability in chromosome number (2n = 16 to 62). The presence of the HSA 14/15 association in all species and subspecies studied herein confirms that this association is the ancestral condition for platyrrhines and that this association has been retained in most platyrrhines, despite the occurrence of extensive inter- and intrachromosomal rearrangements in this infraorder of Primates. PMID:21637455

  17. Environmental compliance at U.S. Department of Energy FUSRAP (Formerly Utilized Sites Remedial Action Program) sites

    International Nuclear Information System (INIS)

    Liedle, S.D.; Clemens, B.W.

    1988-01-01

    With the promulgation of the Superfund Amendments and Reauthorization Act (SARA), federal facilities were required to comply with the Comprehensive Environmental Response Compensation and Liability Act (CERCLA) in the same manner as any non-government entity. This presented challenges for the Department of Energy (DOE) and other federal agencies involved in remedial action work because there are many requirements under SARA that overlap other laws requiring DOE compliance, e.g., the National Environmental Policy Act (NEPA). This paper outlines the options developed to comply with CERCLA and NEPA as part of active, multi-site remedial action program. The program, the Formerly Utilized Sites Remedial Action Program (FUSRAP), was developed to identify, clean up, or control sites containing residual radioactive or chemical contamination as a result of the nation's early development of nuclear power. During the Manhattan Project, uranium was extracted from ores and resulted in mill concentrates, purified metals, and waste products that were transported for use or disposal at other locations. Figure 1 shows the steps for producing uranium metal during the Manhattan Project. As a result of these activities materials, equipment, buildings, and land became contaminated, primarily with naturally occurring radionuclides. Currently, FUSRAP includes 29 sites; three are on the Environmental Protection Agency's (EPA's) National Priorities List (NPL) of hazardous waste sites

  18. Defining the Core Genome of Salmonella enterica Serovar Typhimurium for Genomic Surveillance and Epidemiological Typing

    Science.gov (United States)

    Fu, Songzhe; Octavia, Sophie; Tanaka, Mark M.; Sintchenko, Vitali

    2015-01-01

    Salmonella enterica serovar Typhimurium is the most common Salmonella serovar causing foodborne infections in Australia and many other countries. Twenty-one S. Typhimurium strains from Salmonella reference collection A (SARA) were analyzed using Illumina high-throughput genome sequencing. Single nucleotide polymorphisms (SNPs) in 21 SARA strains ranged from 46 to 11,916 SNPs, with an average of 1,577 SNPs per strain. Together with 47 strains selected from publicly available S. Typhimurium genomes, the S. Typhimurium core genes (STCG) were determined. The STCG consist of 3,846 genes, a set that is much larger than that of the 2,882 Salmonella core genes (SCG) found previously. The STCG together with 1,576 core intergenic regions (IGRs) were defined as the S. Typhimurium core genome. Using 93 S. Typhimurium genomes from 13 epidemiologically confirmed community outbreaks, we demonstrated that typing based on the S. Typhimurium core genome (STCG plus core IGRs) provides superior resolution and higher discriminatory power than that based on SCG for outbreak investigation and molecular epidemiology of S. Typhimurium. STCG and STCG plus core IGR typing achieved 100% separation of all outbreaks compared to that of SCG typing, which failed to separate isolates from two outbreaks from background isolates. Defining the S. Typhimurium core genome allows standardization of genes/regions to be used for high-resolution epidemiological typing and genomic surveillance of S. Typhimurium. PMID:26019201

  19. Synteny of human chromosomes 14 and 15 in the platyrrhines (Primates, Platyrrhini).

    Science.gov (United States)

    Gifalli-Iughetti, Cristiani; Koiffmann, Célia P

    2009-10-01

    In order to study the intra- and interspecific variability of the 14/15 association in Platyrrhini, we analyzed 15 species from 13 genera, including species that had not been described yet. The DNA libraries of human chromosomes 14 and 15 were hybridized to metaphases of Alouatta guariba clamitans, A. caraya, A. sara, Ateles paniscus chamek, Lagothrix lagothricha, Brachyteles arachnoides, Saguinus midas midas, Leontopithecus chrysomelas, Callimico goeldii, Callithrix sp., Cebus apella, Aotus nigriceps, Cacajao melanocephalus,Chiropotes satanas and Callicebus caligatus. The 14/15 hybridization pattern was present in 13 species, but not in Alouatta sara that showed a 14/15/14 pattern and Aotus nigriceps that showed a 15/14/15/14 pattern. In the majority of the species, the HSA 14 homologue retained synteny for the entire chromosome, whereas the HSA 15 homologue displayed fragmented segments. Within primates, the New World monkeys represent the taxon with the highest variability in chromosome number (2n = 16 to 62). The presence of the HSA 14/15 association in all species and subspecies studied herein confirms that this association is the ancestral condition for platyrrhines and that this association has been retained in most platyrrhines, despite the occurrence of extensive inter- and intrachromosomal rearrangements in this infraorder of Primates.

  20. Individualized exergame training improves postural control in advanced degenerative spinocerebellar ataxia: A rater-blinded, intra-individually controlled trial.

    Science.gov (United States)

    Schatton, Cornelia; Synofzik, Matthis; Fleszar, Zofia; Giese, Martin A; Schöls, Ludger; Ilg, Winfried

    2017-06-01

    Treatment options are rare in degenerative ataxias, especially in advanced, multisystemic disease. Exergame training might offer a novel treatment strategy, but its effectiveness has not been investigated in advanced stages. We examined the effectiveness of a 12-week home-based training with body-controlled videogames in 10 young subjects with advanced degenerative ataxia unable or barely able to stand. Training was structured in two 6-weeks phases, allowing to adapt the training according to individual training progress. Rater-blinded clinical assessment (Scale for the Assessment and Rating of Ataxia; SARA), individual goal-attainment scoring (GAS), and quantitative movement analysis were performed two weeks before training, immediately prior to training, and after training phases 1 and 2 (intra-individual control design). This study is registered with ClinicalTrials.gov, NCT02874911). After intervention, ataxia symptoms were reduced (SARA -2.5 points, p training (p = 0.04). Goal attainment during daily living was higher than expected (GAS: 0.45). Movement analysis revealed reduced body sway while sitting (p training-induced improvements in posture control mechanisms. This study provides first evidence that, even in advanced stages, subjects with degenerative ataxia may benefit from individualized training, with effects translating into daily living and improving underlying control mechanisms. The proposed training strategy can be performed at home, is motivating and facilitates patient self-empowerment. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. ТHE TREASURE OF MACEDONIA THE ETHNO - SOCIAL AND CULTURAL – HISTORICAL TOURISTIC MOTIVES IN THE SHAR – POLOG REGION

    Directory of Open Access Journals (Sweden)

    Jagoda Jankovska

    2013-07-01

    Full Text Available Macedonia is a country rich in natural and cultural heritage, which makes it extremely interesting as a tourist destination. There is almost no place that is not marked by cultural characteristics and natural beauty. All this makes Macedonia a unique touristic place. In the abundance of cultural diversity, Sara-Polog region offers an amazing mix of ethno-social, cultural and historical motifs that are not sufficiently studied, but can very easily contribute to greater tourism development in Macedonia. The main aim of this Paper is to identify and describe the cultural, historical andethno-social values of Sara-Polog Region, as a precondition for tourismdevelopment not only in the region, but in Macedonia as well. The research was done using the precise scientific methodology, especially: analysis and synthesis, and the genetic-evolutionary, the historical and the comparative method. The research done led to the conclusion that this attractivemulti-ethnicarea is extremely rich withdifferent ethno dresses, songs, art, traditional music instruments and dances, customs, religious buildings and houses, are enriching the touristic offer in Macedonia.

  2. Bioremediation of soils contaminated by hydrocarbons at the coastal zone of “Punta Majagua”.

    Directory of Open Access Journals (Sweden)

    Jelvys Bermúdez Acosta

    2012-03-01

    Full Text Available The purpose of this research was to describe and assess the main results in the process of bioremediation of 479 m3 of petroleum residuals spilled on the soil and restrained into four deposits of fuel on the coastal zone of “Punta Majagua”, Cienfuegos. The volume of hydrocarbons spilled and contained into the tanks was determined by means of their previous mixture with fertile ground in a ratio of 3/1. The hydrocarbons were disposed in a bioremediation area of 115 m X 75m built in situ. In turn 54, 5 m3 of BIOIL - FC were applied, which were fermented in an industrial bioreactor of 12000 L. An initial sampling was carried out registering values of total hydrocarbons (HTP higher than 41880 mg/kg, with high concentrations of Saturated hydrocarbons, aromatics, resins, asphaltens (SARA. Three subsequent samples were taken with a sampling interval of 0, 45, 90 and 120 days of the application. An average concentration of 1884.57 mg/kg of total hydrocarbons was obtained at 120 days with an average removal rate of 94.8%, moreover values of 94.6%, 90.78%, 86.99% y 79.9% of SARA were respectively reported.

  3. Preliminary data report of investigations conducted at the Salmon Site, Lamar County, Mississippi

    International Nuclear Information System (INIS)

    1994-04-01

    The US Department of Energy (DOE) conducted ecological studies at the Salmon Site (SS), Lamar County, Mississippi, from the middle of June 1992 to the end of April 1993. The studies are part of the Remedial Investigation and Feasibility Study (RI/FS) being conducted by the DOE. The RI/FS is the methodology under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980, as amended by the Superfund Amendments and Reauthorization Act of 1986 (CERCLA/SARA) for evaluating hazardous waste sites on the National Priorities List (NPL). The Salmon Site is not listed on the NPL but DOE has voluntarily elected to conduct the evaluation of the SS in accordance with CERCLA/SARA. As part of the remedial investigation, baseline human health and ecological risk assessments will be conducted. These baseline risk assessments will evaluate the potential impact on human health and the environment if remedial actions are not conducted, identify locations where additional information needs to be collected, help determine whether remedial actions are necessary, and provide justification for performing remedial actions. This report describes the sampling activities conducted between February and April 1993 to aid in evaluating the possible environmental impacts at the SS tailored to the specific circumstances and conditions found there. The initial investigations included identification of the flora and fauna in and around the SS, with particular emphasis on identifying sensitive environments, endangered species and their habitats, and those species consumed by humans or found in human food chains

  4. KEKUASAAN SIMBOLIK DALAM WACANA POLITIK DI MEDIA CETAK

    Directory of Open Access Journals (Sweden)

    Lilik Wahyuni

    2008-12-01

    Full Text Available As a social practice, language is used to persuade, influence, argue, refuse, maintain, and to response one’s reaction. Using language, one may practically pro- duce and reproduce authority. This article deals with the symbolic fight and the mechanism of symbolic force within politics discourse in written media. The analy- sis technique used is critical discourse analysis, especially in the interaction be- tween language and social structure. The result shows that the symbolic fight in the written media represents the practice of continuing the doxa by the orthodoxa group and of attacking it by the heterodoxa group. The strategies of fighting the doxa are by showing the orthodoxa group’s weaknesses, arousing the enmity within the group, comparing the orthodoxa group to others, and by using SARA and com- munity issues. The mechanism of the symbolic force used by the ortodoxa is the use of euphemism and censor.   Key words: kekuasaan simbolik, doxa, orthodoxa, SARA, dan wacana politik.

  5. Synteny of human chromosomes 14 and 15 in the platyrrhines (Primates, Platyrrhini

    Directory of Open Access Journals (Sweden)

    Cristiani Gifalli-Iughetti

    2009-01-01

    Full Text Available In order to study the intra- and interspecific variability of the 14/15 association in Platyrrhini, we analyzed 15 species from 13 genera, including species that had not been described yet. The DNA libraries of human chromosomes 14 and 15 were hybridized to metaphases of Alouatta guariba clamitans, A. caraya, A. sara, Ateles paniscus chamek, Lagothrix lagothricha, Brachyteles arachnoides, Saguinus midas midas, Leontopithecus chrysomelas, Callimico goeldii, Callithrix sp., Cebus apella, Aotus nigriceps, Cacajao melanocephalus, Chiropotes satanas and Callicebus caligatus. The 14/15 hybridization pattern was present in 13 species, but not in Alouatta sara that showed a 14/15/14 pattern and Aotus nigriceps that showed a 15/14/15/14 pattern. In the majority of the species, the HSA 14 homologue retained synteny for the entire chromosome, whereas the HSA 15 homologue displayed fragmented segments. Within primates, the New World monkeys represent the taxon with the highest variability in chromosome number (2n = 16 to 62. The presence of the HSA 14/15 association in all species and subspecies studied herein confirms that this association is the ancestral condition for platyrrhines and that this association has been retained in most platyrrhines, despite the occurrence of extensive inter- and intrachromosomal rearrangements in this infraorder of Primates.

  6. Food as a linking device among the Guidar of North Cameroon La nourriture comme lien entre Guidar du nord-Cameroun

    Directory of Open Access Journals (Sweden)

    Forka Leypey Mathew Fomine

    2009-07-01

    Full Text Available This article elucidates and illuminates food as a powerful device that established and strengthened cultural and commercial relationships among the Guidar of North Cameroon and between the Guidar and their neighbouring ethnic groups. During cultural ceremonies such as traditional wedding, death celebration, funeral entertainment, naming ceremony and group circumcision, the Guidar collectively consumed diverse food items that established and cemented cultural relationships among them. Food also aided in establishing commercial relationships between the Guidar and Moundang, Massa, Tupuri, Bamileke from Cameroon and the Sara from the Republic of Chad.Cet article montre le pouvoir instrumental alimentaire qui établit et renforce les relations culturelles et commerciales parmi les peuples Guidar du nord-Cameroun et différentes entités ethniques voisines. Durant les cérémonies traditionnelles telles que les mariages, les funérailles, les circoncisions en groupes, les peuples Guidar collectivement consomment un large éventail de produits alimentaires qui établissent et renforcent les relations culturelles. La nourriture également favorise l’établissement de relations commerciales entre les peuples Guidar, Moundang, Massa, Toupouri, Bamileke et les peuples Sara de la République du Tchad.

  7. Persepsi mahasiswa terhadap kemunculan berita bohong di media sosial

    Directory of Open Access Journals (Sweden)

    Totok Suyanto

    2018-06-01

    Full Text Available Di era demokratisasi saat ini yang bercirikan adanya kebebasan berpendapat setiap warga baik secara lisan ataupun tertulis, maka fenomena hoax menjadi satu hal yang harus menjadi perhatian bersama. Desain penelitian yang digunakan adalah penelitian survey. Proses penyebaran berita dalam media sosial banyak melibatkan kaum perempuan. Hanya sebagian kecil saja yang mengakui sering mendapatkan berita-berita hoax tentang suku, agama, ras, dan antar golongan (SARA. Dengan demikian, maraknya penyebaran berita hoax di media sosial merupakan satu bentuk pembodohan masyarakat dan  respons terhadap kemunculan berita hoax dengan cara melakukan tindakan perlawanan. ----------------------------------------------------------------------------------------------------------------------------- In this democratization era characterized by the freedom of speech belongs to every citizen both written and spoken, the hoax should be considered seriously. It was a survey research. The spread of news through social media was conducted mostly by women. It was only small numbers who reported that they had received hoax relating SARA. Therefore, the spreading of hoax through social media is a kind of fooling and their response is through counter-narrative.

  8. A perspective of PC-based probabilistic risk assessment

    International Nuclear Information System (INIS)

    Sattison, M.B.; Rasmuson, D.M.; Robinson, R.C.; Russell, K.D.; Van Siclen, V.S.

    1987-01-01

    Probabilistic risk assessment (PRA) information has been under-utilized in the past due to the large effort required to input the PRA data and the large expense of the computers needed to run PRA codes. The microcomputer-based Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) System, under development at the Idaho National Engineering Laboratory, have greatly enhanced the ability of managers to use PRA techniques in their decision-making. IRRAS is a tool that allows an analyst to create, modify, update, and reanalyze a plant PRA to keep the risk assessment current with the plant's configuration and operation. The SARA system is used to perform sensitivity studies on the results of a PRA. This type of analysis can be used to evaluate proposed changes to a plant or its operation. The success of these two software projects demonstrate that risk information can be made readily available to those that need it. This is the first step in the development of a true risk management capability

  9. Stakeholder views of superfund sites

    International Nuclear Information System (INIS)

    English, M.R.

    1992-01-01

    Nearly ten years have passed since the enactment of the federal Comprehensive Response, Compensation, and Liability Act (CERCLA), usually referred to as open-quotes Superfundclose quotes. Nearly four years have passed since CERCLA's major overhaul through the Superfund Amendments and Reauthorization Act (SARA). Although much still remains to be done under Superfund, there is now enough experience to assess how effectively it is working. A study being undertaken by the University of Tennessee's Waste Management Research and Education Institute will supply a portion of that assessment. The study was completed in the fall of 1990. Our study examines two related issues: the resources that will be needed in the coming years to fulfill the mandate of Superfund and other hazardous waste remediation programs, and the site-level experience to date in implementing CERCLA and SARA. This chapter discusses only the open-quotes site-level experienceclose quotes effort, and only its methodological approach. The purpose of the open-quotes site-level experienceclose quotes effort is to explore what counts as a open-quotes successfulclose quotes site in the eyes of different stakeholders in a Superfund cleanup - e.g., the affected community, the potentially responsible parties (PRPs), state and local officials, and the US Environmental Protection Agency (EPA)

  10. FUSRAP adapts to the amendments of Superfund

    International Nuclear Information System (INIS)

    Atkin, R.G.; Liedle, S.D.; Clemens, B.W.

    1988-01-01

    With the promulgation of the Superfund Amendments and Reauthorization Act (SARA) federal facilities were required to comply with the Comprehensive Environmental Response Compensation and Liability Act (CERCLA) in the same manner as any non-government entity. This situation presented challenges for the Department of Energy (DOE) and other federal agencies involved in remedial action work because of the requirements under SARA that overlap other laws requiring DOE compliance, e.g., the National Environmental Policy Act (NEPA). This paper outlines options developed to comply with CERCLA and NEPA as part of an active, multi-site remedial action program. The program, the Formerly Utilized Sites Remedial Action Program (FUSRAP), was developed to identify, clean up, or control sites containing residual radioactive contamination resulting from the nation's early development of nuclear power. During the Manhattan Project, uranium was extracted from domestic and foreign ores and resulted in mill concentrates, purified metals, and waste products that were transported for use or disposal at other locations. Figure 1 shows the steps for producing uranium metal during the Manhattan Project. As a result of these activities materials equipment, buildings, and land became contaminated, primarily with naturally occurring radionuclides. Currently, FUSRAP includes 29 sites; three are on the Environmental Protection Agency's (EPA's) National Priorities List (NPL) of hazardous waste sites

  11. Behaviour of 14C-sulfadiazine and 14C-difloxacin during manure storage

    International Nuclear Information System (INIS)

    Lamshoeft, Marc; Sukul, Premasis; Zuehlke, Sebastian; Spiteller, Michael

    2010-01-01

    The persistence of sulfadiazine, difloxacin, and their metabolites has been investigated in stored manure. The manure collected from sulfadiazine ( 14 C-SDZ) and difloxacin ( 14 C-DIF) treated pigs contained N-acetylsulfadiazine (Ac-SDZ), 4-hydroxy-SDZ (4-OH-SDZ), and sarafloxacin (SARA) as the main metabolites, respectively along with their parent compounds. Manures were stored separately at 10 o C and 20 o C at various moisture levels. About 96-99% of the radioactivity remained in extractable parent compounds and their metabolites after 150 d of storage. The formation of non-extractable residue and the rate of mineralization were both negligible in manure containing SDZ and DIF. During storage SDZ concentration increased as a result of the deacetylation of Ac-SDZ, whose concentration decreased proportionally. Hence the environmental effects may be underestimated if the parent compound alone is considered for environmental risk assessment. About 11% and 14% of 4-OH-SDZ were lost after 20 and 40 d of storage; thereafter its concentration increased relatively, highlighting hydroxylation of SDZ. DIF degraded very slowly (7% loss after 150 d) during the storage of manure; in contrast the concentration of SARA decreased rapidly (72-90% loss after 150 d). Dilution of manure and storage at higher temperatures for a reasonable period of time enhanced the rate of reactions of SDZ, DIF and their related metabolites.

  12. Chemical structure investigation on SFEF fractions of Dagang vacuum residue

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Z.; Yan, G.; Zhao, S.; Guo, S. [China Univ. of Petroleum, Beijing (China). State Key Laboratory of Heavy Oil Processing; Zhang, Z. [Beijing Aeronautical Technology Research Center, Beijing (China)

    2006-07-01

    One of the most important problems in petroleum chemistry is the molecular structure and composition of heavy oil fractions and its importance in applications pertaining to the recovery, refining, and upgrading of petroleum. This paper presented an investigation into the chemical structure on supercritical fluid extraction and fraction (SFEF) factions of Dagang vacuum residue. Dagang vacuum residue was cut into sixteen fractions and a tailing with SFEF instrument. Then, using a chromatography, all SFEF fractions were further separated into four group compositions, notably saturated hydrocarbons, aromatic hydrocarbons, resins and asphaltenes (SARA). Last, the chemical structure was explored through a thorough analysis of the products from the ruthenium ions-catalyzed oxidation (RICO) reaction of those aromatics, resins and asphaltenes. The paper discussed the experiment in terms of samples and chemicals; supercritical fluid extraction and fraction; SARA separation; and RICO. The results and discussions focused on alkyl side chains attached to aromatic carbon; polymethylene bridges connecting two aromatic units; benzenecarboxylic acids an aromatic units; and others. The study has brought to light useful characterization on covalent molecular structure of two typical SFEF fractions, notably the tenth and fifteen fraction. 17 refs., 6 tabs., 16 figs., 1 appendix.

  13. Towards a Geocognition of Geothermal Energy: an Evolving Research Partnership in South West England

    Science.gov (United States)

    Gibson, H.; Stewart, I. S.; Ledingham, P.

    2017-12-01

    The development and deployment of novel geological technologies in industry often raise anxiety in the public sphere. New technologies are intrinsically unfamiliar, not only to the public, but also to other technical specialists in the field. This can focus conflict and uncertainty around issues that may not actually be problematic, or obscure other issues that may actually warrant closer inspection. An example of an emergent geo-technology that has received little attention in the public or general technical spheres is the introduction of Enhanced Geothermal Power in the UK. In early 2018, a project testing the viability of deep geothermal heat and power will begin in Cornwall, England, and is likely to face contested issues of public perception that have confronted other novel geological technologies, such as Carbon Capture and Storage and hydraulic fracturing. To address concerns about how the UK public will conceptualise this new technology, the Cornish deep geothermal project has developed an innovative partnership between the industry partner operating the test drilling site and a geoscience cognition research partner. That research partner integrates geoscience, cognitive psychology and media communication specialists in a three-year project that will track evolving public perceptions of and community attitudes to geothermal energy; from initial community engagements to the drilling operations and, ultimately, to the operation of the facility. Key in this study will be an exploration of how the industrial partnership impacts and affects the research process as the site testing proceeds, but also how the research process can engage with issues of communication between the industrial partner and the public. Overall, the interdisciplinary research aims to better understand how public/industry partnerships develop and evolve over the lifetime of an active geo-energy project and thereby help inform and improve community-centred geo-communication around novel

  14. Assessment of genetic diversity and phylogenetic relationships of Korean native chicken breeds using microsatellite markers

    Directory of Open Access Journals (Sweden)

    Joo Hee Seo

    2017-10-01

    Full Text Available Objective This study was conducted to investigate the basic information on genetic structure and characteristics of Korean Native chickens (NC and foreign breeds through the analysis of the pure chicken populations and commercial chicken lines of the Hanhyup Company which are popular in the NC market, using the 20 microsatellite markers. Methods In this study, the genetic diversity and phylogenetic relationships of 445 NC from five different breeds (NC, Leghorn [LH], Cornish [CS], Rhode Island Red [RIR], and Hanhyup [HH] commercial line were investigated by performing genotyping using 20 microsatellite markers. Results The highest genetic distance was observed between RIR and LH (18.9%, whereas the lowest genetic distance was observed between HH and NC (2.7%. In the principal coordinates analysis (PCoA illustrated by the first component, LH was clearly separated from the other groups. The correspondence analysis showed close relationship among individuals belonging to the NC, CS, and HH lines. From the STRUCTURE program, the presence of 5 clusters was detected and it was found that the proportion of membership in the different clusters was almost comparable among the breeds with the exception of one breed (HH, although it was highest in LH (0.987 and lowest in CS (0.578. For the cluster 1 it was high in HH (0.582 and in CS (0.368, while for the cluster 4 it was relatively higher in HH (0.392 than other breeds. Conclusion Our study showed useful genetic diversity and phylogenetic relationship data that can be utilized for NC breeding and development by the commercial chicken industry to meet consumer demands.

  15. Demodex gatoi -associated contagious pruritic dermatosis in cats - a report from six households in Finland

    Directory of Open Access Journals (Sweden)

    Rajaniemi Riitta-Liisa

    2009-10-01

    Full Text Available Abstract Background Demodex gatoi is unique among demodectic mites. It possesses a distinct stubby appearance, and, instead of residing in the hair follicles, it dwells in the keratin layer of the epidermis, causing a pruritic and contagious skin disease in cats. Little is known of the occurrence of D. gatoi in Europe or control of D. gatoi infestation. Case presentation We describe D. gatoi in 10 cats, including five Cornish Rex, two Burmese, one Exotic, one Persian and one Siamese, living in six multi-cat households in different locations in Finland containing 21 cats in total. Intense pruritus was the main clinical sign. Scaling, broken hairs, alopecia and self-inflicted excoriations were also observed. Diagnosis was based on finding typical short-bodied demodectic mites in skin scrapings, skin biopsies or on tape strips. Other pruritic skin diseases, such as allergies and dermatophytoses, were ruled out. In one household, despite finding several mites on one cat, all six cats of the household remained symptomless. Amitraz used weekly at a concentration of 125-250 ppm for 2-3 months, proved successful in three households, 2% lime sulphur weekly dips applied for six weeks in one household and peroral ivermectin (1 mg every other day for 10 weeks in one household. Previous trials in four households with imidacloprid-moxidectin, selamectin or injected ivermectin given once or twice a month appeared ineffective. Conclusion D. gatoi-associated dermatitis is an emerging contagious skin disease in cats in Finland. Although pruritus is common, some cats may harbour the mites without clinical signs. In addition, due to translucency of the mites and fastidious feline grooming habits, the diagnosis may be challenging. An effective and convenient way to treat D. gatoi infestations has yet to emerge.

  16. Anaphora in question-answer sessions in university ELF contexts.

    Directory of Open Access Journals (Sweden)

    Thomas Wulstan Christiansen

    2015-07-01

    Full Text Available Abstract - Identity chains (Hasan 1984 ˗ strings of co-referential noun phrases ˗ constitute a lesser researched area in the field of ELF, as has the more general area of cohesion (but see Hüttner 2009, Christiansen 2011. Following on the work on anaphora of such scholars as Reinhart (1983 and Cornish (1999, and on cohesion (e.g. Halliday and Hasan 1976, Halliday 2004, Christiansen (2009a/b, 2011 focuses on the link between text cohesion and discourse coherence. The interactive perspective of discourse (seen as the process of which text is the product: see Widdowson 1984: 100 is especially relevant to an ELF context of spontaneous spoken interaction. As Guido (2008 evidences, different inter-cultural concerns constitute a crucial dimension to the complex multi-code interaction. Consequently, the diverse ways in which speakers from different L1 backgrounds employ anaphors and construct identity chains are key elements in the co-construction of a dialogic text. In this case study, six extracts of transcripts taken from the VOICE corpus (2011 of conference question and answer sessions set in multicultural contexts are analysed qualitatively. The different ways that participants construct identity chains (e.g. whether they use full forms of various kinds or anaphoric pro-forms are classified. The analysis focuses on both how individual anaphors are resolved and how relations between anaphors and antecedent triggers are encoded, and how identity chains are constructed and organized individually. The objective is to identify which kinds of noun phrase (various subtypes of full and pro-forms are used by diverse groups of EFL speakers both in relation to their own contributions and to those of other speakers (with a threefold distinction made between the same turn of the same speaker, a different turn of the same speaker, and a different turn by a different speaker.

  17. Effect of ions on the activity of brain acetylcholinesterase from tropical fish

    Directory of Open Access Journals (Sweden)

    Caio Rodrigo Dias Assis

    2015-07-01

    Full Text Available Objective: To investigate the effect of ions on brain acetylcholinesterase (AChE; EC 3.1.1.7 activities from economic important fish [pirarucu, Arapaima gigas; tambaqui, Colossoma macropomum; cobia, Rachycentron canadum (R. canadum and Nile tilapia, Oreochromis niloticus (O. niloticus] comparing with a commercial enzyme from electric eel [Electrophorus electricus (E. electricus]. Methods: The in vitro exposure was performed at concentrations ranging from 0.001 to 10 mmol/L (except for ethylene diamine tetraacetic acid; up to 150 mmol/L. Inhibition kinetics on R. canadum and O. niloticus were also observed through four methods (Michaelis-Menten, Lineweaver-Burk, Dixon and Cornish-Bowden plots in order to investigate the type of inhibition produced by some ions. Results: Hg 2+ , As 3+ , Cu 2+ , Zn 2+ , Cd 2+ caused inhibition in all the species under study. Ca 2+ , Mg 2+ and Mn 2+ induced slight activation in R. canadum enzyme while Pb 2+ , Ba 2+ , Fe 2+ , Li + inhibited the AChE from some of the analyzed species. The lowest IC 50 and Ki values were estimated for E. electricus AChE in presence of Hg 2+ , Pb 2+ , Zn 2+ . Under our experimental conditions, the results for R. canadum and O. niloticus, As 3+ , Cu 2+ , Cd 2+ , Pb 2+ and Zn 2+ showed a non- competitive/mixed-type inhibition, while Hg 2+ inhibited the enzyme in a mixed/competitive- like manner. Conclusions: E. electricus AChE activity was affected by ten of fifteen ions under study showing that this enzyme could undergo interference by these ions when used as pesticide biosensor in environmental analysis. This hindrance would be less relevant for the crude extracts.

  18. Dystocia in the cat evaluated using an insurance database.

    Science.gov (United States)

    Holst, Bodil Ström; Axnér, Eva; Öhlund, Malin; Möller, Lotta; Egenvall, Agneta

    2017-01-01

    Objectives The aim of this study was to describe the incidence of feline dystocia with respect to breed. Methods The data used were reimbursed claims for veterinary care insurance and/or life insurance claims in cats registered in a Swedish insurance database from 1999-2006. Results The incidence rates for dystocia were about 22 cats per 10,000 cat-years at risk, 67 per 10,000 for purebred cats and seven per 10,000 for domestic shorthair cats. The median age was 2.5 years. A significant effect of breed was seen. An incidence rate ratio (IRR) that was significantly higher compared with other purebred cats was seen in the British Shorthair (IRR 2.5), the Oriental group (IRR 2.2), Birman (IRR 1.7), Ragdoll (IRR 1.5) and the Abyssinian group (IRR 1.5). A significantly lower IRR was seen in the Norwegian Forest Cat (IRR 0.38), the Maine Coon (IRR 0.48), the Persian/Exotic group (IRR 0.49) and the Cornish Rex (IRR 0.50). No common factor among the high-risk breeds explained their high risk for dystocia. There was no effect of location; that is, the incidence rate did not differ depending on whether the cat lived in an urban or rural area. Caesarean section was performed in 56% of the cats with dystocia, and the case fatality was 2%. Conclusions and relevance The incidence rate for dystocia was of a similar magnitude in purebred cats as in dogs. The IRR varied significantly among breeds, and the main cause for dystocia should be identified separately for each breed. A selection for easy parturitions in breeding programmes is suggested.

  19. The Irish coastal current: A seasonal jet-like circulation

    Science.gov (United States)

    Fernand, L.; Nolan, G. D.; Raine, R.; Chambers, C. E.; Dye, S. R.; White, M.; Brown, J.

    2006-10-01

    During 25 July-3 August 2001 a comprehensive cruise was undertaken along the western coast of the Republic of Ireland to resolve the three-dimensional density field and circulation. Towed undulating CTD revealed the strong thermocline beyond the 60 m contour with more diffuse stratification inshore. Argos drifters deployed in the late summer of 1999, 2000 and 2001 demonstrated strongly northward flow, their motion was uncorrelated with wind forcing but was consistent with the predicted geostrophic currents generated by the bottom fronts intersecting the seabed. These flows were evident in the data from the vessel mounted 153.6 kHz acoustic Doppler current profiler (ADCP) although the jets are relatively narrow (15-20 km). This region is heavily influenced by storm events and Atlantic influence with high salinity contributing to strong vertical and horizontal density gradients particularly in the south of the region. However, the seasonal heating cycle coupled with tidal mixing is the dominant force of buoyancy production that ensures that the frontal features occur every year. In combination with similar features found in the Celtic Sea [Brown, J., et al., 2003. Observations of the physical structure and seasonal jet-like circulation of the Celtic Sea and St. George's Channel of the Irish Sea. Continental Shelf Research 23, 533-561] these observations demonstrate the existence of a continuous pathway in summer from the north Cornish coast to Malin Head with average residual velocities >7.5 cm s -1. The data set described here provides the necessary basis for environmental management and knowledge of the pathway for contaminants, the dynamics of nutrients and an understanding of the movement of larvae and juvenile fish, in a geographic location that had previously been little studied.

  20. Benthic foraminifera (Protista) as indicators of metal pollution in areas of historic mining: examples from southwest England

    Science.gov (United States)

    Hart, Malcolm; Smart, Christopher

    2016-04-01

    Southwest England has been, from Roman times, an important mining area supplying a range of important metals, including copper, tin, tungsten, arsenic, zinc, silver, etc. This mining activity virtually disappeared in the twentieth century, although one tungsten mine near Plymouth has recently re-opened. Large areas of Cornwall and West Devon are now inscribed as the 'Cornish Mining World Heritage Site' on the cultural list of UNESCO. Many of the old mines with their spoil heaps and tailings dams are now protected and, together with the mineral-rich local geology, provide many catchments with on-going metal pollution. In January 1992, after a period of prolonged, heavy rainfall Wheal Jane mine flooded and discharged heavily polluted, acidic, water into Restonguet Creek and the Fal Estuary. This event provided the setting for a detailed investigation of the immediate impact of the pollution and the resulting environmental improvements caused by engineering interventions and natural re-adjustment. Benthic foraminifera disappeared from Restronguet Creek for a number of years and while there is now an abundant, though low diversity, estuarine assemblage of foraminifera living in the creek there are still high levels (pollution can be used to compare with the test deformity data. In other estuarine systems in southwest England, such as the River Fowey and the River Tamar, levels of deformity are less, though still significant for areas no longer being actively mined. This demonstrates that polluted sediments in all these estuaries, which can be disturbed during floods or times of stormy weather, and the background levels of metal elements in the catchments that supply these estuaries, are sufficient to maintain these levels of deformity in the long term. OLUGBODE, O.I., HART, M.B. & STUBBLES, S.J. 2005. Foraminifera from Restronguet Creek: monitoring recovery from the Wheal Jane pollution incident. Geoscience in south-west England, 11, 82-92.

  1. Evidence of selection signatures that shape the Persian cat breed.

    Science.gov (United States)

    Bertolini, Francesca; Gandolfi, Barbara; Kim, Eui Soo; Haase, Bianca; Lyons, Leslie A; Rothschild, Max F

    2016-04-01

    The Persian cat is mainly characterized by an extremely brachycephalic face as part of the standard body conformation. Despite the popularity, world-wide distribution, and economic importance of the Persian cat as a fancy breed, little is known about the genetics of their hallmark morphology, brachycephaly. Over 800 cats from different breeds including Persian, non-Persian breeds (Abyssinian, Cornish Rex, Bengal, La Perm, Norwegian Forest, Maine Coon, Manx, Oriental, and Siamese), and Persian-derived breeds (British Shorthair, Scottish Fold, Selkirk Rex) were genotyped with the Illumina 63 K feline DNA array. The experimental strategy was composed of three main steps: (i) the Persian dataset was screened for runs of homozygosity to find and select highly homozygous regions; (ii) selected Persian homozygous regions were evaluated for the difference of homozygosity between Persians and those considered non-Persian breeds, and, (iii) the Persian homozygous regions most divergent from the non-Persian breeds were investigated by haplotype analysis in the Persian-derived breeds. Four regions with high homozygosity (H > 0.7) were detected, each with an average length of 1 Mb. Three regions can be considered unique to the Persian breed, with a less conservative haplotype pattern in the Persian-derived breeds. Moreover, two genes, CHL1 and CNTN6 known to determine face shape modification in humans, reside in one of the identified regions and therefore are positional candidates for the brachycephalic face in Persians. In total, the homozygous regions contained several neuronal genes that could be involved in the Persian cat behavior and can provide new insights into cat domestication.

  2. Light whole genome sequence for SNP discovery across domestic cat breeds

    Directory of Open Access Journals (Sweden)

    Driscoll Carlos

    2010-06-01

    Full Text Available Abstract Background The domestic cat has offered enormous genomic potential in the veterinary description of over 250 hereditary disease models as well as the occurrence of several deadly feline viruses (feline leukemia virus -- FeLV, feline coronavirus -- FECV, feline immunodeficiency virus - FIV that are homologues to human scourges (cancer, SARS, and AIDS respectively. However, to realize this bio-medical potential, a high density single nucleotide polymorphism (SNP map is required in order to accomplish disease and phenotype association discovery. Description To remedy this, we generated 3,178,297 paired fosmid-end Sanger sequence reads from seven cats, and combined these data with the publicly available 2X cat whole genome sequence. All sequence reads were assembled together to form a 3X whole genome assembly allowing the discovery of over three million SNPs. To reduce potential false positive SNPs due to the low coverage assembly, a low upper-limit was placed on sequence coverage and a high lower-limit on the quality of the discrepant bases at a potential variant site. In all domestic cats of different breeds: female Abyssinian, female American shorthair, male Cornish Rex, female European Burmese, female Persian, female Siamese, a male Ragdoll and a female African wildcat were sequenced lightly. We report a total of 964 k common SNPs suitable for a domestic cat SNP genotyping array and an additional 900 k SNPs detected between African wildcat and domestic cats breeds. An empirical sampling of 94 discovered SNPs were tested in the sequenced cats resulting in a SNP validation rate of 99%. Conclusions These data provide a large collection of mapped feline SNPs across the cat genome that will allow for the development of SNP genotyping platforms for mapping feline diseases.

  3. Preliminary investigation of genetic characterization of native and endemic fowl types of Sri Lanka

    International Nuclear Information System (INIS)

    Silva, L.P.; Rajapaksha, W.R.A.K.J.S.

    2005-01-01

    The Red Jungle Fowl (Gallus gallus) is generally considered to be main ancestor of the domestic fowl (Callus domesticus). However, it is also believed that other wild Callus species might have contributed to the modern genetic make-up of the domestic fowl, one wild species being the Ceylon Jungle Fowl (Gallus lafayetti), endemic to Sri Lanka, which could have contributed to the domestic stock of Sri Lankan native poultry. The present study was conducted in order to investigate the origin of native fowl in Sri Lanka and to establish genetic relationships among them and the Ceylon Jungle Fowl. Morphological characters of endemic, indigenous and exotic fowl types were recorded. These included Ceylon Jungle fowl; eleven types of native chicken from Sri Lanka; and two exotic chicken breeds (Cornish and Rhode Island Red). Blood samples were collected for DNA extraction. Randomly Amplified Polymorphic DNA (RAPD) analysis was carried out using sixteen non-specific primers. The results of morphological characterization revealed many variations in plumage and colour pattern. Single and pea comb types were found in both native and exotic types of chicken. A prominent yellow colour marking on a red comb was a unique feature in Ceylon Jungle fowl. The presence of white spots in red earlobes was a distinguishing feature of all native chicken types. Sixteen non-specific primers were used in the study, and produced 22 polymorphic bands ranging from 500 to 1960 bp. Genetic similarity indices ranged from 0.5 to 1.1 in average genetic distance scale, indicating a broad genetic base in the samples studied. Cluster analysis revealed a clear separation of Ceylon Jungle Fowl from all other types studied, indicating that contribution in data analysis, and the Director and staff, National Zoological Gardens, Sri Lanka, for their help in sampling Ceylon Jungle Fowl. (author)

  4. Constraining Cosmic Dawn and Cosmological Reionization via the global redshifted 21-cm signal

    Science.gov (United States)

    Singh, Saurabh

    2018-01-01

    The formation of first stars and consequent thermal evolution in baryons during Cosmic Dawn and the Epoch of Reionization (EoR) is poorly constrained. The 21-cm line transition of neutral hydrogen is one of the richest probes of the astrophysics during this era. The signal has the potential to reveal the nature and timing of the emergence of first stars, first light, and the consequent evolution in thermal and ionization state of the baryons.The detection of the global redshifted 21-cm signal, which represents the mean thermal history of the gas, is challenging since it is extremely faint and seen through orders of magnitude stronger contributions from Galactic and extragalactic foregrounds. Man-made terrestrial Radio Frequency Interference (RFI) and the exacting tolerances required on instrument systematics make the detection even more daunting.The design considerations for a precision spectral radiometer are first listed, and a comparison is made of different radiometer configurations, including short and zero baseline interferometers along with methods to enhance the response. We discuss the relative merits of different methods.We then describe SARAS 2, a spectral radiometer custom-designed for precision measurement of the global 21-cm signal. SARAS 2 has been designed to have a system transfer function and internal systematics – both multiplicative and additive – to be spectrally smooth so as to allow a separation of foregrounds and systematics from plausible and predicted global cosmological 21-cm signals. The algorithms for calibration and RFI mitigation are carefully developed so that they do not introduce spectral features that may confuse the detection of the 21-cm signal.We present the outcomes for cosmology from analysis of 60 hr observing with the radiometer deployed at the Timbaktu Collective in Southern India. The detailed analysis of the data reveals an RMS noise level of 11 mK, without being limited by systematic structures. The likelihood

  5. New insights into the effects of styrene-butadiene-styrene polymer modifier on the structure, properties, and performance of asphalt binder: The case of AP-5 asphalt and solvent deasphalting pitch

    Energy Technology Data Exchange (ETDEWEB)

    Nciri, Nader, E-mail: nader.nciri@koreatech.ac.kr [Department of Energy, Materials, and Chemical Engineering, Korea University of Technology and Education, 1600 Chungjeol-ro, Byeongcheon-myeon, Dongnam-gu, Cheonan-City, Chungnam-Province 330-708 (Korea, Republic of); Kim, Namho [Department of Architectural Engineering, Korea University of Technology and Education, 1600 Chungjeol-ro, Byeongcheon-myeon, Dongnam-gu, Cheonan-City, Chungnam-Province 330-708 (Korea, Republic of); Cho, Namjun, E-mail: njuncho@koreatech.ac.kr [Department of Energy, Materials, and Chemical Engineering, Korea University of Technology and Education, 1600 Chungjeol-ro, Byeongcheon-myeon, Dongnam-gu, Cheonan-City, Chungnam-Province 330-708 (Korea, Republic of)

    2017-06-01

    This paper deals with the poorly understood effects of styrene-butadiene-styrene (SBS) copolymer on the bitumen performance. It focuses on determining the impact of various concentrations (e.g., 0, 4, 8, and 12 wt. %) of SBS on the attributes of two types of asphalt namely AP-5 asphalt and solvent deasphalting (SDA) pitch. The unmodified and modified binders were investigated in terms of their chemical compositions, microstructures, thermo-analytical behaviors, and physical properties. The intricate chemical compositions were evaluated by elemental analysis and thin layer chromatography-ionization detection (TLC-FID). Fourier transform infrared (FT-IR) and nuclear magnetic resonance (NMR) spectroscopies, scanning electron microscopy (SEM), and X-ray diffraction (XRD) were utilized to examine the microstructures. Whereas, thermal characteristics were evaluated by thermogravimetric analysis (TGA/DTGA) and differential scanning calorimetry (DSC). The physical behaviors were monitored through the softening point, penetration, viscosity, and ductility tests. The findings showed that the blending of asphalt with different amounts of SBS resulted into different rheological behaviors. This was reflected from the difference in the SARA (i.e., saturates, aromatics, resins, and asphaltenes) compositions and colloidal instability indexes of the modified asphalts. SEM exhibited a continuous asphalt phase with distributed SBS particles, a continuous polymer phase with distributed asphalt globules, or two interconnected continuous phases. FT-IR, {sup 1}H {sup 13}C NMR, and XRD data revealed that the AP-5 asphalt and SDA pitch experienced a number of distinct structural changes. TGA/DSC studies determined the occurrence of diverse events during thermal treatment. It is concluded that the degree of SBS modification depends strongly on SARA composition and polymer content. If the polymers are molded at higher concentrations along with aromatics-rich SDA pitches, then the mixtures

  6. Role of the two-component regulatory system arlRS in ica operon and aap positive but non-biofilm-forming Staphylococcus epidermidis isolates from hospitalized patients.

    Science.gov (United States)

    Wu, Yang; Liu, Jingran; Jiang, Juan; Hu, Jian; Xu, Tao; Wang, Jiaxue; Qu, Di

    2014-11-01

    The ica operon and aap gene are important factors for Staphylococcus epidermidis biofilm formation. However, we found 15 out of 101 S. epidermidis strains isolated from patients had both the ica operon and the aap gene in the genome but could not form biofilms (ica(+)aap(+)/BF(-) isolates). Compared with standard strain RP62A, the 15 ica(+)aap(+)/BF(-) isolates had similar growth curves and initial attachment abilities, but had much lower apparent transcription levels of the icaA gene and significantly less production of polysaccharide intercellular adhesion (PIA). Furthermore, the expression of accumulation-associated protein in ica(+)aap(+)/BF(-) isolates was much weaker than in RP62A. The mRNA levels of icaADBC transcription-related regulatory genes, including icaR, sarA, rsbU, srrA, arlRS and luxS, were measured in the 15 ica(+)aap(+)/BF(-) clinical isolates. The mRNA levels of arlR and rsbU in all of the ica(+)aap(+)/BF(-) isolates were lower than in RP62A at 4 h. At 10 h, 14/15 of the isolates showed lower mRNA levels of arlR and rsbU than shown by RP62A. However, expression of sarA, luxS, srrA and icaR varied in different ica(+)aap(+)/BF(-) isolates. To further investigate the role of arlRS in biofilm formation, we analyzed icaA, sarA and rsbU transcription, PIA synthesis, Aap expression and biofilm formation in an arlRS deletion mutant of S. epidermidis strain 1457 and all were much less than in the wild type strain. This is consistent with the hypothesis that ArlRS may play an important role in regulating biofilm formation by the ica(+)aap(+)/BF(-)S. epidermidis clinical isolates and operate via both ica-dependent and Aap-dependent pathways. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Histamine Induces Bovine Rumen Epithelial Cell Inflammatory Response via NF-κB Pathway.

    Science.gov (United States)

    Sun, Xudong; Yuan, Xue; Chen, Liang; Wang, Tingting; Wang, Zhe; Sun, Guoquan; Li, Xiaobing; Li, Xinwei; Liu, Guowen

    2017-01-01

    Subacute ruminal acidosis (SARA) is a common disease in high-producing lactating cows. Rumenitis is the initial insult of SARA and is associated with the high concentrations of histamine produced in the rumen of dairy cows during SARA. However, the exact mechanism remains unclear. The objective of the current study is to investigate whether histamine induces inflammation of rumen epithelial cells and the underlying mechanism of this process. Bovine rumen epithelial cells were cultured and treated with different concentrations of histamine and pyrrolidine dithiocarbamate (PDTC, an NF-κB inhibitor) cultured in different pH medium (pH 7.2 or 5.5). qRT-PCR, Western-blotting, ELISA and immunocytofluorescence were used to evaluate whether histamine activated the NF-κB pathway and inflammatory cytokines. The results showed that histamine significantly increased the activity of IKK β and the phosphorylation levels of IκB α, as well as upregulated the mRNA and protein expression levels of NF-κB p65 in the rumen epithelial cells cultured in neutral (pH=7.2) and acidic (pH=5.5) medium. Furthermore, histamine treatment also significantly increased the transcriptional activity of NF-κB p65. High expression and transcriptional activity of NF-κB p65 significantly increased the mRNA expressions and concentrations of inflammatory cytokines, tumor necrosis factor alpha (TNF-α), interleukin 6 (IL-6) and interleukin 1 beta (IL-1β), thereby inducing the inflammatory response in bovine rumen epithelial cells. However, inhibition of NF-κB p65 by PDTC significantly decreased the expressions and concentrations of the inflammatory cytokines induced by histamine in the rumen epithelial cells cultured in the neutral and acidic medium. The present data indicate that histamine induces the inflammatory response of bovine rumen epithelial cells through the NF-κB pathway. © 2017 The Author(s). Published by S. Karger AG, Basel.

  8. U.S. EPA Superfund Program's Policy for Community Involvement at Radioactively Contaminated Sites

    International Nuclear Information System (INIS)

    Carey, Pat; Walker, Stuart

    2008-01-01

    This paper describes the Superfund program's statutory requirements for community involvement. It also discusses the efforts the Superfund program has made that go beyond these statutory requirements to involve communities. The Environmental Protection Agency (EPA) implements the Superfund program under the authority of the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA), as amended by the Superfund Amendments and Reauthorization Act of 1986 (SARA). From the beginning of the Superfund program, Congress envisioned a role for communities. This role has evolved and expanded during the implementation of the Superfund program. Initially, the CERCLA statute had community involvement requirements designed to inform surrounding communities of the work being done at a site. CERCLA's provisions required 1) development of a community relations plan for each site, 2) establishment of information repositories near each site where all publicly available materials related to the site would be accessible for public inspection, 3) opportunities for the public to comment on the proposed remedy for each site and 4) development of a responsiveness summary responding to all significant comments received on the proposed remedy. In recognition of the need for people living near Superfund sites to be well-informed and involved with decisions concerning sites in their communities, SARA expanded Superfund's community involvement activities in 1986. SARA provided the authority to award Technical Assistance Grants (TAGs) to local communities enabling them to hire independent technical advisors to assist them in understanding technical issues and data about the site. The Superfund Community Involvement Program has sought to effectively implement the statutory community involvement requirements, and to go beyond those requirements to find meaningful ways to involve citizens in the cleanup of sites in their communities. We've structured our program around

  9. An Update on the NASA Planetary Science Division Research and Analysis Program

    Science.gov (United States)

    Richey, Christina; Bernstein, Max; Rall, Jonathan

    2015-01-01

    Introduction: NASA's Planetary Science Division (PSD) solicits its Research and Analysis (R&A) programs each year in Research Opportunities in Space and Earth Sciences (ROSES). Beginning with the 2014 ROSES solicitation, PSD will be changing the structure of the program elements under which the majority of planetary science R&A is done. Major changes include the creation of five core research program elements aligned with PSD's strategic science questions, the introduction of several new R&A opportunities, new submission requirements, and a new timeline for proposal submissionROSES and NSPIRES: ROSES contains the research announcements for all of SMD. Submission of ROSES proposals is done electronically via NSPIRES: http://nspires.nasaprs.com. We will present further details on the proposal submission process to help guide younger scientists. Statistical trends, including the average award size within the PSD programs, selections rates, and lessons learned, will be presented. Information on new programs will also be presented, if available.Review Process and Volunteering: The SARA website (http://sara.nasa.gov) contains information on all ROSES solicitations. There is an email address (SARA@nasa.gov) for inquiries and an area for volunteer reviewers to sign up. The peer review process is based on Scientific/Technical Merit, Relevance, and Level of Effort, and will be detailed within this presentation.ROSES 2014 submission changes: All PSD programs will use a two-step proposal submission process. A Step-1 proposal is required and must be submitted electronically by the Step-1 due date. The Step-1 proposal should include a description of the science goals and objectives to be addressed by the proposal, a brief description of the methodology to be used to address the science goals and objectives, and the relevance of the proposed research to the call submitted to.Additional Information: Additional details will be provided on the Cassini Data Analysis Program, the

  10. Invited review: Practical feeding management recommendations to mitigate the risk of subacute ruminal acidosis in dairy cattle.

    Science.gov (United States)

    Humer, E; Petri, R M; Aschenbach, J R; Bradford, B J; Penner, G B; Tafaj, M; Südekum, K-H; Zebeli, Q

    2018-02-01

    Rumen health is of vital importance in ensuring healthy and efficient dairy cattle production. Current feeding programs for cattle recommend concentrate-rich diets to meet the high nutritional needs of cows during lactation and enhance cost-efficiency. These diets, however, can impair rumen health. The term "subacute ruminal acidosis" (SARA) is often used as a synonym for poor rumen health. In this review, we first describe the physiological demands of cattle for dietary physically effective fiber. We also provide background information on the importance of enhancing salivary secretions and short-chain fatty acid absorption across the stratified squamous epithelium of the rumen; thus, preventing the disruption of the ruminal acid-base balance, a process that paves the way for acidification of the rumen. On-farm evaluation of dietary fiber adequacy is challenging for both nutritionists and veterinarians; therefore, this review provides practical recommendations on how to evaluate the physical effectiveness of the diet based on differences in particle size distribution, fiber content, and the type of concentrate fed, both when the latter is part of total mixed ration and when it is supplemented in partial mixed rations. Besides considering the absolute amount of physically effective fiber and starch types in the diet, we highlight the role of several feeding management factors that affect rumen health and should be considered to control and mitigate SARA. Most importantly, transitional feeding to ensure gradual adaptation of the ruminal epithelium and microbiota; monitoring and careful management of particle size distribution; controlling feed sorting, meal size, and meal frequency; and paying special attention to primiparous cows are some of the feeding management tools that can help in sustaining rumen health in high-producing dairy herds. Supplementation of feed additives including yeast products, phytogenic compounds, and buffers may help attenuate SARA

  11. Modeling the adequacy of dietary fiber in dairy cows based on the responses of ruminal pH and milk fat production to composition of the diet.

    Science.gov (United States)

    Zebeli, Q; Dijkstra, J; Tafaj, M; Steingass, H; Ametaj, B N; Drochner, W

    2008-05-01

    The main objective of this study was to develop practical models to assess and predict the adequacy of dietary fiber in high-yielding dairy cows. We used quantitative methods to analyze relevant research data and critically evaluate and determine the responses of ruminal pH and production performance to different variables including physical, chemical, and starch-degrading characteristics of the diet. Further, extensive data were used to model the magnitude of ruminal pH fluctuations and determine the threshold for the development of subacute ruminal acidosis (SARA). Results of this study showed that to minimize the risk of SARA, the following events should be avoided: 1) a daily mean ruminal pH lower than 6.16, and 2) a time period in which ruminal pH is content of physically effective neutral detergent fiber (peNDF) or the ratio between peNDF and rumen-degradable starch from grains in the diet increased up to 31.2 +/- 1.6% [dry matter (DM) basis] or 1.45 +/- 0.22, respectively, so did the daily mean ruminal pH, for which a asymptotic plateau was reached at a pH of 6.20 to 6.27. This study also showed that digestibility of fiber in the total tract depends on ruminal pH and outflow rate of digesta from reticulorumen; thereby both variables explained 62% of the variation of fiber digestibility. Feeding diets with peNDF content up to 31.9 +/- 1.97% (DM basis) slightly decreased DM intake and actual milk yield; however, 3.5% fat-corrected milk and milk fat yield were increased, resulting in greater milk energy efficiency. In conclusion, a level of about 30 to 33% peNDF in the diet may be considered generally optimal for minimizing the risk of SARA without impairing important production responses in high-yielding dairy cows. In terms of improvement of the accuracy to assessing dietary fiber adequacy, it is suggested that the content of peNDF required to stabilize ruminal pH and maintain milk fat content without compromising milk energy efficiency can be arranged based

  12. Incorporating ecological risk assessment into remedial investigation/feasibility study work plans

    International Nuclear Information System (INIS)

    1994-06-01

    This guidance document (1) provides instructions on preparing the components of an ecological work plan to complement the overall site remedial investigation/feasibility study (RI/FS) work plan and (2) directs the user on how to implement ecological tasks identified in the plan. Under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA), as amended by the Superfund Amendments and Reauthorization Act of 1986 (SARA), and RI/FS work plan will have to be developed as part of the site-remediation scoping process. Specific guidance on the RI/FS process and the preparation of work plans has been developed by the US Environmental Protection Agency (EPA 1988a). This document provides guidance to US Department of Energy (DOE) staff and contractor personnel for incorporation of ecological information into environmental remediation planning and decision making at CERCLA sites

  13. Optimizing compliance training for the waste management worker

    International Nuclear Information System (INIS)

    Copenhaver, E.D.

    1988-01-01

    Waste management workers are required to participate in special training mandated by a variety of Federal laws and DOE Orders; these include the Resource Conservation and Recovery Act (RCRA), Superfund Amendments Reauthorization Act (SARA) as implemented by OSHA in CFR 1920.120, in addition to requirements for Hazard Communication, Radiation Workers, Respiratory Protection, Transportation, and Waste Generator training. The Technical Resources and Training program is examining the course contents and mandated requirements to determine how to best meld these requirements into a training program that will still fulfill all requirements but eliminate the potential for duplication of some elements in successive courses. This approach may not eliminate all duplication between courses, but it should result in significant savings in manhours demanded in a training environment which requires similar information to meet a host of regulatory requirements. The training matrix planned for Oak Ridge National Laboratory (ORNL) will be presented and discussed. 22 refs., 3 tabs

  14. Special offer

    CERN Multimedia

    Staff Association

    2010-01-01

    Entrez en Harmony et découvrez… Un espace bien-être avec piscine, jacuzzi, hammam, sauna. Une offre de 65 cours collectifs dispensés par des professeurs diplômés, et de multiples possibilités de s’entraîner individuellement ou avec un coach. Un personnel expérimenté à votre écoute. Des locaux spacieux, lumineux, situés au centre de La Praille. Une garderie, des places de parking et 50 commerces, et une grande diversité de collations et jus de fruits frais. Prix corporate « spécial 10 ans » Plus de 20 % de rabais en 2010 Sur présentation de votre carte membre Votre contact: Sara Forestier 079 290 66 18

  15. The revival of Phage Therapy to fight Antimicrobial Resistance – Part II: What about patent protection and alternative incentives?

    DEFF Research Database (Denmark)

    Minssen, Timo

    2014-01-01

    Three days ago I commented on a couple of legal issues raised in the recent Nature report “Phage therapy gets revitalized” by Sara Reardon. One challenge concerns the reluctance of pharma companies to broadly invest in the development of phage therapies. As pointed out in the report, this does....... Like in Europe, the first door to patentability that phage-related technology would need to pass concerns patent eligibility. In the last years the US Supreme Court has rendered an astonishing number of fundamental patent-decisions, including not less than four (!) landmark judgments on patent...... occurring viruses, such as phages, and the processes in which these are used. Myriad and Prometheus could thus have a fundamental impact on many patent portfolios relating to phage therapy and thus business involvement. In that context, it is important to realize that an important component of proper use...

  16. Arvustused / Mart Kalvet

    Index Scriptorium Estoniae

    Kalvet, Mart, 1975-

    2007-01-01

    Heliplaatidest:Type O Negative "Dead Again", Luv Machine "Turns You On", Loits "Leegion laval", Chrome Hoof "Beyond Zade", Neoandertals "Neoanderthals Were Master Butchers", Deathbound "To Cure The Sane With Insanity", Guardians Of Mankind/Merging Flare "Beyond the Blackhole/Under the Fire", Funeral "From These Wounds", Black Bile "Cloacal Meditation", Furze (Woe J. Reaper) "UTD", Embrace "The Last Embrace", Blut Aus Nord "MoRT", Diskreet "Infernal Rise", Sepia Dreamer "The Sublime", SaraLee "Darkness Between", Urt "Saatanhark", Onslaught "Killing Peace", Paganize "Evolution Hour", Kroda "Fimbulwinter", Scent Of Flesh "Deform In Torture", Zatokrev "Bury the Ashes", Misery Signals "Mirrors", Sarpanitum "Despoilment Of Origin", Umbra Nihil "Gnoia", Saattue "Ikiuneen", Sanctimony "Hell in Stereo", Twilight Ophera "Descension", Year Of Desolation "Year Of Desolation", "Resistance"

  17. The changing Arena: New DOE waste management orders

    International Nuclear Information System (INIS)

    Albenesius, E.L.; Kluk, A.F.

    1988-01-01

    There are five orders that address waste management within the Department of Energy (DOE); three of these orders are being revised, which emphasize the rapidly changing arena in which the department is contending in this field. The need to change the Comprehensive Environmental Response, Compensation and Liability Act (CERCLA) Order arose from the Superfund amendments of 1986 (SARA) with its hammer provisions in Section 120 for compliance at Federal facilities. The need to change the Hazardous and Mixed Waste Management Order was accelerated by the promulgation by DOE of the new mixed waste rule on May 1, 1987, (1) and cancellation of the obsolete existing order on October 5, 1987. The new rule requires coregulation of all DOE mixed waste with the Environmental Protection Agency (EPA) and the respective authorized states. 5 refs

  18. Note e Recensioni

    Directory of Open Access Journals (Sweden)

    a cura di Mariagrazia Portera

    2013-12-01

    Full Text Available Volumi Winfried Menninghaus, La promessa della bellezza, [Fabrizio Desideri, p. 272] • David Rothenberg, Survival of the Beautiful. Art, Science and Evolution [Danae Crocchiola, p. 274] • Lev Manovich, Software Takes Command [Angela Maiello, p. 277]. Note Method in Aesthetics: Philosophy, Evolution and the Cognitive Sciences [Aaron Meskin, Matthew Kieran, Gregory Currie, p. 280] • L’Abitare possibile. Estetica, Architettura e New Media, Ravello, Auditorium Oscar Niemeyer, 28-30 maggio 2013 [Sara Matetich, p. 282] • Copenhagen Summer School in Phenomenology and Philosophy of Mind, University of Copenhagen, 12-16 Agosto 2013 [Raoul Frauenfelder, p. 289] • Ciò che è vivo e ciò che è morto nell’estetica di Archibald Ali- son. Nota a margine del convegno: Neoestetica ed emozione. Archibald Alison e l’estetica con- temporanea, Palermo, 4-5 ottobre 2013 [Giuseppe Pucci, p. 294

  19. Feminist Praxis, Critical Theory and Informal Hierarchies

    Directory of Open Access Journals (Sweden)

    Eva Giraud

    2015-05-01

    Full Text Available This article draws on my experiences teaching across two undergraduate media modules in a UK research-intensive institution to explore tactics for combatting both institutional and informal hierarchies within university teaching contexts. Building on Sara Motta’s (2012 exploration of implementing critical pedagogic principles at postgraduate level in an elite university context, I discuss additional tactics for combatting these hierarchies in undergraduate settings, which were developed by transferring insights derived from informal workshops led by the University of Nottingham’s Feminism and Teaching network into the classroom. This discussion is framed in relation to the concepts of “cyborg pedagogies” and “political semiotics of articulation,” derived from the work of Donna Haraway, in order to theorize how these tactics can engender productive relationships between radical pedagogies and critical theory.

  20. Implementation of environmental compliance for operating radioactive liquid waste systems at the Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    Hooyman, J.H.; Robinson, S.M.

    1992-01-01

    This paper addresses methods being implemented at the Oak Ridge National Laboratory (ORNL) to continue operating while achieving compliance with new standards for liquid low level waste (LLLW) underground storage tank systems. The Superfund Amendment and Reauthorization Act (SARA) of the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) required that the Department of Energy (DOE) execute a Federal Facility Agreement (FFA) with the Environmental Protection Agency (EPA) within 6 months of listing of the ORNL on the National Priorities List. An FFA for ORNL became effective January 1, 1992 among the EPA, DOE, and the Tennessee Department of Environment and Conservation (TDEC). The agreement ensures that environmental impacts resulting from operations at the Oak Ridge Reservation are investigated and remediated to protect the public health, welfare, and environment

  1. Solvent substitutes

    International Nuclear Information System (INIS)

    Evanoff, S.P.

    1995-01-01

    The environmental and industrial hygiene regulations promulgated since 1980, most notably the Superfund Amendments and Reauthorization Act (SARA), the Hazardous and Solid Waste Amendments to the Resources Conservation and Recovery Act (RCRA), and the Clean Air Act Amendments of 1990, have brought about an increased emphasis on user exposure, hazardous waste generation, and air emissions. As a result, industry is performing a fundamental reassessment of cleaning solvents, processes, and procedures. The more progressive organizations have made their goal the elimination of solvents that may pose significant potential human health and environmental hazards. This chapter discusses solvent cleaning in metal-finishing, metal-manufacturing, and industrial maintenance applications; precision cleaning; and electronics manufacturing. Nonmetallic cleaning, adhesives, coatings, inks, and aerosols also will be addressed, but in a more cursory manner

  2. Fifteen years of seismic monitoring at the Las Tres Virgenes, BCS, geothermal field; Quince anos de monitoreo sismico en el campo geotermico de Las Tres Virgenes, BCS

    Energy Technology Data Exchange (ETDEWEB)

    Ortiz Prieto, Irais; Lorenzo Pulido, Cecilia [Comision Federal de Electricidad, Gerencia de Proyectos Geotermoelectricos, Morelia, Michoacan (Mexico)]. E-mail: cecilia.lorenzo@cfe.gob.mx

    2009-07-15

    Seismic monitoring at the Las Tres Virgenes, BCS, geothermal field started in 1992 with an analog station of vertical components detecting a large number of earthquakes of varying magnitudes. In February 1993, a seismic network was installed, composed of six digital stations DR-2000-with S-6000 and S-5000 sensors and three registration channels (N-S, E-W and vertical). This was the basis for the development of a program to correct arrival-time data for P and S waves due to instrument drift. From January to April 1994 and May to August 1995, based on the 170 seismic events recorded, a velocity model was proposed. From December 1995 to July 1996, seismic data were processed and interpreted, and zones of occurrence were determined for events according to magnitude and the predominant noise in the field. From September 2003 to December 2004, 10 seismic stations (permanent and temporary) were installed and monitored and it was concluded the most active fault system was El Volcan. From September to December 2004, production wells LV-4 and LV-13 were acid-stimulated and seismic monitoring during this period allowed for the definition of two important seismic zones, both related to the El Volcan fault system and to injection well LV-8. After reopening these production wells, it was concluded an increase in seismic activity had occurred. From May to August 2006, information was compiled from the seismic network and it was concluded El Partido had became the most active fault system. Presently the seismic network in this field is composed of one SARA station and four K2 units. The SARA station is telemetrically connected to the base station. [Spanish] En el campo geotermico de Las Tres Virgenes, BCS, el monitoreo sismico empezo a partir de 1992 con una sola estacion analogica de registro vertical, la cual detecto una gran cantidad de temblores de distintas magnitudes. En febrero de 1993 se instalo una red sismica con seis estaciones digitales DR-2000 con sensores S-6000 y S

  3. Energy policy and foreign policy in Italy; Politica energetica e politica estera in Italia

    Energy Technology Data Exchange (ETDEWEB)

    Venanzi, F. (comp.)

    2001-06-01

    Energy policy in Italy is principally a matter of foreign policy. As a result, extensive programmes for the exploration, development, transport and marketing of oil and natural gas have to be planned and carried out together with the producing countries. In this effort, the country shall need the support of its national energy companies. That is why ENI's controlling interest as well as its mission had better be on Italian hands. [Italian] Per l'Italia la politica energetica deve essere principalmente politica estera. Occorre pertanto realizzare vasti programmi di esplorazione mineraria, coltivazione, trasporto e commercializzazione di petrolio e gas naturale con i Paesi produttori. Ci sara' quindi bisogno di contare sulle imprese energetiche nazionali: per questa ragione, si auspica che il controllo e la missione dell'ENI restino italiani.

  4. Methodology of modeling and measuring computer architectures for plasma simulations

    Science.gov (United States)

    Wang, L. P. T.

    1977-01-01

    A brief introduction to plasma simulation using computers and the difficulties on currently available computers is given. Through the use of an analyzing and measuring methodology - SARA, the control flow and data flow of a particle simulation model REM2-1/2D are exemplified. After recursive refinements the total execution time may be greatly shortened and a fully parallel data flow can be obtained. From this data flow, a matched computer architecture or organization could be configured to achieve the computation bound of an application problem. A sequential type simulation model, an array/pipeline type simulation model, and a fully parallel simulation model of a code REM2-1/2D are proposed and analyzed. This methodology can be applied to other application problems which have implicitly parallel nature.

  5. Optimizing compliance training for the waste management worker

    International Nuclear Information System (INIS)

    Copenhaver, E.D.

    1988-01-01

    Waste management workers are required to participate in special training mandated by a variety of Federal laws and DOE (Department of Energy) Orders; these include the Resource Conservation and Recovery Act (RCRA), Superfund Amendments Reauthorization Act (SARA) as implemented by OSHA (Occupational Safety and Health Administration) in CFR 1910.120, in addition to requirements for Hazard Communication, Radiation Workers, Respiratory Protection, Transportation, and Waste Generator training. The Technical Resources and Training Program is examining the course contents and mandated requirements to determine how to best meld these requirements into a training program that will still fulfill all requirements but eliminate the potential for duplication of some elements in successive courses. This approach may not eliminate all duplication between courses, but it should result in significant savings in man-hours demanded in a training environment which requires similar information to meet a host of regulatory requirements. The training matrix planned for Oak Ridge National Laboratory (ORNL) will be presented and discussed

  6. Full spectrum analysis in environmental monitoring

    International Nuclear Information System (INIS)

    Reinhardt, Sascha; Hartmann, Soeren; Pimpl, Richard

    2015-01-01

    In the environmental monitoring spectroscopic gamma detectors are frequently used. The motivation to use spectroscopic gamma detectors is the higher sensitivity and specific spectral information. For the analysis often the photo peaks of the gamma spectrum are used to identify the nuclide. These methods are very reliable, robust and well developed but using only the photo peak means also to use only a fraction of the available information. Doing a full spectrum analysis based on principle components obtained from NASVD for description of the radiation background and adjustment calculations are a possible analysis method which may provide advantages compared to a peak based analysis when used for a continuous environmental monitoring. An analysis example is shown and discussed with a measured time series of gamma spectra obtained from a spectroscopic gamma detector SARA IGS710 with a NaI(Tl) scintillator as it is used in the environmental monitoring.

  7. Comprehensive Environmental Response, Compensation, and Liability Act, as amended by the Superfund Amendments and Reauthorization Act Section 120(e)(5)

    International Nuclear Information System (INIS)

    1992-05-01

    The US Department of Energy (DOE) is committed to conducting its operations. In a safe and environmentally sound manner. High priorities for the Department are identifying and correcting environmental problems at DOE facilities that resulted from past operations, and preventing environmental problems from occurring during present and future operations. In this regard, the Department is committed to the 30-year goal of cleanup of all facilities by the year 2019. DOE has issued an Order and guidance establishing policy and procedures for activities conducted under the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), as amended by the Superfund Amendments and Reauthorization Act (SARA), and has developed a Five-Year Plan, updated annually, that integrates planing for corrective activities, environmental restoration, and waste management operations at its facilities. During Calendar Year 1991 and early 1992, DOE made significant progress in reaching agreements with regulatory entities, undertaking cleanup actions, and initiating preventive measures designed to eliminate future environmental problems. These accomplishments are described

  8. Transfer of 137Cs from soil to plants in different types of soils

    International Nuclear Information System (INIS)

    Todorovic, D.; Radenkovic, M.; Popovic, D.; Djuric, G.

    1998-01-01

    The investigations were carried out in two mountainous regions in the West and South region of the country). Three main types of soils were examined: shale, limestone and the mixed type, and several plants: grass, meadow flora, pinewood, blueberries, an endemic species of Mt. Sara and the bioindicators: moss and lichen. The transfer factors lay in the range of 0.1 - 2.0 in dependence on the type of soil and plant (3.0 - 10.0 for the bioindicator plants). The vertical distribution of 13' 7Cs in the first 15 cm layer of the soil indicates a slow migration of Chernobyl cesium through soil, except on riversides where the wash-out effect plays a role. Generally, the concentration of 137 Cs in soils strongly depends on the configuration of the ground

  9. Reviews of recent publications

    Directory of Open Access Journals (Sweden)

    2009-06-01

    Full Text Available Sara Lennox. Cemetery of the Murdered Daughters: Feminism, History, and Ingeborg Bachmann by Kristin T. Vander Lugt Birgit Tautz. Reading and Seeing Ethnic Differences in the Enlightenment: From China to Africa by Susanne Kelley Patrick Greaney. Untimely Beggar. Poverty and Power from Baudelaire to Benjamin by Christine Rinne Philip Payne, Graham Bartram, and Galin Tihanov, eds. A Companion to the Works of Robert Musil by Geoffrey C. Howes Jennifer Willging. Telling Anxiety: Anxious Narration in the Work of Marguerite Duras, Annie Ernaux, Nathalie Sarraute and Anne Hébert by Natalie Edwards Michael Lucey. Never Say I: Sexuality and the First Person in Colette, Gide, and Proust by Elissa Gelfand Anthony Waine. Changing Cultural Tastes. Writers and the Popular in Modern Germany by Katrin Völkner Susan Ireland and Patrice Proulx, eds. Textualizing the Immigrant Experience in Contemporary Quebec by Amy Hubbell Cristina Peri Rossi. State of Exile . Trans. Marilyn Buck. by Reina Ruiz

  10. 14C SIRI samples at CNA: Measurements at 200 kV and 1000 kV

    International Nuclear Information System (INIS)

    Santos Arévalo, Francisco-Javier; Gómez Martínez, Isabel; Agulló García, Lidia

    2015-01-01

    The Sixth International Radiocarbon Intercomparison (SIRI) exercise has taken place during late 2013 and 2014. 13 samples were distributed for AMS (Accelerator Mass Spectrometry) and 5 for radiometric laboratories, including one sample exclusively for radiometric laboratories. Being the first opportunity for our laboratory to participate actively in an intercomparison exercise, we have prepared and measured the samples in the two existing AMS dedicated facilities at the Centro Nacional de Aceleradores (CNA): SARA (Spanish Accelerator for Radionuclide Analysis), a 1 MV multielemental AMS system from HVEE, and Micadas, a 200 kV radiocarbon dating system designed by ETH. Results are presented for the two systems, together with a description of both the sample preparation and measurement procedures.

  11. {sup 14}C SIRI samples at CNA: Measurements at 200 kV and 1000 kV

    Energy Technology Data Exchange (ETDEWEB)

    Santos Arévalo, Francisco-Javier, E-mail: fj.santos@csic.es; Gómez Martínez, Isabel; Agulló García, Lidia

    2015-10-15

    The Sixth International Radiocarbon Intercomparison (SIRI) exercise has taken place during late 2013 and 2014. 13 samples were distributed for AMS (Accelerator Mass Spectrometry) and 5 for radiometric laboratories, including one sample exclusively for radiometric laboratories. Being the first opportunity for our laboratory to participate actively in an intercomparison exercise, we have prepared and measured the samples in the two existing AMS dedicated facilities at the Centro Nacional de Aceleradores (CNA): SARA (Spanish Accelerator for Radionuclide Analysis), a 1 MV multielemental AMS system from HVEE, and Micadas, a 200 kV radiocarbon dating system designed by ETH. Results are presented for the two systems, together with a description of both the sample preparation and measurement procedures.

  12. 14C SIRI samples at CNA: Measurements at 200 kV and 1000 kV

    Science.gov (United States)

    Santos Arévalo, Francisco-Javier; Gómez Martínez, Isabel; Agulló García, Lidia

    2015-10-01

    The Sixth International Radiocarbon Intercomparison (SIRI) exercise has taken place during late 2013 and 2014. 13 samples were distributed for AMS (Accelerator Mass Spectrometry) and 5 for radiometric laboratories, including one sample exclusively for radiometric laboratories. Being the first opportunity for our laboratory to participate actively in an intercomparison exercise, we have prepared and measured the samples in the two existing AMS dedicated facilities at the Centro Nacional de Aceleradores (CNA): SARA (Spanish Accelerator for Radionuclide Analysis), a 1 MV multielemental AMS system from HVEE, and Micadas, a 200 kV radiocarbon dating system designed by ETH. Results are presented for the two systems, together with a description of both the sample preparation and measurement procedures.

  13. Comparison between four blackberry (Rubus sp.) cultivars to light variation

    International Nuclear Information System (INIS)

    Enciso, B.E.; Gómez, C.

    2004-01-01

    Abstract: This paper compares four Colombian blackberry cultivars- (Rubus sp.) light compensation points, leaf area, chlorophyll concentration and photosynthetic capacity. Time can be saved and efficiency improved by adapting different cultivars to differing luminosity once these parameters have been determined and established. The four cultivars involved were -Guarne-, -San Antonio-, -Sara 3- and -Pacho 2- forming part of Corpoica-s blackberry collection at the Sena farm in Manizales. The results revealed that all four cultivars had different light compensation points. They also showed that net photosynthesis varied amongst cultivars, even when grown in the same environmental conditions and that total chlorophyll and leaf area may be used as indicators of response to the conditions being evaluated. Key words: Photosynthesis, leaf area, radiation, compensation point, photons flow density (PFD), chlorophyll [es

  14. Work Plan for the Feasibility Study for Remedial Action at J-Field, Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    Benioff, P.; Biang, C.; Haffenden, R.; Goyette, M.; Martino, L.; Patton, T.; Yuen, C.

    1995-05-01

    The purpose of the feasibility study is to gather sufficient information to develop and evaluate alternative remedial actions to address contamination at J-Field in compliance with the NCP, CERCLA, and SARA. This FS Work Plan summarizes existing environmental data for each AOC and outlines the tasks to be performed to evaluate and select remedial technologies. The tasks to be performed will include (1) developing remedial action objectives and identifying response actions to meet these objectives; (2) identifying and screening remedial action technologies on the basis of effectiveness, implementability, and cost; (3) assembling technologies into comprehensive alternatives for J-Field; (4) evaluating, in detail, each alternative against the nine EPA evaluation criteria and comparing the alternatives to identify their respective strengths and weaknesses; and (5) selecting the preferred alternative for each operable unit.

  15. Risk-based management system development for the Advanced Test Reactor

    International Nuclear Information System (INIS)

    Davis, M.L.; Eide, S.A.

    1990-01-01

    A Risk-Based Management System (RBMS) is being developed to facilitate the use of the Advanced Test Reactor (ATR) probabilistic risk assessment to support ATR operation. Most ATR RBMS questions can best be answered using the System Analysis and Risk Assessment System (SARA) developed at the Idaho National Engineering Laboratory. However, some applications may require employment of the other four codes used to develop and report the PRA. These four codes include the Integrated Reliability and Risk Analysis System (IRRAS), SETS, ETA-II, and the Nuclear Computerized Library for Assessing Reactor Reliability (NUCLARR). The ATR RBMS will evolve over three years, and will include the results of the Level 3 and external events analysis

  16. Study and realization of a parallel plate avalanche counter used for time of flight and localization measurements

    International Nuclear Information System (INIS)

    Pellegrin, P.O.

    1985-01-01

    A parallel Plates Avalanche Counter (P.P.A.C.) allowing high resolution training and localization is studied. It is designed to be placed on the beam trajectory-including the magnetic spectrometer of SARA accelerator at ISN Grenoble. Two purposes are searched: firstly to improve the time-of-flight measurement due to the very high intrinsic time resolution (it can be less than 150 ps), secondly to measure with accuracy the scattering angle of the particle on the target, due to its localization. The detector thickness has been reduced to set aside as unimportant the disturbance produced on the particle trajectory. The theoretical aspect of the detector operation and a quantitative study of the disturbances it causes on particle energy are presented. The set-up and its necessary surroundings are described with experimental results of its characteristics [fr

  17. Measurement of the plastic scintillator response to heavy ions, between 0 to 30 MeV/N

    International Nuclear Information System (INIS)

    Dorion, I.

    1984-01-01

    The light produced in a plastic scintillator depends on particle nature and energy. Theoretical models predict a linear behavior of the light output response for high energy heavy ions. An experimental set-up was realised in order to perform the integral and, in some case, the differential measurement of the light yield in a plastic scintillator (NE102) stopping 6 Li, 12 C, 16 O, 20 Ne, 40 Ar ions given by SARA, with particle incident energy from 3 to 30 MeV per nucleon. The plastic resolution was also measured. The data analysis leads to experimental results which are in good agreement with the predictions. Taking into account resolution value, the use of plastic scintillator in detection system allows in some case, particle identification [fr

  18. Multi-band photometric study of the short-period eclipsing binary GR Boo

    Science.gov (United States)

    Wang, Daimei; Zhang, Liyun; Han, Xianming L.; Lu, Hongpeng

    2017-05-01

    We present BVRI light curves with complete phase coverage for the short-period (p = 0.377day) eclipsing binary star GR Boo. We carried out the observations using the SARA 90 cm telescope located at Kitt Peak National Observatory. We obtained six new light curve minimum times. By fitting all of the available O-C minimum times, we obtained an updated ephemeris that shows the orbital period of GR Boo is decreasing at a rate of P˙ = - 2.36 ×10-7 days/year. This decrease in its period can be explained by either mass transfer from the more massive component to the less massive one, or angular momentum exchange due to magnetic activities. We also obtained a set of revised orbital parameters using the Wilson & Devinney program. And finally, we concluded that GR Boo is a contact binary with a dark spot.

  19. Experimental research of isospin and spin exotic nuclei with an ion guide and γ multidetectors

    International Nuclear Information System (INIS)

    Astier, A.

    1992-04-01

    This work is concerned with nuclear studies of isospin and spin exotic nuclei by two complementary approaches: on-line radioactivity and fusion-evaporation reactions. An ion guide coupled to the SARA accelerator allowed the study of very refractory and short lived (down to 1 ms) elements. Using the 238 U (α 40 MeV, f) reaction to produce very neutron-rich radioisotopes, all mass chains from A=96 to 122 have been scanned by conventional nuclear spectroscopy. More than 60 production yields have been measured. The comparison of proton and α induced fission yields shows the predominance of symmetric fission around A=115 for α beam. The collective high spin states structures observed in the A=190 mass region are studied with different γ multidetectors

  20. Spain's marketing sector seeing more changes

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    This paper reports that Spain's petroleum marketing sector continues to restructure. Partly state owned Repsol SA and Royal Dutch/Shell Group are discussing supplying each other's retail outlets in the UK and Spain. And Portugal's state owned Petroleos de Portugal (Petrogal), seeking to sharply expand retail operations in Spain, complains of government interference with foreign investment in Spanish marketing. Meantime, Conoco Inc. Has agreed with Saras SpA Raffinerie Sarde, Milan, to set up a network of service stations in northern Spain and Portugal at a cost of 100 billion pesetas (%972 million). The two are considering building an oil terminal at the port city of Gijon in Asturias, Spain, and the Exxon Corp., Total, and Shell are interested in participating in the project

  1. The States Training and Education Program (STEP): A success story of Department of Energy (DOE) interacting with other state and federal agencies

    International Nuclear Information System (INIS)

    Kouba, S.C.; Eaton, O.W.

    1990-01-01

    DOE facilities, if not already faced with the need, could be confronted with the necessity of or request to train civil authorities near DOE facilities. SARA Title 3 and the recent high visibility of DOE safety programs have prompted civil authorities to seek out specialized emergency response training for their community's first responders. In 1988, the states through which the DOE is scheduled to transport transuranic (TRU) waste for disposal at the Waste Isolation Pilot Plant expressed the concerns that their fire, medical, and law enforcement personnel were not prepared to handle an accident involving shipments of TRU waste. In response, the DOE authorized their contractor, Westinghouse Electric Corporation, to develop and deliver a training program to emergency responders along the transportation routes to mitigate this specific institutional concern. The lessons learned by DOE and Westinghouse in creating, coordinating, and delivering this program could be modified to apply to the concerns of governmental jurisdictions, including adjoining DOE facilities

  2. The Gift Network: Dave Eggers and the Circulation of Second Editions

    Directory of Open Access Journals (Sweden)

    Jacqueline O’Dell

    2017-07-01

    Full Text Available This article argues for a view of the gift as an affective network and investigates how Dave Eggers’s practice of publishing second editions works to produce this network. Framing my discussion of the gift with Sara Ahmed’s work on affective economies, I suggest that the gift, like affect, is best understood as a surplus effect of circulation. I argue that Eggers negotiates the gift’s double bind by emphasizing the impossibility of identifying a “pure” gift or an authoritative “original” edition; his double editions show how the gift survives through the surplus values generated by their ongoing circulation. Eggers's symbolic and material gift network ultimately depends on the uncertainty and mystification emblematic of Eggers’s anxious aesthetic and mode of recirculation, adding to critical conversations that position Eggers’s aesthetic within movements of new sincerity or post-irony.

  3. Cesarean section after abdominal mesh repair for pregnancy-related desmoid tumor: a case report

    Directory of Open Access Journals (Sweden)

    Ooi S

    2017-07-01

    Full Text Available Sara Ooi, Harry Ngo Obstetrics and Gynaecology Department, Liverpool Hospital, Liverpool, NSW, Australia Abstract: We report the case of a 32-year-old gravida 2 para 1 woman with a background of partially resected desmoid tumor (DT arising from the previous cesarean section (CS scar. This case details the management of her DT by surgical resection and mesh repair and second pregnancy following this. Pregnancy-related DTs are a relatively rare entity, and there is a paucity of literature regarding their management during pregnancy. There are only five reported cases of DTs arising from CS scars. To our knowledge, this is the only report to illustrate that subsequent CS is possible after desmoid resection and abdominal mesh repair. It provides evidence that CS can be safely accomplished following abdominal wall reconstructions and further arguments against elective lower segment CS. Keywords: abdominal wall, cesarean section, complications, desmoid tumor, surgical mesh

  4. Evaluation of immunomodulatory activity of “Shirishavaleha”–An Ayurvedic compound formulation in albino rats

    Science.gov (United States)

    Yadav, Shyamlal Singh; Galib; Prajapati, P. K.; Ashok, B. K.; Ravishankar, B.

    2011-01-01

    The immunomodulatory activity of Shirishavaleha prepared from two different parts of Shirisha (Albizia lebbeck Benth), i.e., Twak (Bark) and Sara (Heartwood) as main ingredients was evaluated for humoral antibody formation and cell-mediated immunity in established experimental models. The study used Wistar rats of either sex weighing 200 ± 40 g, while the test drug was administered orally at a dose of 1.8 g/kg. Hemagglutination titer and body weight were recorded to assess effects on humoral immunity; immunological paw edema was assessed for cell-mediated immunity. Shirishavaleha prepared from heartwood shows significant enhancement in antibody formation, attenuation of body weight changes, and suppression of immunological paw edema, while Shirishavaleha prepared from bark shows weak immunomodulatory activity. The study therefore concludes that Shirishavaleha prepared from heartwood has significant immunomodulatory activity. PMID:22253509

  5. Evaluation of immunomodulatory activity of " Shirishavaleha"-An Ayurvedic compound formulation in albino rats

    Directory of Open Access Journals (Sweden)

    Shyamlal Singh Yadav

    2011-01-01

    Full Text Available The immunomodulatory activity of Shirishavaleha prepared from two different parts of Shirisha (Albizia lebbeck Benth, i.e., Twak (Bark and Sara (Heartwood as main ingredients was evaluated for humoral antibody formation and cell-mediated immunity in established experimental models. The study used Wistar rats of either sex weighing 200 ± 40 g, while the test drug was administered orally at a dose of 1.8 g/kg. Hemagglutination titer and body weight were recorded to assess effects on humoral immunity; immunological paw edema was assessed for cell-mediated immunity. Shirishavaleha prepared from heartwood shows significant enhancement in antibody formation, attenuation of body weight changes, and suppression of immunological paw edema, while Shirishavaleha prepared from bark shows weak immunomodulatory activity. The study therefore concludes that Shirishavaleha prepared from heartwood has significant immunomodulatory activity.

  6. Anti-inflammatory activity of Shirishavaleha: An Ayurvedic compound formulation.

    Science.gov (United States)

    Yadav, Shyamlal Singh; Galib; Ravishankar, B; Prajapati, P K; Ashok, B K; Varun, B

    2010-10-01

    The purpose of the present study was to evaluate the anti-inflammatory activity of Shirishavaleha prepared from two different parts of Shirisha (Albizia lebbeck Benth.), viz. the bark (Twak) and the heartwood (Sara). The activity was screened in the carrageenan-induced rat paw edema model in albino rats. The raw materials were collected and authenticated in the university and the trial formulations were prepared by following standard classical guidelines. Randomly selected animals were divided into four groups of six animals each. The test drugs were administered orally at a dose of 1.8 g/kg for 5 days. Phenylbutazone was used as the standard anti-inflammatory drug for comparison. Between the two different test samples studied, the formulation made from heartwood showed a weak anti-inflammatory activity in this model while that made from the bark produced a considerable suppression of edema after 6 h. It appears that the bark sample would be preferable for clinical use.

  7. Evaluation of immunomodulatory activity of "Shirishavaleha"-An Ayurvedic compound formulation in albino rats.

    Science.gov (United States)

    Yadav, Shyamlal Singh; Galib; Prajapati, P K; Ashok, B K; Ravishankar, B

    2011-10-01

    The immunomodulatory activity of Shirishavaleha prepared from two different parts of Shirisha (Albizia lebbeck Benth), i.e., Twak (Bark) and Sara (Heartwood) as main ingredients was evaluated for humoral antibody formation and cell-mediated immunity in established experimental models. The study used Wistar rats of either sex weighing 200 ± 40 g, while the test drug was administered orally at a dose of 1.8 g/kg. Hemagglutination titer and body weight were recorded to assess effects on humoral immunity; immunological paw edema was assessed for cell-mediated immunity. Shirishavaleha prepared from heartwood shows significant enhancement in antibody formation, attenuation of body weight changes, and suppression of immunological paw edema, while Shirishavaleha prepared from bark shows weak immunomodulatory activity. The study therefore concludes that Shirishavaleha prepared from heartwood has significant immunomodulatory activity.

  8. Full spectrum analysis in environmental monitoring

    International Nuclear Information System (INIS)

    Reinahrdt, S.; Hartmann, S.; Pimpl, R.

    2014-01-01

    In the environmental monitoring spectroscopic gamma detectors are frequently used. The motivation to use spectroscopic gamma detectors is the higher sensitivity and specific spectral information. For the analysis often the photo peaks of the gamma spectrum are used to identify the nuclide. These methods are very reliable, robust and well developed but using only the photo peak means also to use only a fraction of the available information. Doing a full spectrum analysis based on principal components obtained from NASVD for description of the radiation background and adjustment calculations are a possible analysis method, which may provide advantages compared to a peak based analysis when used for a continuous environmental monitoring. An analysis example is shown and discussed with a measured time series of gamma spectra obtained from a spectroscopic gamma detector SARA IGS710 with a NaI(Tl) scintillator as it is used in the environmental monitoring. (authors)

  9. The use of a heat transfer coefficient for describing the radiative exchange between water vapour and the bounding walls

    International Nuclear Information System (INIS)

    Eifler, W.; Shepherd, I.M.

    1983-01-01

    During the ''severe-fuel-damage'' experiments of the SUPER SARA test program radiation heat transfer will play an important part. For the analysis of these experiments it should be modelled therefore in a particularly appropriate manner. Based on the same engineering type principles which are used in the radiation model of the TRAC code version for boiling water reactors a new model has been developed. This model is less computer time consuming than the TRAC model and particularly appropriate for the use in the subchannel - type bundle computer code which is planned to be developed for the analysis of the ''severe-fuel-damage'' experiments. Sample calculations for the ''severe-fuel-damage'' test array show that the difference between the results obtained with the new model and those obtained with the TRAC model is in general not significant

  10. Investigation of the Gas Injection Effect on Asphaltene Onset Precipitation Using the Cubic-Plus-Association Equation of State

    DEFF Research Database (Denmark)

    Arya, Alay; von Solms, Nicolas; Kontogeorgis, Georgios M.

    2016-01-01

    Miscible and immiscible gas flooding is one of the enhanced oil recovery (EOR) techniques that has been widely used to increase the oil production. One of the critical problems with gas flooding is that it generally aggravates the asphaltene precipitation, which further creates a flow assurance...... dependency upon the saturates, aromatics, resins, and asphaltenes (SARA) analysis or molecular weight (MW) of asphaltene is also analyzed. In addition, a unique characteristic of the model for the given stock tank oil (STO) is identified, which does not change with different types and amounts of gas...... injections and also remains the same at upper and lower onset pressure boundaries. On the basis of this unique characteristic, a simple procedure to predict asphaltene phase envelope (APE) for the reservoir oil with relatively simple and few experimental data, performed on STO with n...

  11. Propostas em ventilação mecânica na síndrome da angústia respiratória Propuestas en ventilación mecánica en la síndrome de angustia respiratoria Mechanical ventilatory management in adult respiratory distress syndrome

    Directory of Open Access Journals (Sweden)

    José Otávio Costa Auler Junior

    2001-12-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: O objetivo deste artigo é oferecer ao leitor um resumo das normas já consagradas pela literatura a respeito da estratégia atual do manuseio da ventilação durante a Síndrome da Angústia Respiratória Aguda (SARA. Isto é de fundamental importância, já que a ventilação mecânica, como medida terapêutica, tem estado sob constante revisão e muitos artigos têm sido publicados a este respeito. CONTEÚDO: Este trabalho contém a revisão de 29 artigos e um livro, selecionados a partir de pesquisa de palavras-chaves realizada no MEDLINE. CONCLUSÕES: Muito se tem publicado a respeito de ventilação em SARA, porém, tende-se para uma estratégia de proteção pulmonar baseada em baixo volume corrente e altos níveis de PEEP. Outras medidas adjuvantes seriam tomografias computadorizadas seriadas de tórax, ajuste de PaO2, inalação de óxido nítrico, posição prona e ECMO (extracorporeal membrane oxygenation.JUSTIFICATIVA Y OBJETIVOS: El objetivo de este artículo es ofrecer al lector un resumen de las normas ya consagradas por la literatura a respecto de la estrategia actual del manoseo de la ventilación durante la Síndrome de la Angustia Respiratoria Aguda (SARA. Esto es de fundamental importancia, ya que la ventilación mecánica, como medida terapéutica, ha estado bajo constante revisión, muchos artículos han sido publicados a este respecto. CONTENIDO: Este trabajo contiene la revisión de 29 artículos y un libro, seleccionados a partir de la pesquisa de palabras-claves realizada en el MEDLINE. CONCLUSIONES: Mucho se ha publicado a respecto de ventilación en SARA, sin embargo, la tendencia es para una estrategia de protección pulmonar tomando como base el bajo volumen corriente y altos niveles de PEEP. Otras medidas de ayuda serian tomografías computadorizadas seriadas de tórax, ajuste de PaO2, inhalación de óxido nítrico, posición prono y ECMO (extracorporeal membrane oxygenation

  12. Propostas em ventilação mecânica na síndrome da angústia respiratória

    OpenAIRE

    Auler Junior, José Otávio Costa; Bliacheriene, Fernando; Miyoshi, Erika; Fernandes, Cláudia Regina

    2001-01-01

    JUSTIFICATIVA E OBJETIVOS: O objetivo deste artigo é oferecer ao leitor um resumo das normas já consagradas pela literatura a respeito da estratégia atual do manuseio da ventilação durante a Síndrome da Angústia Respiratória Aguda (SARA). Isto é de fundamental importância, já que a ventilação mecânica, como medida terapêutica, tem estado sob constante revisão e muitos artigos têm sido publicados a este respeito. CONTEÚDO: Este trabalho contém a revisão de 29 artigos e um livro, selecionados a...

  13. Computerized systems for high level information processing and decision making in the field of PSA

    International Nuclear Information System (INIS)

    Kafka, P.; Kunitz, H.

    1990-01-01

    A comprehensive review of Probabilistic Safety Assessment (PSA) related program packages is made. Three fields in methodological succession are covered: plant modeling, data quantification procedures and decision-making support. Packages for fault tree construction and minimal cut sets evaluation are referred to and the performances of three of them: RALLY, ORCHARD and SALP-PC, are discussed and compared. Notions on the raw data sources are presented and the Nuclear Computerized Library for Assessing Reactor Reliability (NUCLARR) is given as an example for data base management system generating PSA data. Aggregated risk models for support in safety assessment, plant operation and accident management (SARA, ESSM, PRISIM) are cited. Examples of systems supporting 'living PSA' (SAIS, SUPER-NET, LESSEPS 1300, NUPRA, SPSA) are given. The concluding remarks outline the state-of-the-art developments of computerized systems for reliability analyses. 1 fig., 1 tab., 51 refs. (R.Ts)

  14. Activities in department of energy hazardous and mixed waste defense waste management

    International Nuclear Information System (INIS)

    Eyman, L.D.

    1988-01-01

    In January 1986, the U.S. Department of Energy (DOE) Office of Assistant Secretary for Defense Programs (DP) created the Hazardous Waste and Remedial Actions Division within the Office of Defense Waste and Transportation Management. The Oak Ridge Operations Office (ORO) was assigned the responsibility for supporting DOE Headquarters (HQ) in planning nationally integrated activities for Resource Conservation and Recovery Act/Comprehensive Environmental Response, Compensation, and Liability Act/Superfund Amendments and Reauthorization Act (RCRA/CERCLA/SARA) compliance. In turn, ORO created the Hazardous Waste Remedial Actions Program Support Contractor Office (HAZWRAPSCO) to assist with the expanded lead assignment. The HAZWRAPSCO activities are currently supported by three distinct DOE-HQ funding elements: the Environmental Restoration Program, the Hazardous Waste Compliance Technology Program, and the Hazardous Waste Research and Development R and D Program. The Environmental Restoration Program is discussed in the paper, entitled The DOE Defense Program for Environmental Restoration

  15. "doing and Undoing Gender": Female Higher Education in the Islamic Republic of Iran

    Science.gov (United States)

    Mehran, Golnar

    2009-11-01

    Since the establishment of the Islamic Republic, female higher education has been characterised by a paradoxical combination of discrimination and exclusion, on the one hand, and increasing equality and empowerment, on the other. This study focuses on the triangle of education, equality and empowerment, using Sara Longwe's women's empowerment framework to analyse the interplay between the three. State policies to Islamise the universities during the 1980-1983 Cultural Revolution determined the "gender appropriateness" of each specialisation and led to the exclusion of women from "masculine" fields of study during the early years of the revolution. Despite such discriminatory measures, women today represent the majority of students in all fields, except engineering. Women, however, remain underrepresented at graduate levels of education and as faculty members. An important challenge is to understand why men are not entering different specialisations and whether there is a possibility of "re-doing gender" - this time in addressing male inequality and disempowerment at undergraduate levels.

  16. Compositional Simulation of In-Situ Combustion EOR: A Study of Process Characteristics

    DEFF Research Database (Denmark)

    Jain, Priyanka; Stenby, Erling Halfdan; von Solms, Nicolas

    2010-01-01

    In order to facilitate the study of the influence of reservoir process characteristics in In-Situ combustion modeling and advance the work of Kristensen et al. in this domain; a fully compositional In-situ combustion (ISC) model of Virtual Kinetic Cell (VKC; single-cell model) for laboratory scale....... This incorporates fourteen pseudo components and fourteen reactions (distributed amongst thermal cracking, low temperature oxidation and high temperature oxidation). The paper presents a set of derivative plots indicating that reservoir process characterization in terms of thermal behavior of oil can be well...... construed in terms of thermo-oxidative sensitivity of SARA fractions. It can be interpreted from the results that operating parameters like air injection rate, oxygen feed concentration and activation energy have significant influence on oil recovery; an increase in air injection rate can lead to cooling...

  17. A 90 años de la fundación de la Liga Feminista Costarricense: los derechos políticos

    Directory of Open Access Journals (Sweden)

    Marta E. Solano Arias

    2014-01-01

    Full Text Available : Repaso de los derechos políticos de las mujeres con motivo del 90 aniversario de la fundación de la Liga Feminista Costarricense el 12 de octubre de 1923 en el Colegio Superior de Señoritas. El artículo ofrece un breve recorrido histórico de la participación de mujeres en hechos sociales y políticos relacionados con procesos electorales y la demanda del derecho el sufragio para las mujeres durante las primeras décadas del siglo XX y hasta 1925 en Costa Rica. Destaca algunas acciones de dos sufragistas descollantes durante los años 1912 a 1925, Ángela Acuña y Sara Casal.

  18. Exoplanet atmospheres physical processes

    CERN Document Server

    Seager, Sara

    2010-01-01

    Over the past twenty years, astronomers have identified hundreds of extrasolar planets--planets orbiting stars other than the sun. Recent research in this burgeoning field has made it possible to observe and measure the atmospheres of these exoplanets. This is the first textbook to describe the basic physical processes--including radiative transfer, molecular absorption, and chemical processes--common to all planetary atmospheres, as well as the transit, eclipse, and thermal phase variation observations that are unique to exoplanets. In each chapter, Sara Seager offers a conceptual introduction, examples that combine the relevant physics equations with real data, and exercises. Topics range from foundational knowledge, such as the origin of atmospheric composition and planetary spectra, to more advanced concepts, such as solutions to the radiative transfer equation, polarization, and molecular and condensate opacities. Since planets vary widely in their atmospheric properties, Seager emphasizes the major p...

  19. STUDI KUALITATIF TENTANG AKTIVITAS ETNOMATEMATIKA DALAM KEHIDUPAN MASYARAKAT TOLAKI

    Directory of Open Access Journals (Sweden)

    Sitti Fatimah S Sirate

    2017-11-01

    Full Text Available The article aims at discovering the form of ethno-mathematics activity that exist in Tolaki society at Southeast Sulawesi. This study is a qualitative descriptive research that describe 6 basic activities of Tolaki’s society (1 counting, (2 measuring, (3 deciding location, (4 designing, (5 playing, (6 explaining. The data collection was conducted through observation, interview, and docu-mentation. The data were then analyzed based on logical analysis. The results of the research shows that Tolaki society still maintain the traditional of kalo sara which is part of the six basic activities of Tolaki society well known as ethnomathematics. The writer expected that the Tolaki culture should be maintained as local culture heritage that enrich the national culture.

  20. Attending to others: how digital technologies direct young people's nightlife

    Directory of Open Access Journals (Sweden)

    J. Truong

    2018-05-01

    Full Text Available It is a growing phenomenon that young people use mobile information and communication technologies during their nightlife. This article offers an empirical examination of how young people's nightlife is shaped by engagement with the mobile phone application WhatsApp. Drawing on Sara Ahmed's phenomenological concept of orientation, I examine how WhatsApp extends young people's nightlife and how young people become orientated therein. On the one hand, I show that nightlife acquires new boundaries and fixities that encourage young people to direct their attention towards missing social relations and absent nightlife places. On the other hand, I find that young people create new perceptions of how to inhabit and spend leisure time and space. I argue that digital technologies reorientate young people, which I suggest offers novel means of addressing young people's contemporary nightlife practices, places, spaces, and social relations.