WorldWideScience

Sample records for sara ariano laura

  1. The Invention of the Jury in " The Auto Mary " by Ariano Suassuna

    Directory of Open Access Journals (Sweden)

    Ezilda Claudia de Melo

    2016-06-01

    Full Text Available It identified the intersections between the jury and literature , the "Auto da Compadecida " Ariano Suassuna . He embarked at the intersection field between law and Literary Arts to identify the characters, ritual and emotion in the jury of the show presented by him . The trial is the real key to understanding this work and is the intersection point of this research, with the law as it is intended to relate the institution of the jury from the buildings Ariano Suassuna . It was concluded that emotionality gives on the rationality of the jury.

  2. News developments at Sara

    International Nuclear Information System (INIS)

    Belmont, J.L.; Fruneau, M.; Martin, P.

    1989-05-01

    SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration

  3. 2012 SARA Students Technical Report

    International Nuclear Information System (INIS)

    Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet

    2012-01-01

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of

  4. 2012 SARA Students Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

    2012-07-30

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the

  5. The SARA REU Site Program

    Science.gov (United States)

    Wood, M. A.; Oswalt, T. D.; SARA Collaboration

    2000-12-01

    We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.

  6. Põletavatest küsimustest / Laura Kuusk

    Index Scriptorium Estoniae

    Kuusk, Laura, 1982-

    2007-01-01

    Eesti Kunstiakadeemia magistrantide põlevkiviteemaline näitus "Depressioon" Rael Arteli galeriis Tartus kuni 4. veebruarini. Laura Pählapuu, Siiri Taimla, Risto Tali, Tõnu Narro, Alina Korsmiku ja Mikk Freibergi töödest

  7. LAURA Users Manual: 5.2-43231

    Science.gov (United States)

    Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, Bil

    2009-01-01

    This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintainability by eliminating the requirement for problem-dependent re-compilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multiphysics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the FUN3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU-standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.

  8. Laura Users Manual: 5.1-41601

    Science.gov (United States)

    Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, Bil

    2009-01-01

    This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintainability by eliminating the requirement for problem-dependent re-compilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multiphysics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the FUN3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU-standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.

  9. LAURA Users Manual: 5.3-48528

    Science.gov (United States)

    Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Chirstopher O.; Kleb, Bil

    2010-01-01

    This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintainability by eliminating the requirement for problem-dependent re-compilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multi-physics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the FUN3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU-standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.

  10. LAURA Users Manual: 5.5-64987

    Science.gov (United States)

    Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, William L.

    2013-01-01

    This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintain ability by eliminating the requirement for problem dependent recompilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multi-physics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the Fun3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.

  11. LAURA Users Manual: 5.4-54166

    Science.gov (United States)

    Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, Bil

    2011-01-01

    This users manual provides in-depth information concerning installation and execution of Laura, version 5. Laura is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 Laura code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintainability by eliminating the requirement for problem dependent re-compilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multi-physics coupling. As a result, Laura now shares gas-physics modules, MPI modules, and other low-level modules with the Fun3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU-standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.

  12. Sara

    International Nuclear Information System (INIS)

    Aparo, M.; Dionisi, M.; Vicini, C.; Zeppa, P.; Frazzoli, F.V.; Remetti, R.; Portale, C.

    1989-01-01

    Nuclear Material Accountability, supported by Containment and Surveillance measures, is a foundamental means for an effective International Safeguard implemention in nuclear plants. Accountability is based on the verification that difference between a material quantity entering a given material balance and the quantity leaving that area in a given period of time, correspond and the amount of material actually present at the moment of the inspection. In the recent years International Safeguards appealing to the needs of timeliness in detecting diversion and concealing activities, devoted ReD efforts on a new Dynamic Accountability procedures (NRTMA) with particular concern with reprocessing plants. The present paper, which is the result of a research activity carried out in the frame of the Italian Support Programme to IAEA for Safeguards implementation, deals with a feasibility study of a NRTMA system to be applied to the EUREX pilot reprocessing plant. Such a feasibility study was performed by developing a computer program based on simulated plant generated data

  13. Laura Kallasvee ei aja kärbseid pähe / Laura Kallasvee ; intervjueerinud Margit Tõnson

    Index Scriptorium Estoniae

    Kallasvee, Laura, 1979-

    2010-01-01

    Laura Kallasvee fotostuudiost, postkaardiseeriast "Lubadused", raamatust "Toit. Kirg", digifotograafiast, inspiratsiooniallikatest, moefotode pildistamisest, ebaprofessionaalsusest visuaalses ruumis, fotogeenilisusest

  14. Kunstnikuraamatud / Paul Kuimet, Dénes Kalev Farkas, Laura Kuusk ; intervjueerinud Laura Kuusk, Kristel Schwede

    Index Scriptorium Estoniae

    Kuimet, Paul, 1984-

    2016-01-01

    Paul Kuimet, Dénes Kalev Farkas ja Laura Kuusk räägivad, kuidas valmisid nende kunstnikuraamatud ja mis oli projekti tõukejõuks. Paul Kuimeti fotoraamat "In Vicinity", Dénes Kalev Farkasi raamatud "Evident in Advance" ja "Credo", Laura Kuuse raamat "Pop-up-book"

  15. Laura: Soybean variety lacking Kunitz trypsin inhibitor

    Directory of Open Access Journals (Sweden)

    Srebrić Mirjana

    2010-01-01

    Full Text Available Grain of conventional soybean varieties requires heat processing to break down trypsin inhibitor's activity before using as food or animal feed. At the same time, protein denaturation and other qualitative changes occur in soybean grain, especially if the temperature of heating is not controlled. Two types of trypsin inhibitor were found in soybean grain the Kunitz trypsin inhibitor and the Bowman-Birk inhibitor. Mature grain of soybean Laura is lacking Kunitz trypsin inhibitor. Grain yield of variety Laura is equal to high yielding varieties from the maturity group I, where it belongs. Lacking of Kunitz-trypsin inhibitor makes soybean grain suitable for direct feeding in adult non ruminant animals without previous thermal processing. Grain of variety Laura can be processed for a shorter period of time than conventional soybeans. This way we save energy, and preserve valuable nutritional composition of soybean grain, which is of interest in industrial processing.

  16. ACHP | News | Laura Bush Announces Preserve America Grants Budget

    Science.gov (United States)

    Search skip specific nav links Home arrow News arrow Laura Bush Announces Preserve America Grants Budget Laura Bush Announces Preserve America Grants Budget First Preserve America Communities Also Announced ) Jan. 15, 2004, Washington, DC—Mrs. Laura Bush announced today that the President's budget for FY 2005

  17. Fotograafid loevad ja tekstlevad / Laura Kuusk

    Index Scriptorium Estoniae

    Kuusk, Laura, 1982-

    2008-01-01

    Kollektiivne näituseprojekt "Minnes vastu lugejate soovidele" Tartu Linnaraamatukogu keldris tegutsevas Rael Artel Gallerys. Ühisnäitusel osalesid noored fotograafid Kristiina Hansen, Taaniel Raudsepp, Krõõt Tarkmeel ja Laura Toots ning projektiruumi moderaator Rael Artel

  18. "Operation Exhibition" - fotokunst uues valguses / Laura Lepp

    Index Scriptorium Estoniae

    Lepp, Laura

    2011-01-01

    Šotimaal Glasgow's 22.-27. aprillini avatud Ida-Euroopast pärit noorte fotograafide näitusest, mille korraldasid Glasgow' ülikoolis õppivad kunstiajaloo üliõpilased Laura Lepp (Eesti) ja Jevgenia Judova (Läti). Eestit esindavad näitusel Rene Suurkaev ja Marin Sild

  19. Severe Accident Recriticality Analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  20. Severe accident recriticality analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H

    2001-11-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated

  1. Severe accident recriticality analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.

    2001-01-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady

  2. Severe Accident Recriticality Analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  3. Interpreting the SARA and RCRA training requirements

    International Nuclear Information System (INIS)

    Moreland, W.M.; Wells, S.M.

    1987-01-01

    The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements

  4. Mimetismo e Recriação do Imaginário Medieval em Auto da Compadecida de Ariano Suassuna e en La Diestra de Dios Padre de Enrique Buenaventura

    Directory of Open Access Journals (Sweden)

    Tereza Aline Pereira de Queiroz

    1998-01-01

    Full Text Available O artigo tem por objetivo discutir, a partir da análise das peças teatrais Auto da Compadecida, de Ariano Suassuna, e La Diestra de Dios Padre, de Enrico Buenaventura, a presença do imaginário medieval ibérico no continente americano.This article intends to discuss the maintenance of iberian medieval imaginaire in the american continent analysing the plays Auto da Compadecida by Ariano Suassuna and La Diestra de Dios Padre by Enrico Buenaventura.

  5. System Analysis and Risk Assessment (SARA) system

    International Nuclear Information System (INIS)

    Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

    1986-01-01

    Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable

  6. O Jesus Ariano. O imaginário e as concepções historiográficas do Jesus Histórico na Alemanha Nazista.

    OpenAIRE

    Chevitarese, André Leonardo; Universidade Federal do Rio de Janeiro - UFRJ; Justi, Daniel Brasil; Universidade Federal do Rio de Janeiro

    2017-01-01

    Este trabalho pretende discutir que os teólogos alemães, comprometidos com a ideologia nazista, inclusive através do juramento de lealdade que fizeram ao Führer, não optaram pelo “silêncio virtual” nem demonstraram “um interesse limitado” pelo Jesus histórico. Muito pelo contrário, eles não apenas potencializaram o “retrato” de Jesus como sendo um ariano, como também o popularizaram, por meio de seus escritos, de suas homilias e de suas experiências cotidianas. Deve-se ter atenção aqui: a con...

  7. Aastahitt 2008. Chalice "Supervõimed". Laura "Destiny" / Kallervo Karu

    Index Scriptorium Estoniae

    Karu, Kallervo

    2009-01-01

    Aastahitt 2008 valimisest (võitis Kerli Kõivu lugu "Walking on Air") ja kontserdist ETV ja Raadio 2 koostööna Tallinnas Club von Überblingenis. Heliplaadist. Laura Põldvere esitatavast eurolaulust

  8. Laura Ashley - lugu armastusest ja loomejõust

    Index Scriptorium Estoniae

    2008-01-01

    Laura Ashley (1925-1985) edulugu. 1953. a. hakkasid Bernard ja Laura Ashley käsitsi trükkima tekstiile oma korteris Londonis. 1954. a. asutasid nad firma Ashley Mountney Limitied. 1957. a. importis firma oma toodangut Euroopasse, USA-sse ja Austraaliasse. 1977. a. sai L. Ashley Queen's Award for Export Achievement auhinna. Firma põhitegevuseks on saanud kodusisustamiseks vajalike tekstiilide tootmine

  9. User's Manual for the Langley Aerothermodynamic Upwind Relaxation Algorithm (LAURA)

    Science.gov (United States)

    Gnoffo, Peter A.; Cheatwood, F. McNeil

    1996-01-01

    This user's manual provides detailed instructions for the installation and the application of version 4.1 of the Langley Aerothermodynamic Upwind Relaxation Algorithm (LAURA). Also provides simulation of flow field in thermochemical nonequilibrium around vehicles traveling at hypersonic velocities through the atmosphere. Earlier versions of LAURA were predominantly research codes, and they had minimal (or no) documentation. This manual describes UNIX-based utilities for customizing the code for special applications that also minimize system resource requirements. The algorithm is reviewed, and the various program options are related to specific equations and variables in the theoretical development.

  10. Kus lõpeb maastik? / Laura Põld ; intervjueerinud Kristel Schwede

    Index Scriptorium Estoniae

    Põld, Laura, 1984-

    2013-01-01

    Viinis tegutseva eesti kunstniku Laura Põllu loomingulisest teekonnast, kunstiprojektidest "Katse lavastada maastikku" (Tallinna Kunstihoone galerii, 31.05.-23.06.2013) ja "Das Ende der Landschaft, das Ende der Stadt" (Galerie Gut Gasteil, Prigglitz, Austria, 27.04.-16.06.2013)

  11. The relationship between SARA fractions and crude oil stability

    Directory of Open Access Journals (Sweden)

    Siavash Ashoori

    2017-03-01

    Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.

  12. Layering of life (Sara novel of Peter Sarić

    Directory of Open Access Journals (Sweden)

    Kostić Dragomir J.

    2015-01-01

    Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safe­guard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.

  13. arXiv Laura++ : a Dalitz plot fitter

    CERN Document Server

    Back, John; Harrison, Paul; Latham, Thomas; O'Hanlon, Daniel; Qian, Wenbin; del Amo Sanchez, Pablo; Craik, Daniel; Ilic, Jelena; Otalora Goicochea, Juan; Puccio, Eugenia; Silva Coutinho, Rafael; Whitehead, Mark

    The Dalitz plot analysis technique has become an increasingly important method in heavy flavour physics. The Laura++ fitter has been developed as a flexible tool that can be used for Dalitz plot analyses in different experimental environments. Explicitly designed for three-body decays of heavy-flavoured mesons to spinless final state particles, it is optimised in order to describe all possible resonant or nonresonant contributions, and to accommodate possible CP violation effects.

  14. Trouble makers : Laura Poitras and the problem of dissent

    OpenAIRE

    Danchev, Alex

    2015-01-01

    This review article considers three works by the distinguished documentary film-maker Laura Poitras: My country, my country (2006); The oath (2010); and the recently released Citizenfour (2014), focusing on the whistle-blower Edward Snowden. Poitras describes these works as a trilogy about American power after 9/11, but they are also about disobedience and resistance, or the problem of dissent. The article argues for the significance (and the virtue) of Poitras's project, as film maker and tr...

  15. Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.

    Science.gov (United States)

    O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J

    2008-04-01

    Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.

  16. Gene : CBRC-SARA-01-1996 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

  17. SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS

    International Nuclear Information System (INIS)

    Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.

    2015-01-01

    SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index

  18. Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

    Directory of Open Access Journals (Sweden)

    M. Sidi Ritau'din

    2017-06-01

    Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.

  19. Laura Mariani, Sarah Bernhardt, Colette e l'arte del travestimento ...

    African Journals Online (AJOL)

    User

    Laura Mariani, Sarah Bernhardt, Colette e l'arte del travestimento,. Bologna, Il Mulino, 1996. Anche questo secondo libro che Laura Mariani dedica alla storia delle attrici si svolge al confine tra storia del teatro e storia delle donne: un intreccio fertile di suggestioni e spunti teorici. Tema dell'indagine, condotta soprattutto ...

  20. 77 FR 27253 - Proposed Collection, Laura Bush 21st Century Librarian Grant Program Evaluation

    Science.gov (United States)

    2012-05-09

    ... Century Librarian Grant Program Evaluation AGENCY: Institute of Museum and Library Services, National... evaluate and make improvements to the Laura Bush 21st Century Librarian (LB21) Grant Program. The... proposes clearance of the Laura Bush 21st Century Librarian Grant Program Evaluation. The 60-day Notice for...

  1. Layering of life (Sara novel of Peter Sarić)

    OpenAIRE

    Kostić, Dragomir J.

    2015-01-01

    Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...

  2. A simple blowdown code for SUPER-SARA loop conditions

    International Nuclear Information System (INIS)

    Fritz, G.

    1981-01-01

    The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section

  3. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...

  4. Symbols and Sexual Perversion of Laura Wingfield in Tennesse Willimas’s The Glass Menagerie

    Directory of Open Access Journals (Sweden)

    Retnowati Retnowati

    2015-07-01

    Full Text Available The Glass Menagerie, a play written by Tennessee Williams, is full of symbols in which some of them refer to the sexual perversion in the character of the play such as Laura Wingfield. The research applied library research by taking data from the script of the play, then analysed based on the two theories, those were the theory of symbol and psychological theory called sexual perversions. The symbols in this play was analyzed, especially those related to Laura Wingfield. There were symbols like the glass collection, glass unicorn, blue roses, fire escape and Jim O’Connor which explained the sexual perversion of Laura Wingfield. These symbols were clues to understand the psycological problems suffered by Laura. It can be concluded that The cause of the strange sexual desire is because of her being abnormal because she is crippled and suffers from pleurosis. 

  5. Sara, a patient with borderline personality structure: A "crisis" management

    Directory of Open Access Journals (Sweden)

    Paola Marinelli

    2015-05-01

    Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma. 

  6. Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

    Directory of Open Access Journals (Sweden)

    Jessica N Snowden

    Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.

  7. System Analysis and Risk Assessment system (SARA) Version 4.0

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1992-01-01

    This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis

  8. The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...

  9. Calculations for the design and modification of the 2 cyclotrons of S.A.R.A

    International Nuclear Information System (INIS)

    Albrand, P.S.; Belmont, J.L.; Ripouteau, F.

    1983-09-01

    S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron

  10. Social humanoid robot SARA: development of the wrist mechanism

    Science.gov (United States)

    Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.

    2018-01-01

    This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.

  11. The erudite humility of the historian: the 'critical epistemology' of Georges Lantéri-Laura.

    Science.gov (United States)

    Basso Lorini, Elisabetta

    2017-06-01

    This paper analyses the historical and epistemological work of the French psychiatrist Georges Lantéri-Laura (1930-2004) within the context of the French 'tradition' of history and philosophy of sciences, with special reference to Georges Canguilhem and Michel Foucault. After an introduction devoted to a critical survey of the most recent works on the history and historiography of psychiatry in French, the paper outlines Lantéri-Laura's approach by focusing especially on the role played by the methodological concept of 'semiology' as regards the relation between medicine and psychiatry. The last part of the paper draws attention to the relation between the history and philosophy of psychiatry in light of Lantéri-Laura's 'critical epistemology'.

  12. Gender Transformations and Colonial Displacements in Laura Antillano's "Tuna de mar"

    Science.gov (United States)

    Reid, Alana

    2015-01-01

    This paper examines the trajectories of two characters in Laura Antillano's short story, "Tuna de mar" (1991), as they navigate interrelated systems of power and attempt to position themselves closer to, or further away from, the margins. Set in the late eighteenth century, the tale features a female protagonist who escapes prostitution…

  13. Laura Laur, personnage hologramme. De l'intersubjectivité dans la littérature

    Directory of Open Access Journals (Sweden)

    Isabelle Boisclair

    2015-01-01

    Full Text Available La construction particulière de Laura Laur, de Suzanne Jacob (1983, effaçant la voix du personnage principal au profit de quatre personnages de son entourage (deux frères et deux amants, est ici prise en exemple pour aborder l’intersubjectivité, selon laquelle tout échange entre deux sujets participe à la production des subjectivités de chacun d’entre eux. Compte tenu du sexe des instances narratives (ce sont quatre hommes qui dessinent, depuis leurs positions respectives, une femme, est aussi considérée la dimension genrée du travail des rapports intersubjectifs dans la constitution du soi. Laura Laur apparaît ainsi comme un hologramme trahissant les attentes des uns et des autres envers le féminin. The singular construction of Suzanne Jacob’s Laura Laur (1983, which effaces the voice of the main character in favour of that of four characters from her entourage (two brothers and two lovers is taken here as an example for approaching intersubjectivity, an approach according to which every exchange between two subjects contributes to the production of their subjectivity. Taking into account the sex of the narrative instances (four men depicting a woman from their various perspectives, the gendered dimension of the role of intersubjective relations in the constitution of the self is also considered. Laura Laur then appears as a hologram that betrays the various expectations associated with the feminine.

  14. Teaching Laura Kipnis's "Love's Labors" in "Ways of Reading"

    Science.gov (United States)

    Fike, Matthew A.

    2013-01-01

    This essay describes a method of teaching a very challenging anthology piece: Laura Kipnis's "Love's Labors" (chapter 1 of her 2003 "Against Love: A Polemic"). The method, although designed for a critical thinking course, should also provide resources for those who teach Kipnis's work in writing courses. Using…

  15. Rakesh K. Kapania named Norris and Laura Mitchell Professor of Aerospace Engineering

    OpenAIRE

    Crumbley, Liz

    2008-01-01

    Rakesh K. Kapania, a professor in the Department of Aerospace and Ocean Engineering in the College of Engineering at Virginia Tech, was appointed the Norris and Laura Mitchell Professor of Aerospace Engineering by the Virginia Tech Board of Visitors during the board's quarterly meeting March 31.

  16. Building a story: myths and realities in the autobiography of Laura Orvieto

    Directory of Open Access Journals (Sweden)

    Caterina Del Vivo

    2014-01-01

    Full Text Available Laura Orvieto (Milan 1876 - Florence 1953, children’s writer, always loved telling stories. She asked everyone to tell her stories and, if she couldn’t find anyone available, she told stories to younger children. These stories were inspired by the many books she read and by the fairy tales told by old women.  As an adult, once a writer, her most successful work was inspired by classical mythology and the small adventures of her own children. But in the second half of the 1930s many things changed for a family from the Florentine Jewish middle classes, with the increasing pressure of racial marginalization. In around 1936 Laura decided to abandon her usual themes, and instead to turn to her origins and tell her own story, and that of her husband Angiolo and their respective families. The Storia di Angiolo e Laura is written in a simple and direct style, close to Orvieto’s other work. But in the final pages she allows space for statements that illustrate her painful crisis of conscience. Today we can ask to what extent these pages reflect a real biographical  journey: other sources complete, confirm or deny the events and states of mind expressed in the book. A parallel reading of a few chapters and other documents reveals less well-known aspects of the thinking and frame of mind of Laura and her family and illustrates her working methods. Received: 27/05/2013 / Accepted: 20/06/2013 How to reference this article Del Vivo, C. (2014. Costruirsi una storia: miti e realtà nell’autobiografia di Laura Orvieto. Espacio, Tiempo y Educación, 1(1, pp. 55-75. doi: http://dx.doi.org/10.14516/ete.2014.001.001.003

  17. Mengukur Politisasi Agama dalam Ruang Publik: Komunikasi SARA dalam Perdebatan Rational Choice Theory

    Directory of Open Access Journals (Sweden)

    Mohammad Supriyadi

    2015-12-01

    Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.

  18. Concurrent software system design supported by SARA at the age of one

    Energy Technology Data Exchange (ETDEWEB)

    Campos, I.M.; Estrin, G.

    A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.

  19. ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

    Directory of Open Access Journals (Sweden)

    Sulistyastuti Sutomo

    2015-01-01

    Full Text Available Not only does art   have   self-fullfillment, but  it also has axiological  benefits both socially, culturally, religiously, and economiclally.  So does Sara Douda dance.  Sara Douda aesthetics  is first contained  in its whole dance movements. In addition, it  can also be found in the whole dance equipments.  Moreover,  this dance aesthetics  may  also be contained in the verbal symbols in the speech forms  prior to the dance performance. However,  both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and  religious values in the Loli community about  their honoring their ancestors,  having social harmony, and  highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance.   Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...

  6. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    Science.gov (United States)

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...

  14. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  3. Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural

    Directory of Open Access Journals (Sweden)

    Tiara Kharisma

    2017-12-01

    Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

  7. DA POÉTICA DO ENGAJAMENTO NA LITERATURA POLICIAL DE LAURA LIPPMAN

    Directory of Open Access Journals (Sweden)

    Isabella Santos Mundim

    2013-04-01

    Full Text Available Este artigo propõe investigar como se dá a relação da literatura policial de Laura Lippman com um projeto ético determinado. Com base na leitura de obras selecionadas, pretende-se analisar como essa autora se vale da inventividade da linguagem para traduzir, em narrativa, o fenômeno da violência e a falência das instituições.

  8. Writing Displacement, Demythologising Violence: Discourses of Violence in Contemporary Colombia and Laura Restrepo's La multitude errante

    OpenAIRE

    Averis, Kate

    2016-01-01

    This article explores and analyses the representation of violence in contemporary Colombian culture. Violence has come to characterise Colombian society since the onset of the current armed conflict, with devastating consequences for its population. Within this context, this article examines tendencies in contemporary literary representations of violence, with a focus on La multitud errante (2001) by Laura Restrepo, one of Colombia’s foremost writers. It begins with an outline of the origins ...

  9. Transferring generic SARA/OSHA training to US Department of Energy facilities

    International Nuclear Information System (INIS)

    White, A.; McKinley, T.

    1989-01-01

    The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs

  10. SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

    DEFF Research Database (Denmark)

    Martin, Christer; Heinze, C.; Busch, M.

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...

  14. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    OpenAIRE

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...

  16. Ground-water resources of the Laura area, Majuro Atoll, Marshall Islands

    Science.gov (United States)

    Hamlin, S.N.; Anthony, S.S.

    1987-01-01

    The water system that supplies the heavily populated Dalap-Uliga-Darrit (DUD) area of Majuro atoll, Marshall Island, relies almost entirely upon airstrip catchment of rain water. Droughts cause severe water supply problems and water rationing is required, even during periods of normal rainfall. The Laura area contains a substantial lens of fresh groundwater that could be developed for export to the DUD area 30 mi to the east. Study of the groundwater resource at Laura involved a survey of existing wells, installation of monitoring wells and test holes, compilation of continuous records of rainfall and water level fluctuations, and collection of water quality data. Test hole data permitted the definition of three geohydrologic units which correlate well with similar units in Bikini and Enewetak atolls. The units consist of two layers of unconsolidated reef and lagoon sediments resting on a dense, highly permeable limestone. The potable water zone, or freshwater nucleus, of the lens is contained mostly within the unconsolidated layers, which are much less permeable than the basal limestone. Recharge to the Laura freshwater lens is estimated to be 1.8 mil gal/day, based on an average annual rainfall of 140 in. Sustainable yield is estimated to be about 400,000 gal/day. Shallow skimming wells or infiltration galleries similar to those used on Kwajalein atoll would be appropriate to develop the freshwater lens. The impact of development on the lens can be determined by monitoring the salinity in developed water and in a network of monitor wells. (Author 's abstract)

  17. Identification of Differentially Expressed Proteins in Liver in Response to Subacute Ruminal Acidosis (SARA Induced by High-concentrate Diet

    Directory of Open Access Journals (Sweden)

    X. Y. Jiang

    2014-08-01

    Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.

  18. SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-05-01

    Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.

  19. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    Science.gov (United States)

    Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

    2017-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.

  20. System Analysis and Risk Assessment System (SARA), Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.

    1992-02-01

    This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs

  1. Una musa de la modernidad: Laura Méndez de Cuenca (1853-1928

    Directory of Open Access Journals (Sweden)

    Mílada Bazant

    2013-01-01

    Full Text Available Este trabajo aborda la trayectoria biográfica, magisterial y literaria de una de las primeras feministas de México, Laura Méndez de Cuenca. Mujer liberal y moderna, madre soltera, quien se atrevió a transgredir las normas sociales católicas de su tiempo y vivió una vida libre, pagando un precio muy alto por esa libertad. Su legado de 2000 páginas es un tratado de educación y un compendio literario de todos los géneros.

  2. Una musa de la modernidad: Laura Méndez de Cuenca (1853-1928)

    OpenAIRE

    Mílada Bazant

    2013-01-01

    Este trabajo aborda la trayectoria biográfica, magisterial y literaria de una de las primeras feministas de México, Laura Méndez de Cuenca. Mujer liberal y moderna, madre soltera, quien se atrevió a transgredir las normas sociales católicas de su tiempo y vivió una vida libre, pagando un precio muy alto por esa libertad. Su legado de 2000 páginas es un tratado de educación y un compendio literario de todos los géneros.

  3. Creation and (Re)presentation of Historical Discourse in Isle of Passion by Laura Restrepo

    OpenAIRE

    Daniela Melis

    2011-01-01

    Published in Colombia in 1989, but neglected until the author’s later distinction, Laura Restrepo’s first novel, Isle of Passion , focuses on historical facts, as well as on the issues that arise when the impact of events is articulated in official discourse. This study—drawing from Walter Mignolo’s idea of decolonial theory—explores how Restrepo’s attempt to rewrite history following “an-other logic, an-other language, an-other thinking” contributes to the decolonization of knowledge, being...

  4. Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

    2009-07-01

    Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench

  5. Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

    Science.gov (United States)

    Thomas, S. M.; Su, Y. C.; Hummel, P. R.

    2016-12-01

    Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance

  6. Combined LAURA-UPS solution procedure for chemically-reacting flows. M.S. Thesis

    Science.gov (United States)

    Wood, William A.

    1994-01-01

    A new procedure seeks to combine the thin-layer Navier-Stokes solver LAURA with the parabolized Navier-Stokes solver UPS for the aerothermodynamic solution of chemically-reacting air flowfields. The interface protocol is presented and the method is applied to two slender, blunted shapes. Both axisymmetric and three dimensional solutions are included with surface pressure and heat transfer comparisons between the present method and previously published results. The case of Mach 25 flow over an axisymmetric six degree sphere-cone with a noncatalytic wall is considered to 100 nose radii. A stability bound on the marching step size was observed with this case and is attributed to chemistry effects resulting from the noncatalytic wall boundary condition. A second case with Mach 28 flow over a sphere-cone-cylinder-flare configuration is computed at both two and five degree angles of attack with a fully-catalytic wall. Surface pressures are seen to be within five percent with the present method compared to the baseline LAURA solution and heat transfers are within 10 percent. The effect of grid resolution is investigated and the nonequilibrium results are compared with a perfect gas solution, showing that while the surface pressure is relatively unchanged by the inclusion of reacting chemistry the nonequilibrium heating is 25 percent higher. The procedure demonstrates significant, order of magnitude reductions in solution time and required memory for the three dimensional case over an all thin-layer Navier-Stokes solution.

  7. Development of an ion guide coupled to an on-line isotope separation system on Sara. Identification and study of isospin exotic nuclei at Isolde and Sara

    International Nuclear Information System (INIS)

    Bouldjedri, A.

    1992-06-01

    This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements

  8. Unusta, säilita, mäleta : kunstnikud materialiseerivad mälu / Laura Põld

    Index Scriptorium Estoniae

    Põld, Laura, 1984-

    2015-01-01

    Rahvusvaheline näitus "Tracing the Memory" Vaal galeriis 17. detsembrist 2014 kuni 17. jaanuarini 2015, kuraatorid Annika Toots ja Slavomira Ondrušová. Eksponeeriti Daniela Krajčová, Jan Nálevka, Katarina Poliačiková, Laura Tootsi ja Milan Vagač'i installatsioone. Kunstnike eluloolisi andmeid

  9. Judith Husband: 'it's surprising what we can actually live without, other than air, water and food'. Interview by Laura Pacey.

    Science.gov (United States)

    Husband, Judith

    2013-05-01

    Judith Husband speaks to the BDJ about current challenges facing dentistry, the new BDA PEC and her love of social media site Twitter. The only catch is she has accepted the challenge issued by interviewer and fellow Twitter enthusiast Laura Pacey of answering every question, in 140 characters or less. Follow on Twitter @Judith_Husband and @The_BDJ.

  10. Saaremaa noored said hakkama eduka filmiga! : [intervjuu] / Laura Tõhk, Marili Pärtel ; küsitles Minni Saapar

    Index Scriptorium Estoniae

    Tõhk, Laura

    2006-01-01

    Saaremaa Ühisgümnasiumi abituriendid Laura Tõhk ja Marili Pärtel pälvisid oma filmiga "Fallen Angel" Rakveres toimunud noorte filmipäevadel parima dokumentaalfilmi ja Pärnu rahvusvahelise dokumentaal- ja antropoloogiafilmide festivali tunnustuse

  11. Laura Bassi and science in 18th century Europe the extraordinary life and role of Italy's pioneering female professor

    CERN Document Server

    Frize, Monique

    2013-01-01

    This book presents the extraordinary story of a Bolognese woman of the settecento. Laura Maria Caterina Bassi (1711-1778) defended 49 Theses at the University of Bologna on April 17, 1732 and was awarded a doctoral degree on May 12 of the same year. Three weeks before her defense, she was made a member of the Academy of Sciences in Bologna. On June 27 she defended 12 additional Theses. Several of the 61 Theses were on physics and other science topics. Laura was drawn by the philosophy of Newton at a time when most scientists in Europe were still focused on Descartes and Galen. This last set of Theses was to encourage the University of Bologna to provide a lectureship to Laura, which they did on October 29, 1732. Although quite famous in her day, Laura Bassi is unfortunately not remembered much today. This book presents Bassi within the context of the century when she lived and worked, an era where no women could attend university anywhere in the world, and even less become a professor or a member of an academ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  13. Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.

    1995-01-01

    Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...

  15. Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010

    OpenAIRE

    Beaulé, Sophie

    2014-01-01

    With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w

  17. Lepidoptera, Nymphalidae, Heliconiinae, Heliconius sara apseudes (Hübner, 1813: Distribution extension

    Directory of Open Access Journals (Sweden)

    Iserhard, C. A.

    2010-01-01

    Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.

  18. Laura Jensen. Patriots, Settlers and the Origins of American Social Policy.

    Directory of Open Access Journals (Sweden)

    Evelyne Thévenard

    2006-04-01

    Full Text Available Dans son ouvrage sur les origines de l’Etat-Providence aux Etats-Unis, Laura Jensen réfute la thèse de l’historiographie classique, qui privilégie le New Deal et la Great Society dans le processus d’élaboration de la protection sociale américaine. Mais surtout, elle s’applique à démontrer que, contrairement à la thèse de Theda Skocpol (Protecting Soldiers and Mothers, les droits sociaux et leur contribution à la construction de la nation et à la définition de la citoyenneté ne datent pas des...

  19. PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

    Directory of Open Access Journals (Sweden)

    Jorge A. Orrego-Ruiz

    2014-06-01

    Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.

  20. The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

    Science.gov (United States)

    Wood, M. A.

    2003-12-01

    The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.

  1. Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.

    Science.gov (United States)

    Zhao, Bryan M; Hoffmann, F Michael

    2006-09-01

    Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.

  2. Sara John: Ethnisierte Arbeit. Eine feministische Perspektive. Marburg: Tectum Wissenschaftsverlag 2009.

    Directory of Open Access Journals (Sweden)

    Grit Grigoleit

    2011-03-01

    Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.

  3. A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

    Science.gov (United States)

    Worthen, Helena Harlow

    2012-01-01

    The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…

  4. Hemolytic disease of the fetus and newborn caused by an antibody to a low-prevalence antigen, anti-SARA.

    Science.gov (United States)

    Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy

    2011-09-01

    The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.

  5. Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

    Science.gov (United States)

    Goldrick-Rab, Sara; Kelly, Andrew P.

    2016-01-01

    In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

  7. NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r

  12. Autoficción y trabajo de memoria en La casa de los conejos de Laura Alcoba

    Directory of Open Access Journals (Sweden)

    Bruno Ragazzi

    2014-02-01

    Full Text Available The article explores discursive representations within the field of memory in La casa de los conejos by Laura Alcoba. The choice of autofiction as a genre allows discovering new mnemic narratives around the unequal confrontation between Montoneros and right-wing repressive forces. These novel ways of viewing the past are connected to what Ricoeur has called “work of memory”, a therapeutic elaboration on memory that enables a community to reach hope and forgiveness.

  13. Escribiendo el silencio: la contemplación poética de Sara Pujol

    Directory of Open Access Journals (Sweden)

    Gala, Candelas

    2005-06-01

    Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.

  14. Language’s Configurations in La casa de los conejos by Laura Alcoba

    Directory of Open Access Journals (Sweden)

    Estefanía Luján Di Meglio

    2018-01-01

    Full Text Available This article studies a novel written in the argentinean posdictatorship, in French, La casa de los conejos (2007 by Laura Alcoba. The main concept of the paper is the mother and second tongue and its multiples links with the history –the history of state violence– that novel relates. First of all, it is studied the fact that text is written in French in spite of author’s mother tongue is Spanish: Alcoba had to go into exile during the period of the “Triple A” in Argentina. In second place, it is observed that beyond this fact, there are several words written in Spanish. Such words work as metonymy of a whole language (Spanish, as a symbol of a history (the state terrorism and at the same time, they work as a metonymy of posdictatorship argentinean literature: those words represent the capital fact to telling a history in another way of that one of the oficial history.

  15. Sedimentary facies and Holocene depositional processes of Laura Island, Majuro Atoll

    Science.gov (United States)

    Yasukochi, Toru; Kayanne, Hajime; Yamaguchi, Toru; Yamano, Hiroya

    2014-10-01

    The depositional processes that formed Laura Island, Majuro Atoll, Marshall Islands, were reconstructed based on a facies analysis of island sediments and spine ratios, and radiocarbon ages of foraminifera. Sedimentary facies were analyzed from trenches and drill cores excavated on the island and its adjacent reef flat. Depositional ages were obtained using benthic foraminifera (Calcarina) whose spines had not been abraded. The facies were classified into two types: gravelly and sandy. The initial sediments of these sites consisted of gravelly facies in the lower horizon and sandy facies in the upper horizon. Their ages were approximately 2000 cal BP and coincident with the onset of a 1.1-m decline in regional relative sea level, which enabled deposition of the gravelly facies. Half of the sand fraction of the sediment was composed of larger benthic foraminifera. The spine ratio showed that their supply source on the reef flat was located oceanside of the island. The supply source appears to have been caused by the relative sea-level fall. This indicates that the studied island was formed by a relative reduction in wave energy and enhanced foraminiferal supply, both of which were triggered by the late Holocene relative sea-level fall.

  16. Creation and (Representation of Historical Discourse in Isle of Passion by Laura Restrepo

    Directory of Open Access Journals (Sweden)

    Daniela Melis

    2011-06-01

    Full Text Available Published in Colombia in 1989, but neglected until the author’s later distinction, Laura Restrepo’s first novel, Isle of Passion , focuses on historical facts, as well as on the issues that arise when the impact of events is articulated in official discourse. This study—drawing from Walter Mignolo’s idea of decolonial theory—explores how Restrepo’s attempt to rewrite history following “an-other logic, an-other language, an-other thinking” contributes to the decolonization of knowledge, being, community interests, and cultural heritage. The novel’s plot centers on a minor event in international history: the territorial dispute over the island of Clipperton, which was encountered by an English pirate escaping the Spaniards in the 1700’s, claimed by the Mexicans for its geographical proximity, owned (since 1930 by the French, and occasionally disputed by the English and US governments. Writing while personally experiencing the trauma of exile, Restrepo narrates the forgotten story of the Mexican soldiers—deployed with their families to defend the island—as a metaphor of marginalization. Clipperton, therefore, represents not only a geographical, but also a historical entity. This reading of Isle of Passion describes how its creative dis-order recovers a chapter of national history, finally retold by its silenced protagonists.

  17. El cancionero de los romances judeo-Espanoles de Sarajevo de Laura Papo-bojoteta

    Directory of Open Access Journals (Sweden)

    Muhamed Nezirović

    1986-12-01

    Full Text Available Los autores e investigadores europeos e americanos que se han ocupado desde principios de este siglo hasta nuestros días del fenómeno de los romances sefardíes de Bosnia, país en el cual vivía antes de la última Guerra Mundial una población judía muy activa y muy importante que Manuel Ortega, en esta época presidente de la Federación de las Asociaciones Sefardíes de Marruecos, caracterizaba en 1930 en estos términos: "Precisamente el grupo de Sefardíes de Sarajevo es uno de los que nos ha preocupado en todo momento por su situación privilegiada en el eje de las corrientes culturales del Oriente europeo, donde tan alto colocan el pabellón de la cultura hispana que ellos f ormaron en su mayor parte'', citan en tre los colectores de esta poesía bien a los judíos originarios de Bosnia como Dan S. Albachary, Maurice Levi o Kalmi Baruch, bien a los extranjeros como Leo Wiener, Manuel Manrique de Lara o Cynthia Crews. Ellos, sin embargo, omiten el nombre de una mujer bosníaca, Laura Papo-Bojoreta, que tiene un lugar destacado en la literatura judeoespañola de Yugoslavia no solamente como autora de unas obras literarias de gran valor, sino también como coleccionadora de los romances judíos de su país natal.

  18. Intravenous immunoglobulin in the management of a rare cause of hemolytic disease of the newborn: Anti-SARA antibodies.

    Science.gov (United States)

    Venkataraman, Rohini; Yusuf, Kamran

    2017-01-01

    Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.

  19. Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

    Directory of Open Access Journals (Sweden)

    Tirshem Kumar Kaushik

    2015-05-01

    Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.

  20. Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge

    DEFF Research Database (Denmark)

    Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette

    2017-01-01

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...

  1. TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

    Energy Technology Data Exchange (ETDEWEB)

    1989-03-01

    This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.

  2. Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.

    1994-11-01

    The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)

  3. Instructional materials for SARA/OSHA training. Volume 1, General site working training

    Energy Technology Data Exchange (ETDEWEB)

    Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)

    1988-04-01

    This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.

  4. La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli

    Directory of Open Access Journals (Sweden)

    Umberto Fortis

    2014-04-01

    Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.

  5. Reading Sara Pujol Russell’s Poetry of Contemplation and Connection

    Directory of Open Access Journals (Sweden)

    Anita M. Hart

    2012-06-01

    Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.

  6. SAPHIRE technical reference manual: IRRAS/SARA Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.

    1993-01-01

    This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix

  7. Releyendo a Laura Mulvey 40 años después. Historiografía y feminismo / Re-reading Laura Mulvey 40 Years After. Historiography and Feminism

    Directory of Open Access Journals (Sweden)

    Eva Parrondo Coppel

    2016-11-01

    Full Text Available «Placer visual y cine narrativo», de Laura Mulvey (Screen, 1975, es un artículo nuclear en la configuración de la teoría feminista del cine y su notable influencia ha excedido este ámbito teórico. En el presente trabajo historiográfico nos proponemos realizar una lectura crítica del mismo a la luz de la creciente institucionalización del feminismo a partir de la década de 1980. Para ello nos aproximamos a este texto clásico desde tres ángulos interrelacionados: su contexto histórico, su con-texto teórico y la cuestión de las premisas metodológicas sobre las que se sostiene. En la primera parte de este trabajo, situamos «Placer visual y cine narrativo» en el contexto del movimiento feminista británico post-mayo del 68, el cual se caracterizó por el antagonismo entre las feministas funcionalistas, las marxistas-culturalistas y las psicoanalíticas. Asimismo, nos ocupamos de los primeros textos psicoanalíticos de la teoría feminista del cine, escritos por Claire Johnston y Pam Cook (1973-1975, frente a los cuales Mulvey se posiciona en su artículo. Por medio de esta doble contextualización proponemos, en la segunda parte, que si bien Mulvey dice utilizar el psicoanálisis y, de hecho, hace un amplio uso de terminología psicoanalítica, las bases conceptuales de «Placer visual y cine narrativo» son realmente sociológicas, lo cual (tal y como concluimos es sobre todo palpable en su particular combate contra el Inconsciente, piedra angular del psicoanálisis.Palabras clave: teoría del cine, feminismo, historiografía, Inconsciente, Laura Mulvey, Claire Johnston, Pam Cook.AbstractLaura Mulvey’s «Visual Pleasure and narrative Cinema» (Screen, 1975 is a key essay in the configuration of feminist film theory and its outstanding influence has exceeded this theoretical field. The aim of this historiographical paper is to undertake a critical reading of it in the light of the increasing institucionalization of feminism from

  8. Review Article: Yamada, Jeni "Laura: A Case for the Modularity of Language"; Tomasello, Michael "First Verbs: A Case Study of Early Grammatical Development."

    Science.gov (United States)

    Shatz, Marilyn

    1994-01-01

    Jeni Yamada's "Laura" and Michael Tomasello's "First Verbs" continue a tradition of providing useful information on the language ability of individuals in a depth rarely found in multisubject studies; however, these efforts are unusual for case studies in that both take strong theoretical positions on the essence of language and language learning.…

  9. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    Directory of Open Access Journals (Sweden)

    Abdullah K. Shehabat

    2016-09-01

    Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.

  10. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0. Volume 5, Systems Analysis and Risk Assessment (SARA) tutorial manual

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities

  11. SARA South Observations and Analysis of the Solar Type, Totally Eclipsing, Over Contact Binary, PY Aquarii

    Science.gov (United States)

    Chamberlain, Heather; Samec, Ronald G.; Caton, Daniel Bruce; Van Hamme, Walter

    2018-01-01

    PY Aqr (GSC 05191-00853) is a solar Type (T ~ 5750K) eclipsing binary. It was observed in July to October, 2017 at Cerro Tololo in remote mode with the 0.6-m SARA South reflector. Two times of minimum light were calculated from our present observations, a primary and a secondary eclipse:HJD Min I = 2457951.7762±0.0006 HJD Min II = 2458019.5295±00.0003. Both weighted as 1.0.In addition, four timings were determined from online data given in IBVS 5600 and five observations at minima were determined from archived All Sky Automated Survey Data:HJD Min I = 2452908.3165, 2452912.33612 HJD Min II = 2452877.5621, 2452913.34465. All weighted as 0.5.ASAS Observations at minima: 2452094.688, 2453478.882, 2453266.576, 2452093.685 and 54729.600. Each weighted as 0.10The following linear and quadratic ephemerides were determined from all available times of minimum light:JD Hel Min I=2452951.7443±0.0008d + 0.402093441±0.000000099 X E {1} JD Hel Min I=2452951.7439±0.0007d + 0.4020912±0.0000007 X E +0.00000000018 ± 0.00000000006 X E2 {2}A BVRI Bessell filtered simultaneous Wilson-Devinney Program (W-D) solution reveals that the system has a mass ratio of ~0.34 and a component temperature difference of only ~40 K. One low luminosity (Tfact ~ 0.94, ~66 degree radius) large cool region of spots was iterated on the primary component in the WD Synthetic Light Curve computations. It appears in the Southern Hemisphere (colatitude 155 degrees). The Roche Lobe fill-out of the binary is ~17%. The inclination is ~86 degrees. An eclipse duration of ~10 minutes was determined for the primary eclipse and the light curve solution. Additional and more detailed information is given in this report.

  12. Autoficción y trabajo de memoria en La casa de los conejos de Laura Alcoba

    Directory of Open Access Journals (Sweden)

    Bruno Ragazzi

    2013-11-01

    Full Text Available Este artículo se propone indagar acerca de las representaciones discursivas en el campo de memoria que se presentan en La casa de los conejos de Laura Alcoba. Se cree que la elección del género de la autoficción es una herramienta genérica que permite descubrir nuevas narrativas mnémicas en torno al enfrentamiento desigual entre Montoneros y las fuerzas represivas de la derecha. Estas novedosas maneras de ver el pasado se vinculan con lo que Ricoeur ha denominado “trabajo de memoria”, una elaboración terapéutica sobre el recuerdo que permite a un pueblo abrirse hacia la esperanza y el perdón.

  13. DETERMINACIÓN DE LAS FRACCIONES SARA DE ASFALTOS COLOMBIANOS ENVEJECIDOS AL MEDIO AMBIENTE EMPLEANDO CROMATOGRAFÍA LÍQUIDA EN COLUMNA DETERMINAÇÃO DAS FRAÇÕES SARA DE ASFALTOS COLOMBIANOS ENVELHECIDOS AO MÉDIO AMBIENTE EMPREGANDO CROMATOGRAFIA LÍQUIDA EM COLUNA DETERMINATION OF SARA FRACTIONS OF ENVIRONMENTALLY AGED COLOMBIAN ASPHALTS USING LIQUID CHROMATOGRAPHY COLUMN

    Directory of Open Access Journals (Sweden)

    Fredy Alberto Reyes

    2012-06-01

    Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p

  14. Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia

    Directory of Open Access Journals (Sweden)

    Tjitske F. Lawerman

    2017-12-01

    Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced

  15. sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

    DEFF Research Database (Denmark)

    Christner, Martin; Heinze, Constanze; Busch, Michael

    2012-01-01

    to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...

  16. Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

    Science.gov (United States)

    Godwin, Allison; Potvin, Geoff

    2017-01-01

    This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…

  17. Staphylococcus aureus Quorum Regulator SarA Targeted Compound, 2-[(Methylaminomethyl]phenol Inhibits Biofilm and Down-Regulates Virulence Genes

    Directory of Open Access Journals (Sweden)

    P. Balamurugan

    2017-07-01

    Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.

  18. Performance of the OVERFLOW-MLP and LAURA-MLP CFD Codes on the NASA Ames 512 CPU Origin System

    Science.gov (United States)

    Taft, James R.

    2000-01-01

    The shared memory Multi-Level Parallelism (MLP) technique, developed last year at NASA Ames has been very successful in dramatically improving the performance of important NASA CFD codes. This new and very simple parallel programming technique was first inserted into the OVERFLOW production CFD code in FY 1998. The OVERFLOW-MLP code's parallel performance scaled linearly to 256 CPUs on the NASA Ames 256 CPU Origin 2000 system (steger). Overall performance exceeded 20.1 GFLOP/s, or about 4.5x the performance of a dedicated 16 CPU C90 system. All of this was achieved without any major modification to the original vector based code. The OVERFLOW-MLP code is now in production on the inhouse Origin systems as well as being used offsite at commercial aerospace companies. Partially as a result of this work, NASA Ames has purchased a new 512 CPU Origin 2000 system to further test the limits of parallel performance for NASA codes of interest. This paper presents the performance obtained from the latest optimization efforts on this machine for the LAURA-MLP and OVERFLOW-MLP codes. The Langley Aerothermodynamics Upwind Relaxation Algorithm (LAURA) code is a key simulation tool in the development of the next generation shuttle, interplanetary reentry vehicles, and nearly all "X" plane development. This code sustains about 4-5 GFLOP/s on a dedicated 16 CPU C90. At this rate, expected workloads would require over 100 C90 CPU years of computing over the next few calendar years. It is not feasible to expect that this would be affordable or available to the user community. Dramatic performance gains on cheaper systems are needed. This code is expected to be perhaps the largest consumer of NASA Ames compute cycles per run in the coming year.The OVERFLOW CFD code is extensively used in the government and commercial aerospace communities to evaluate new aircraft designs. It is one of the largest consumers of NASA supercomputing cycles and large simulations of highly resolved full

  19. The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters

    International Nuclear Information System (INIS)

    Iazzourene, F.

    1982-01-01

    The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr

  20. Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

    Directory of Open Access Journals (Sweden)

    Helena López

    2013-07-01

    Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.

  1. Os suínos da raça Bísara – oportunidades e desafios

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...

  2. Resistographic evaluation on defibred wood elements of the leaching tower at the Santa Laura saltpeter works in Chile. A world heritage site

    Directory of Open Access Journals (Sweden)

    R. Ortiz

    2017-09-01

    Full Text Available The leaching tower is located in the Santa Laura saltpeter works office in Chile. In recent years studies have been carried out, using Non Destructive Techniques (TND, which have determined that the tower is in good condition. However, there are doubts regarding the actual dimensions of the construction elements affected by the desfibration. The present study had the objective of evaluate defibred wood elements, from the leaching tower of the Santa Laura saltpeter works office, using the resistography technique. Additional studies of ultrasound and xylohigrometry were also developed. The obtained results establish that the reduction of the dimensions of the evaluated elements does not present significant difference and that there are no deep damages in the woods. The study confirms that the building is not at risk.

  3. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  4. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Diego O Andrey

    Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  5. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    OpenAIRE

    Abdullah K. Shehabat

    2016-01-01

    This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...

  6. Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests

    International Nuclear Information System (INIS)

    Eifler, W.; Shepherd, I.M.

    1983-01-01

    Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix

  7. Land-use evaluation for sustainable construction in a protected area: A case of Sara mountain national park.

    Science.gov (United States)

    Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena

    2018-01-15

    The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Diagnóstico de la Planta de Lixiviación de la oficina Salitrera Santa Laura en Chile. Patrimonio de la Humanidad

    OpenAIRE

    Ortiz, R.; Jamet, A.; Moya, A.; González, M.; Varela, M. Paz; Hernández, M.; Fuentes, R.; Díaz, P.; Navarrete, J.

    2015-01-01

    La oficina salitrera Santa Laura, que es actualmente el lugar donde se mantiene la infraestructura industrial más completa del periodo del procesamiento del salitre, posee una Torre de Lixiviación que es considerada, por su singularidad, el ícono de la otrora industria salitrera en Chile. Esta impresionante estructura, construida casi en su totalidad con madera de Pino Oregón (Pseudotsuga menziesii) y elementos metálicos en sus uniones, sobrelleva desafortunadamente, después del cese del proc...

  9. Laura Adamietz: Geschlecht als Erwartung. Das Geschlechtsdiskriminierungsverbot als Recht gegen Diskriminierung wegen der sexuellen Orientierung und der Geschlechtsidentität. Baden-Baden: Nomos Verlag 2011.

    Directory of Open Access Journals (Sweden)

    Anson Koch-Rein

    2012-02-01

    Full Text Available Laura Adamietz präsentiert in ihrer Dissertation eine präzise Analyse deutschen und internationalen Antidiskriminierungsrechts und bestehender Rechtsprechung in Sachen Geschlecht, sexuelle Orientierung und Geschlechtsidentität. Verbunden wird dies mit einem – nicht nur für ein juristisches Publikum lohnenden – Überblick über einschlägige, aber in der gängigen Rechtsauslegung unzureichend berücksichtigte geschlechterwissenschaftliche Erkenntnisse. Auf dieser Grundlage entwickelt die Autorin eine Auslegung des antidiskriminierungsrechtlichen Begriffs ‚Geschlecht‘ als „Geschlecht als Erwartung“, wodurch dieser gleichzeitig Komplexität und Anwendbarkeit gewinnt. Die Verbindung von theoretischer Sorgfalt, interdisziplinärer Perspektive und Lösungsorientierung ist ein zentrales Verdienst dieses Buches.Laura Adamietz’s dissertation presents a precise analysis of German and international anti-discrimination law and established jurisdiction regarding gender, sexual orientation, and gender identity. This is combined with an overview of pertinent, yet in current legal interpretation insufficiently considered, findings of gender studies, which is not only valuable for a legal readership. On this basis, the author develops an interpretation of the anti-discrimination juridical term ‘gender’ as “gender as expectation”, which adds both complexity and applicability to it. The combination of theoretical accuracy, interdisciplinary perspective, and solution orientation is a central merit of this book.

  10. Probabilistic model fitting for spatio-temporal variability studies of precipitation: the Sara-Brut system - a case study

    International Nuclear Information System (INIS)

    Dorado Delgado, Jennifer; Burbano Criollo, Juan Carlos; Molina Tabares, Jose Manuel; Carvajal Escobar, Yesid; Aristizabal, Hector Fabio

    2006-01-01

    In this study, space and time variability of monthly and annual rainfall was analyzed for the downstream influence zone of a Colombian supply-regulation reservoir, Sara-Brut, located on the Cauca valley department. Monthly precipitation data from 18 gauge stations and for a 29-year record (1975-2003) were used. These data were processed by means of time series completion, consistency analyses and sample statistics computations. Theoretical probabilistic distribution models such as Gumbel, normal, lognormal and wake by, and other empirical distributions such as Weibull and Landwehr were applied in order to fit the historical precipitation data set. The fit standard error (FSE) was used to test the goodness of fit of the theoretical distribution models and to choose the best of this probabilistic function. The wake by approach showed the best goodness of fit in 89% of the total gauges taken into account. Time variability was analyzed by means of wake by estimated values of monthly and annual precipitation associated with return periods of 1,052, 1,25, 2, 10, 20 and 50 years. Precipitation space variability is presents by means of ArcGis v8.3 and using krigging as interpolation method. In general terms the results obtained from this study show significant distribution variability in precipitation over the whole area, and particularity, the formation of dry and humid nucleus over the northeastern strip and microclimates at the southwestern and central zone of the study area were observed, depending on the season of year. The mentioned distribution pattern is likely caused by the influence of pacific wind streams, which come from the Andean western mountain range. It is expected that the results from this work be helpful for future planning and hydrologic project design

  11. LA ISLA DE LA PASIÓN DE LAURA RESTREPO: UNA UTOPÍA NOVELADA O UNA HISTORIA FICCIONAL DE MODERNIDAD, COLONIALISMO Y DECOLONIALIDAD EN MÉXICO Y AMÉRICA LATINA

    OpenAIRE

    Puertas, Mario Munoz

    2016-01-01

    En esta tesis analizo La isla de la pasión de Laura Restrepo cimentando mi cuadro argumentativo, esencialmente, en conceptos teóricos de narratología (Gérard Genette), de historiografía (Hayden White) y de la Teoría Decolonial (Enrique Dussel, Walter Mignolo y Aníbal Quijano). El objetivo de la presente investigación es analizar si la novela La isla de la pasión (1989), de Laura Restrepo, corresponde a una utopía novelada o una historia ficcional perteneciente a la modernidad, colonialismo y ...

  12. The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

    International Nuclear Information System (INIS)

    Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan

    2013-01-01

    Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques

  13. SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-04-01

    The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

  14. A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta

    OpenAIRE

    Carvalho, Marieta

    2014-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...

  15. Perceptions of the Nature of Happiness: Cultural, but Related to the Dynamics of the Human Mind and the Gratification of General Needs : Laura Hyman: Happiness; Understanding Narratives and Discourses, Palgrave Macmillan, 2014, ISBN: 978-1-137-32152-7

    NARCIS (Netherlands)

    J.C. Ott (Jan Cornelis)

    2017-01-01

    markdownabstractIn her book ‘Happiness’ Laura Hyman identifies some discourses, as defined by Foucault, about happiness among 19 middle-class respondents in the UK. A discourse is a way of thinking and communicating about some issue, and comparable to a ‘perception’ or a’ view’. The dominant

  16. The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

    Directory of Open Access Journals (Sweden)

    John M Morrison

    2012-03-01

    Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.

  17. Identification of new proton-rich rare earth nuclei by means of the coupled system helium jet-isotope separator of SARA

    International Nuclear Information System (INIS)

    Ollivier, T.

    1986-01-01

    In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr

  18. Análise SWOT global da exploração dos suínos da raça Bísara

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...

  19. Diagnóstico de la Planta de Lixiviación de la oficina Salitrera Santa Laura en Chile. Patrimonio de la Humanidad

    Directory of Open Access Journals (Sweden)

    Ortiz, R.

    2015-12-01

    Full Text Available The Santa Laura Saltpeter Work, which is nowadays the place where the most complete industrial infrastructure of the nitrate processing period is maintained, has a Leaching Tower that is considered by its uniqueness, the icon of the former nitrate industry in Chile. This impressive structure, built mostly in Oregon Pine wood (Pseudotsuga menziesii with metal junctions, unfortunately bears, after the plant stopped producing nitrate and iodine, the impact of its productive past and subsequent human actions because of neglect and lack of maintenance. This report, based on a visual, instrumental and structural inspection, is a diagnosis of the current condition of the building. The results indicate that the elements of the structure, with some exceptions, are in good condition and without changes in their mechanical properties. Structural analysis determined that the plant behavior is favorable, being able to withstand a seismic event of importance.La oficina salitrera Santa Laura, que es actualmente el lugar donde se mantiene la infraestructura industrial más completa del periodo del procesamiento del salitre, posee una Torre de Lixiviación que es considerada, por su singularidad, el ícono de la otrora industria salitrera en Chile. Esta impresionante estructura, construida casi en su totalidad con madera de Pino Oregón (Pseudotsuga menziesii y elementos metálicos en sus uniones, sobrelleva desafortunadamente, después del cese del proceso de fabricación de salitre y yodo, el impacto de su pasado productivo y posteriores acciones antrópicasambientales producto de su abandono y falta de mantenimiento. El presente informe, que contemplo inspección básica, instrumental y análisis estructural, es un diagnóstico del estado actual de conservación del edificio. Los resultados obtenidos indican que los elementos que conforman la estructura, con algunas excepciones, se encuentran en buen estado y sin alteración de sus propiedades mecánicas. El

  20. Narratives of Displacement: The Challenges of Motherhood and Mothering in semi-fictional works by Laura Pariani, Mary Melfi, and Donatella Di Pierantonio

    Directory of Open Access Journals (Sweden)

    Laura Rorato

    2018-01-01

    Full Text Available This article analyses the representation of the impact of migration on family dynamics in three autobiographical works: Laura Pariani’s Il piatto dell’angelo (2013, Mary Melfi’s Italy Revisited. Conversations with my Mother (2009, and Antonella Di Pietrantonio’s Mia madre è un fiume (2011. All three authors were directly or indirectly affected by the wave of emigration that took place in Italy between the end of the 19th century and the first half of the 20th century. Pariani extends her observations to the present by focusing also on those South American women who are currently moving to Italy to work as cares for old people, often leaving their families behind. Motherhood and mothering are central themes in all three books. These works problematise the patriarchal notion of motherhood and highlight the need to move towards alternative concepts of motherhood that do not imply the subordination of women. Additionally, this article offers a reflection on the role that creative writing can play in challenging some of the most engrained stereotypes, such as those of the good mother versus the bad mother, partially related to our Christian tradition. Building on Podnieks and O’Reilly’s notion of “maternal texts” (1-2, this article argues that through fiction women are less inhibited in exploring the thornier aspects of motherhood as a social construction than they seem to be in everyday life.

  1. Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973

    Directory of Open Access Journals (Sweden)

    Guillermina Feudal

    2017-12-01

    Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.

  2. En el mar de la literatura : Un análisis de las funciones de la intertextualidad en La Isla de la Pasión de Laura Restrepo

    OpenAIRE

    Ekström, Sandra

    2012-01-01

    En este trabajo investigamos las funciones de la intertextualidad en la novela La Isla de la Pasión de Laura Restrepo. Concentrándonos en citas y alusiones que refieren a Don Quijote de Cervantes, Robinson Crusoe de Defoe y la Biblia, y tomando en cuenta el contexto en el que aparecen, analizamos las funciones que estas referencias intertextuales cumplen en el nivel del relato en la novela de Restrepo. Constatamos que la intertextualidad entre La Isla de la Pasión y Don Quijote aparece como u...

  3. Laura Jackson, Ph.D.

    Science.gov (United States)

    Research Biologist with the EPA. Her current work involves linking natural and built infrastructure to human health and well-being at multiple spatial scales, in order to develop interpretive maps and analytical tools for an interactive, web-based Atlas.

  4. Lood toimivad ajas / Laura Kuusk

    Index Scriptorium Estoniae

    Kuusk, Laura, 1982-

    2006-01-01

    Andres Härmi kureeritud näitusesari "Story" Tallinna Linnagaleriis: 14. IX-1. X "Story I: Katse ja eksitus. Monument massidele. Janna Holmstedt & Po Hagström"; 5.-22. X "Story II: 9. detsember 2005: minu märkmik. Tõnis Saadoja"; 26. X-12. XI "Story III: Aja sund. Minna Hint ja Jane Remm" ja 7.-31. XII "Story IV: Cinemagic Tour. Elsebeth Jorgensen"

  5. Sharing AIS Related Anomalies (SARA)

    Science.gov (United States)

    2016-03-01

    78 6.3.7 SQL Versus NoSQL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 6.4 Data Processing...43 6.1 Overview of SQL and NoSQL differences, from [56]. . . . . . . . . . . . . . . . . . 82 A.1 Description of the ship anomaly upload use...constraints must be considered. These requirements, however, can only be defined when lower level implementation decisions, such as SQL versus NoSQL

  6. Severe accident recriticality analyses (SARA)

    DEFF Research Database (Denmark)

    Frid, W.; Højerup, C.F.; Lindholm, I.

    2001-01-01

    with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality-both super-prompt power bursts and quasi steady-state power......Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies......, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g(-1), was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s(-1). In most cases, however, the predicted energy deposition was smaller, below...

  7. Notas sobre Feral y las cigüeñas, de Fernando Alonso, y la "Historia del califa cigüeña" (Wilhelm Hauff, Sara Cone Bryant

    Directory of Open Access Journals (Sweden)

    Hans Christian Hagedorn

    2011-01-01

    Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.

  8. Assessment of the uranium potential of the Jurassic volcanism (Bahía Laura and El Quemado Complexes), Province of Santa Cruz, using ground-borne gamma-ray spectrometry and rock geochemistry

    International Nuclear Information System (INIS)

    Kleinman, L.E.; Maloberti, A.L.; Gayone, M.R.; Kaufmann, C.; Sruoga, P.

    2013-01-01

    Radiometric surveys are a rapid tool to measure uranium (U), thorium (Th) and potassium (K) concentrations in rocks and are very useful in the exploration for radioactive minerals. The distribution of uranium in Jurassic volcanic rocks of the province of Santa Cruz is evaluated in this work using ground gamma-ray spectrometry and rock geochemistry in order to assess its potential to form uranium deposits. Five areas were selected, which had some previous data of high radiometric values and detailed geological information. Measurements were carried out with a portable gamma-ray spectrometer (Exploranium-GR 320®) in andesites, ignimbrites, rhyolites, silicified areas, ash-fall tuffs and lacustrine sediments corresponding to the Bahía Laura and to El Quemado complexes. The results were similar in the five surveyed areas: radiometric concentrations show good positive correlations with chemical composition of the studied rocks for both K and Th, and a relatively poorer correlation for U. Different processes such as magmatic differentiation, vapor phase crystallization, hydrothermal alteration and supergene alteration are reflected in the distribution of these elements. U concentrations increase in the more glassy rocks, in areas with hydrothermal silicification, and in fracture zones, features that should be considered in future surveys. The calkalkaline composition and arc-signatures of the Jurassic magmatism are not the most favorable for uranium enrichment and for concentration of significant mineralizations. However, the extensional tectonic setting; the occurrence of calderas with facies slightly enriched in U and Th, in addition to hydrothermal activity are positive factors for U exploration. (authors) [es

  9. Experimenting with wires, batteries, bulbs and the induction coil: Narratives of teaching and learning physics in the electrical investigations of Laura, David, Jamie, myself and the nineteenth century experimenters. Our developments and instruments

    Science.gov (United States)

    Cavicchi, Elizabeth Mary

    Physics is conventionally taught as a fixed curriculum which students must master. This thesis changes that: curriculum emerges from what learners try and question in experiments they invent. The thesis narrates: three adult students exploring wires, batteries and bulbs with me as teacher; nineteenth century investigations of electromagnetism; my laboratory work replicating historic instruments. In each case, learning arose through activity with materials. Evidences of this are analyzed within narratives and reflections. I used teaching-research, a method developed by Duckworth from Piaget's clinical interviewing, to research and simultaneously extend students' evolving understandings. What I learned through questioning students informed my next interactions; what they learned extended their experimenting. Similarly, I researched historical accounts interactively: improvising experiments to develop my understandings. Studying my own learning deepened my interpretations of students' learning. My students Laura, David and Jamie experimented by: soldering bulbs to wires, making series and parallel circuits, inserting resistive wire that dimmed bulbs, conducting electricity through salt water They noticed bulb brightness and battery heat, compared electricity's paths, questioned how voltage and current relate. They inferred electricity's effects manifest magnitudes of material properties. They found their experiences while learning were inseparable from what they learned. I researched investigations connected with Cavendish's leather fish, Galvani's frogs, Schweigger's wire spiraled around a compass needle, Henry's electromagnets, Faraday's induction ring, induction devices of Page, Callan, Hearder. Experimentally, I made galvanometers, electromagnets, induction rings, induction coil. I observed effects of electromagnetism, internal resistance, induced sparking. Across these investigations, learning developed with instrumental innovations; confusions were productive

  10. Talendid, kes tulid tagasi koju / Laura Mallene

    Index Scriptorium Estoniae

    Mallene, Laura

    2010-01-01

    IsePankuri asutajast Pärtel Tombergist, start-up firmaga Cutefund tegelevast Enn Metsarist, riigikantselei EL-i sekretariaadi konsultandist Katrin Juhandist, Küberkaitse Kompetentsikeskuse töötajast Anna-Maria Talihärmist, LHV Turunduse töötajast Ellen Murulast, Elioni finantsanalüütikust Artur Elmest

  11. [Variation im heutigen Deutsch...] / Laura Tidrike

    Index Scriptorium Estoniae

    Tidrike, Laura

    2008-01-01

    Arvustus: Variation im heutigen Deutsch : Perspektiven für den Sprachunterricht / hrsg. v. Eva Neuland. Frankfurt am Main : Lang, 2006. (Sprache - Kommunikation - Kultur. Soziolinguistische Beiträge ; Vol. 4)

  12. 1980 Annual status report: super-SARA

    International Nuclear Information System (INIS)

    1981-01-01

    The essential tasks of the JRC for the SUPERSARA project during 1980 were therefore twofold: 1. Actuation of an international Task Force with which to: a. discuss in depth the test objectives and the relationships between the SSTP and the world mosaic of activities in the field of LWR fuel behaviour; b. establish a consensus test matrix; c. identify and discuss the major technological problems affecting the feasibility of attaining the consensus test objectives, especially for the boil-down SFD tests. A Task Force with these objectives was necessary in order to provide the elements for a Council decision on phase II. 2. Conservation of the rythm of the main contractor (UKAEA-Harwell) and subcontractors for the timely fabrication of loop components and the timely design of those new aspects of the plant necessary for the boil-down SFD tests

  13. Biokeemilised kõnelused katseklaasis / Laura Herm ; Herm, Laura; Rinken, Ago

    Index Scriptorium Estoniae

    Herm, Laura

    2007-01-01

    Artiklis räägitakse suhtlemise biokeemiast, sellistest biokeemilistest kõnelustest, mida peavad meid moodustavad närvirakud omavahel ja iseeneste sees, ning mida oma katseklaasides uurivad Tartu Ülikooli keemia instituudi bioorgaanilise keemia õppetooli õppurid ja teadurid

  14. Βιβλιοκρισία του: Martin da Canal, Les Estoires de Venise, αγγλική μετάφραση, εισαγωγή και σχόλια LAURA K. MORREALE [Archivio del Litorale Adriatico XII], Padova 2009

    Directory of Open Access Journals (Sweden)

    Μαρίνα ΚΟΥΜΑΝΟΥΔΗ

    2012-03-01

    Full Text Available Βιβλιοκρισία του: Martin da Canal, Les Estoires de Venise, αγγλική μετάφραση, εισαγωγή και σχόλια LAURA K. MORREALE [Archivio del Litorale Adriatico XII], Padova 2009, σσ. xxii + 175 [ΙSBN 978-88-8098-267-8].

  15. Ergenlik Dönemi Okuma Tutumu Ölçeği’nin Türkçe’ye Uyarlanması The Adaptasyon Of Survey Of Adolescent Reading Attitudes (Sara Into Turkish

    Directory of Open Access Journals (Sweden)

    Muhammet BAŞTUĞ

    2013-07-01

    Full Text Available The aim of this study is to adapt the Survey of Adolescent Reading Attitudes SARA to Turkish, which was developed by McKenna, Conradi, Lawrance, Jang, and Meyer (2012, and to test it for validity and reliability. The rationale is that the scale involves one’s attitude towards digital reading. The sample was comprised of 702 sixth,seventh and eighth grade students in Konya- 343 of them being femaleand the remaining 359 being male. The original scale had 18 items infour sub-dimensions, namely academic reading in digital settings (AD,recreational reading in digital settings (RD, academic reading in printsettings (AP and recreational reading in print settings (RP. Theexploratory factor analysis and confirmatory factor analysis revealedthat the four original sub-dimensions were retained when two itemswere omitted. Cronbach’s alpha coefficients were 0.691, 0.802, 0.690,0.660 and 0.623 for the overall scale, RD, RP, AP and AD respectively.The results suggest that the adapted scale is reliable and valid. The 15-item finalized version is appropriate for the Turkish language and use inTurkey. In the development of reading environments and materials,identification of students’ attitudes toward reading in a multidimensionalway is expected to make great contributions to morequalified learning environments. Bu araştırmanın amacı, McKenna, Conradi, Lawrence, Jang ve Meyer (2012 tarafından geliştirilen Ergenlik Dönemi Okuma Tutumu Ölçeği’nin geçerlik ve güvenirliğinin yapılarak Türkçe’ye uyarlanmasıdır. Ölçeğin dijital okumaya karşı tutumu da kapsaması sebebiyle uyarlama çalışmasının uygun olacağı düşünülmüştür. Çalışma grubunu Konya ilinde yer alan ve 6,7 ve 8. Sınıflara devam eden 343’ü kız, 359’u erkek toplam 702 öğrenci oluşturmuştur. Ölçeğin orjinali 18 maddeden ve “Akademik Dijital, Serbest Dijital, Akademik Kağıt ve Serbest Kağıt” olmak üzere 4 alt boyuttan olu

  16. Kohastumus eluks vee ääres / Laura Kuusk

    Index Scriptorium Estoniae

    Kuusk, Laura, 1982-

    2007-01-01

    4. "Ars Baltica" fototriennaal Kumu Kunstimuuseumis kuni 30. IX. Tellervo Kalleineni ja Oliver Kochta-Kalleineni, Alexander Vaindorfi, Coloneli (Thierry Geoffroy) ja Khaled D. Ramadani, Kaspars Goba, Tanja Nellemann Poulseni, Katrin Teesi, Anu Pennaneni, Petra Baueri, Talleiv Taro Manumi (sünd. 1968 Jaapanis, elab Norras), Olga Tshernõsheva, Kristina Inciuraite, Julita Wojciki, Sven Johne, Anna Baumgarti, Arturas Valiauga ja duo J&K (Janne Schäfer, Kristine Agergaard) töödest

  17. Moonutatult ja vahendatult nüüdiskunstist / Laura Kuusk

    Index Scriptorium Estoniae

    Kuusk, Laura, 1982-

    2016-01-01

    Liikumisest kujuteldava ja füüsilise ruumi vahel. Kristina Õlleki magistritööst "Kunstiteos, selle fotodokumentatsioon ja representatsioon digiajastul. When you have the object itself in front of your eyes protsess ja analüüs". Magistritöös uuritakse näitluse vaatamisel tekkivate kujutluspiltide teemat

  18. Toomas Kalve : Kontakt-impressioonid = Contact-impressions / Laura Kuusk

    Index Scriptorium Estoniae

    Kuusk, Laura, 1982-

    2007-01-01

    1990-ndatel hakkas fotograafia omandama täisväärtusliku kunstiliigi rolli. Kunstnikuna tegeleb Toomas Kalve mustvalge fotoga ning tema tööde puhul on oluline roll kasutataval autoritehnoloogial. Ta pildistab plaatkaameraga, mille vanimad negatiivid on aastast 1939 ja Pariisis käsitsi lihvitud objektiiv kannab aasta numbrit 1872. Näitusele jõuavad negatiividest tehtud kontaktkoopiad. Fotografeerimine on tema jaoks rituaal, tema tehika ja töömeetodid on olnud kasutusel fotograafia leiutamisest alates ja samasugune staatilisus õhkub ka tema pruunitoonilistest piltidest. Tema tööd on läbimõeldud, ülimalt komponeeritud, lavastuslikud ning mängulised, hetk ei ole tema jaoks kahanev väärtus, vaid lõpmatu konstant

  19. ACHP | News | First Lady Laura Bush Launches Preserve America Initiative

    Science.gov (United States)

    . Thank you, Secretary Norton, for your service to our country. Thank you, John for your leadership as resources are essentially democratic in spirit, purpose, and method." That is our call today. Our land

  20. Pedro Meyer vastutab oma piltide eest / Laura Kuusk

    Index Scriptorium Estoniae

    Kuusk, Laura, 1982-

    2007-01-01

    Mehhiko fotograafi Pedro Meyeri tutvustus. P. Meyeri ettekande tekst "Kui dokumentaalne teile meeldis, siis digitaalset hakkate armastama", esitatud Soomes Jyväskyläs 2006. a. oktoobris toimunud fotograafiakonverentsil

  1. Walter Benjamin i l'aura de l'autobiografia

    OpenAIRE

    Martí Monterde, Antoni, 1968-

    2006-01-01

    És la biblioteca una forma d'autobiografia? Només caldria un sol escrit que ho demostrés de manera plena per a afirmar que sí, i aquest text el va escriure Walter Benjamin, qui el 17 de juliol de 1931 va publicar, a Die literarische Welt, 'un discurs sobre el col·leccionisme' sota el títol 'Tot desembolicant la meua biblioteca'.

  2. People, art and the human environment / Laura Kuusk

    Index Scriptorium Estoniae

    Kuusk, Laura, 1982-

    2009-01-01

    Tutvustatakse Eestis toimunud kunstiprojekte, mis on seotud kunstipraktika, igapäevase elu, inimsuhete ja avaliku ruumiga. Sirja-Liisa Vahtra ja Otto von Buschi kunstiprojektist (2004), Martin Pääsukese plakatitest "Vabadus" linnaruumis (2008), Ave Teeääre ja Kertu Ehala projektist "Painting Club" Ravila hooldekodus (2007), rühmituse Johnson&Johnson "Paldiski projektist" (2006-2008), Riin Kranna-Rõõsi ja Eve Arpo projektist "Päev ilma mobiilita". Kunstnikest, kes on dokumenteerinud Tallinnas toimunud aktsioone. Kunsti ja sotsiaalset praktikat ühendavatest institutsioonidest (kultuuritehas Polymer, Kultuurikatel, Linnalabor jt.)

  3. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    Directory of Open Access Journals (Sweden)

    Mihael Černetič

    2015-02-01

    Full Text Available The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is analysed from the perspective of mindfulness. Within the course of therapy, parallels were observed between the client's increased mindfulness, improved internal and external contact, strengthened Adult ego state, mastery of introjections, as well as diminished feelings of guilt, improved mood, self care and ability to engage in appropriate separation and individuation. These gains support the conclusion that Integrative Psychotherapy and mindfulness are inherently related and that explicit incorporation of mindfulness may enhance the therapeutic process of Integrative Psychotherapy.

  4. Discovery of carbon nanotubes. Sara ni carbon nanotube e

    Energy Technology Data Exchange (ETDEWEB)

    Iijima, S

    1994-01-20

    This paper describes the following matters on carbon nanotubes (CNt): CNt is discovered in carbon deposits generated in the tip of a negative electrode during DC arc discharge between carbon electrodes. CNt has a construction in which cylinders made of normally several layers are superposed, based on cylindrical crystals in a single layer with six-member rings of carbon atoms laid out. Spiral arrangement of carbon six-member rings has been discovered in the single-layered crystals. Five-member rings exist in a location where the CNt tip is closed, and seven-member rings in a location where the CNt presents a saddle-like curve, without exceptions. It is introduced theoretically that the electronic structure of the single-layered CNt depends on the cylinder diameter and spiral pitch. Replacing part of the carbon negative electrode with iron, and vaporizing iron and carbon simultaneously through arc discharge can result in a single-layered CNt with a diameter of 1 nm. Heating the CNt deposited with metallic lead in an oxygen atmosphere can form CNt containing lead compounds. 19 refs., 9 figs.

  5. AFSC/REFM: Alaska Stock Assessment Results Archive (SARA)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Each year over 50 Alaskan groundfish stock assessments report the condition of Alaskan fisheries resources in the U.S. Exclusive Economic Zone. Stock assessment...

  6. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    OpenAIRE

    Mihael Černetič

    2015-01-01

    The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is ana...

  7. Gene : CBRC-SARA-01-0604 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available and polyadenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82107.1| cleavage and poly...adenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82108.1| cleavage and polyadenylat...ion specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] 3e-16 77% MSTVPTVSCTS...TDRWGLVGTGRCYGSGRGGSMLASCGELSQAIALPKPVLSGHQAGSDPAGSSLYLVLPEGRCLPSVPAHVCPGTAEPAQHSQTPLQRELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVCPWAGVPRAGRPGPQAQPALSFRCMQWPPAPIRHAPASHA ...

  8. Brivaracetam: review of its pharmacology and potential use as adjunctive therapy in patients with partial onset seizures

    OpenAIRE

    Russo, Emilio; Mumoli,Laura; Palleria,Caterina; Gasparini,Sara; Citraro,Rita; Labate,Angelo; Ferlazzo,Edoardo; Gambardella,Antonio; De Sarro,Giovambattista

    2015-01-01

    Laura Mumoli,1 Caterina Palleria,2 Sara Gasparini,1 Rita Citraro,2 Angelo Labate,1 Edoardo Ferlazzo,1 Antonio Gambardella,1 Giovambattista De Sarro,2 Emilio Russo2 1Institute of Neurology, 2Institute of Pharmacology, University Magna Græcia, Catanzaro, Italy Abstract: Brivaracetam (BRV), a high-affinity synaptic vesicle protein 2A ligand, reported to be 10–30-fold more potent than levetiracetam (LEV), is highly effective in a wide range of experimental models of focal an...

  9. 76 FR 72003 - Proposed Collection, Laura Bush 21st Century Librarian Grant Program Evaluation

    Science.gov (United States)

    2011-11-21

    ... Services Act, Public Law 104-208 and is the primary source of federal support for the nation's 123,000... Century Librarian Grant Program Evaluation AGENCY: Institute of Museum and Library Services, National Foundation for the Arts and the Humanities. ACTION: Notice, request for comments, collection of information...

  10. OECD: andke töötukassale raha juurde/ Laura Raus

    Index Scriptorium Estoniae

    Raus, Laura

    2011-01-01

    Majanduskoostöö ja Arengu Organisatsiooni (OECD) riigiülevaate üksuse asejuht Robert Ford tutvustas organisatsiooni raportit Eesti majanduse kohta. Rahandusminister Jürgen Ligi ei pea kõiki soovitusi Eestile sobivaks

  11. Kallas eitab süüdistusi ja kaalub kohtuteed / Mikk Salu, Laura Raus

    Index Scriptorium Estoniae

    Salu, Mikk, 1975-

    2011-01-01

    Euroopa Kontrollikoja endine liige Maarten Engwirda kritiseerib Euroopa Komisjoni volinikku Siim Kallast kontrollikoja-vastase meediarünnaku ja audiitorite sõltumatuse õõnestamise eest. Kallas peab süüdistusi laimuks ja kaalub kohtusse pöördumist

  12. Traditsioonilise folkloori käekäik Bulgaarias / Rahel Laura Vesik

    Index Scriptorium Estoniae

    Vesik, Rahel Laura

    2008-01-01

    Arvustus: Живи човешки съкровища - Бьлгария: Living Human Treasures Bulgaria. Sofia : Academic Publishing House Marin Drinov, 2004. Kokkuvõte Bulgaaria Folkloori Instituudi UNESCO projektist

  13. Sõprus äratab! : Ärkamised ja karjed kino Sõpruse ajaloos / Laura Talvet

    Index Scriptorium Estoniae

    Talvet, Laura

    2010-01-01

    Kinos Sõprus näidati 1990ndate alguses punkansamblist Sex Pistols' valminud dokumentaalfilmi "The Great Rock'N'Roll Swindle" (Suurbritannia 1980), režissöör Julien Temple. Artiklis tsiteeritakse Juq-Kalle Raidi, Kojamehe, Erik Morna ja Tõnu Trubetsky muljeid

  14. "Riik malelaual" = "Country on a Chessboard" / Tarmo Piirmets ; kommenteerinud Laura Kipper

    Index Scriptorium Estoniae

    Piirmets, Tarmo, 1974-

    2015-01-01

    Eesti Ajaloomuuseumi näitus "Riik malelaual. Saksa okupatsioon Eestis 1941-1944" Maarjamäe suvemõisa tallihoones, kuraator Olev Liivik. 19. sajandist pärit tallihoone renoveerimisest. Autor Tarmo Piirmets (Pink); arhitektid Jaak Huimerind, AB Studio Paralleel

  15. Tsoon libiseb ajast ära nagu Kodaki slaididki / Laura Kuusk

    Index Scriptorium Estoniae

    Kuusk, Laura, 1982-

    2006-01-01

    Prantsuse kunstniku Dove Alluoche'i püüdest leida Arvo Iho abiga paigad, kus Andrei Tarkovski 28 aastat tagasi väntas filmi "Stalker", rekonstrueerides Sergei Didõki kaamera vahendusel Tarkovski vaatepunkte ja taastades "tsoonis" tolleaegset atmosfääri. Seeria "Tsoon" koosneb 13 fotost, mida eksponeeritakse Tallinnas, Pariisis, Bueonos Aireses ja mujal

  16. Laura sin aura. La literatura después de la literatura

    Directory of Open Access Journals (Sweden)

    Miguel Ángel García

    2012-06-01

    Full Text Available Para no andarme con rodeos innecesarios diré, ya de entrada y de forma abrupta, que el profesor Juan Carlos Rodríguez ha escrito, en otro golpe audaz de maestría, de gran maestría, un libro contra la Naturaleza Humana. O lo que es lo mismo, un libro a favor de la radical historicidad del discurso literario, como de cualquier otro discurso. Radical historicidad que anda lejos de ser, a estas alturas, una simple provocación para la historia, la teoría y la crítica literarias, por jugar con un famoso título de H. R. Jauss que no disgusta, como leemos en algún momento en este libro magnífico, al profesor Rodríguez. La posición, en el sentido althusseriano del término, la tesis de la radical historicidad de la literatura viene siendo empleada, con resultados deslumbrantes, por este infatigable trabajador teórico de la literatura desde hace casi cuarenta años; y sigue siendo tan válida y tan actual, a mi parecer, como el primer día.

  17. Positiivne ränne Baltimaade kunstielus / Emma Duester ; intervjueerinud Laura Põld

    Index Scriptorium Estoniae

    Duester, Emma

    2015-01-01

    Emma Duesteri dissertatsioonist, mille raames uuriti Tallinna, Riia ja Vilniuse päritolu kunstnike sisserännet Suurbritanniasse. Mobiilsusest immigratsiooniküsimuse kontekstis, kunstielust Baltimaades

  18. Kunstnikuraamat - teos või dokument? / Alissa Nirgi, Marge Monko, Anu Vahtra ; intervjueerinud Laura Kuusk

    Index Scriptorium Estoniae

    Nirgi, Alissa, 1993-

    2016-01-01

    Alissa Nirgi, Marge Monko ja Anu Vahtra mõtteid, kuidas nende viimaste aastate kunstiprojektid raamatukaante vahele jõudsid. Alissa Nirgi fotoseeriast ja raamatust "Kaspar istub". Marge Monko fototööst "Kümme pärast kümmet", performance'ist ja raamatust "Don't wind it up, turn it on". Anu Vahtra installatsioonidest ja raamatust "Untitled"

  19. USA politoloogid : Obama võit oleks ka Eesti oma / Laura Vetik

    Index Scriptorium Estoniae

    Vetik, Laura

    2008-01-01

    USA politoloogide sõnul oleks pingestunud Venemaa ja USA suhete taustal Eestile kasulikum, kui 56. USA presidendivalimised võidaks demokraat Barack Obama. Erinevate politoloogide hinnanguid. Vt. samas: Obama ja McCain loovad kabinette

  20. Iseloomukasvatus Ameerika Ühendriikides / Merle J. Schwartz ; tõlkinud Kadri Lutt, Laura Lilles

    Index Scriptorium Estoniae

    Schwartz, Merle J.

    2008-01-01

    Iseloomukasvatus on mitmekülgne käsitlusviis, milleni tõhusamalt jõutakse üldise koolireformi kaudu. See hõlmab lapse arengu mõistmist, iseloomu kasvatamist, sobivat pedagoogilist käsitlusviisi

  1. Paris Photo 2015 / Kristel Schwede, Annika Haas, Laura Põld, Piret Frey

    Index Scriptorium Estoniae

    2015-01-01

    Rahvusvaheline fotomess "Paris Photo 2015" 12. kuni 15. novembrini Pariisi messihallis Grand Palais. Eestit esindasid messil oma loominguga Jaanus Samma, Sigrid Viir, Krista Mölder (Temnikova & Kasela galerii)

  2. Ülikooli kõrvale sobib paindlik töö / Laura Mallene

    Index Scriptorium Estoniae

    Mallene, Laura

    2008-01-01

    Tööturul tööjõupuuduse tõttu oodatud üliõpilastest ja kõrgkoolis õppimise kõrvalt töötamisest. Arvamust avaldab ka TLÜ rekreatsioonikorralduse tudeng ja kooli kõrvalt portjeena töötav O. Luup ning CVO Recruitment Estonia ärisuuna juht T. Raamat ja Eesti Üliõpilaskondade Liidu juhatuse esimees E. Veldre

  3. Tundmatud kohad ja asjade loomus / Katrine Gram Sloth, Johna Hansen ; intervjueerinud Laura Põld

    Index Scriptorium Estoniae

    Gram Sloth, Katrine, 1983-

    2016-01-01

    Taani kunstnik Katrine Gram Sloth ja Rootsi arhitekt Johna Hansen räägivad oma lapsepõlvest, kunstnikuteest, loomingust. Johna Hanseni jaapanipärasest einelaua installatsioonist "Laud" (2015-2016), Katrine Gram Slothi Islandil loodud teosest "Vista Revisited" (2015)

  4. Laura Shapiro, Something from the Oven: Reinventing Dinner in 1950s America

    Directory of Open Access Journals (Sweden)

    Annie Hubert

    2005-05-01

    Full Text Available This very intelligent book, relates and analyses, not without humour, what happened in the American home kitchens in the 1950’s. After the Second World War, when many women went to work in various armament factories, a reinforced and even more idealised image of woman came into force. It took up some of the older Victorian ideals of the feminine and put it to a more modern taste. Women were ideally supposed to care for their families, in lovely suburban homes, full of appliances to help with ...

  5. Kunst on vaimu avardumise üks keskseid koldeid / Peeter Maria Laurits ; interv. Laura Kuusk

    Index Scriptorium Estoniae

    Laurits, Peeter, 1962-

    2006-01-01

    Peeter Laurits oma loomingust, näitustest "Voolav labürint" (koostöö Katzi ja Hollandi Pavlov Medialabiga) SEB Ühispanga galeriis, "Meistriteoste varjus" (koos Laurentsiusega) Kadrioru Kunstimuuseumis, isikunäitusest "Vana labürint" ArtDepoos, autorikaitsest jm.

  6. Informe científico de investigador: Villata, Laura Sofía (2012-2013)

    OpenAIRE

    Villata, Laura Sofía

    2013-01-01

    En el presente período se estudiaron las reacciones entre compuestos polifenólicos y especies radicalarias. Se trabajó con flavonas (Apigenina) y flavanonas (Naringenina, Hesperetina)[1,2]. Estas sustancias presentes principalmente en cítricos, naranja, limón mandarina y pomelo, también en orégano, tomillo y otras especies vegetales que se utilizan tanto como condimentos aromáticos así también para preparar infusiones presentan de conocida acción antioxidante [3-5]. Se realizaron es...

  7. Informe de personal de apoyo: Garro, María Laura (2012-2013)

    OpenAIRE

    Garro, María Laura

    2013-01-01

    Proyectos de investigación en los cuales colabora: a) Depilado libre de sulfuro de sodio .Empleo de preparados enzimáticos como agentes depilantes. b) Valorización de residuos sólidos de curtiembre: Biotransformación Fúngica del residuo pelo vacuno.

  8. Informe de personal de apoyo: Garro, María Laura (2014-2015)

    OpenAIRE

    Garro, María Laura

    2015-01-01

    Proyectos de investigación en los cuales colabora: a) Depilado libre de sulfuro de sodio .Empleo de preparados enzimáticos como agentes depilantes b) Valorización de residuos sólidos de curtiembre: Biotransformación Fúngica del residuo pelo vacuno

  9. ERKI moeshow kui karnevallik nähtus 1980. aastate Nõukogude Eestis / Laura Paju, Ester Võsu

    Index Scriptorium Estoniae

    Paju, Laura

    2008-01-01

    Analüüsitakse Eesti NSV Riikliku Kunstiinstituudi (ERKI) tudengite korraldatud moeshowde karnevallikke aspekte, lähtudes vene filosoofi, kirjandusteadlase ja semiootiku Mihhail Bahtini karnevaliteooriast. Eesmärgiks oli ka kunagiste korraldajate ja aktiivsete osalejate arvamused ja kuidas nad neid sündmusi tänapäeval mõtestavad

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1| unnamed protein product [Mus musculus] gb|EAW65549.1| non imprinted in Prader-Willi/Angelman syndrome 1, ...isoform CRA_a [Homo sapiens] gb|EAW65551.1| non imprinted in Prader-Willi/Angelman syndrome 1, isoform CRA_a... [Homo sapiens] gb|ABM82178.1| non imprinted in Prader-Willi/Angelman syndrome 1 ...[synthetic construct] gb|ABM85364.1| non imprinted in Prader-Willi/Angelman syndrome 1 [synthetic construct] CAD97953.1 1e-113 81% ...

  11. Sara Lipton in Conversation with Eva Janáčová. [Interview

    Czech Academy of Sciences Publication Activity Database

    Janáčová, Eva; Lipton, S.

    2017-01-01

    Roč. 65, č. 1 (2017), s. 66-70 ISSN 0049-5123 Institutional support: RVO:68378033 Keywords : Judaism * Middle Ages * art Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Arts, Art history

  12. Low energy neutral atom imaging on the Moon with the SARA ...

    Indian Academy of Sciences (India)

    (LENA) imaging mass spectrometer, which will perform remote sensing of the lunar surface via detection of neutral atoms in the energy range from 10eV to 3keV from a 100km polar orbit. ..... as studying the existence of ion void regions around.

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1549 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndent protein export [Herminiimonas arsenicoxydans] emb|CAL63167.1| twin-arginine translocase subunit, sec-i...ndependent protein export [Herminiimonas arsenicoxydans] YP_001101288.1 2.0 37% ...

  14. The State Authorization Reciprocity Agreement (SARA): A Good Idea Whose Time Has Come

    Science.gov (United States)

    Longanecker, David; Hill, Marshall A.

    2014-01-01

    In this article the authors argue that states need a new way to oversee the delivery of postsecondary distance education across state borders. They assert that the current process is too spotty to assure consistent consumer protection and too cumbersome and expensive for institutions. Because education is not specified in the US Constitution as a…

  15. 76 FR 39967 - 30-Day Notice of Proposed Information Collection: U.S. National Commission for UNESCO Laura W...

    Science.gov (United States)

    2011-07-07

    ... for justice, for the rule of law and for the human rights and fundamental freedoms which are affirmed for the peoples of the world, without distinction of race, sex, language or religion, by the Charter...

  16. Kunstiakadeemia arhitektuuritudengid Pariisis / Artur Staškevitš, Laura Linsi, Roland Reemaa ... [jt.] ; üles kirjutanud Margit Mutso

    Index Scriptorium Estoniae

    2011-01-01

    Eesti Kunstialadeemia arhitektuuri eriala tudengite muljeid Pariisist ja osalemisest Pariisi Belleville'i arhitektuurikõrgkoolis (Ecole Nationale Supérieure d'Architecture Paris-Belleville) toimunud töötoas. Tuli kavandada üliõpilaselamu elitaarsesse Marais' piirkonda, leida üliõpilaselamise mudel

  17. Rundum artist-run space and its elusive form / Hanna Laura Kaljo, Mari-Leen Kiipli, Kulla Laas ... [jt.

    Index Scriptorium Estoniae

    2015-01-01

    Rundum on 2013. a septembris Tallinnas loodud liikuv loominguline platvorm, mille eesmärgiks on suhestuda erinevate kohtadega, reageerida tühikutele Eesti loomemaastikus ning uurida sealjuures ka omaalgatuslike praktikate võimalikkust kohalikus kontekstis. Vestlusringis Rundumi algatajad Mari-Leen Kiipli, Kulla Laas, Aap Tepper, Mari Volens, Kristina Õllek

  18. Üha enam Eesti noori tahab Austraaliasse tööd otsima minna / Laura Raus

    Index Scriptorium Estoniae

    Raus, Laura

    2011-01-01

    Austraalia statistikast lähtub, et 2009/2010 majandusaastal sai Austraalia Working Holiday viisa 1387 Eesti noort. Austraalis töötamist võimaldavad viisad. Töötasud Austraalias. Tallinna noorte infokeskuse Austraalias töötamisvõimalusi tutvustavast seminarist

  19. E-Eestist e-Euroopasse: elektrooniline allkiri riigisiseses ja piiriüleses suhtluses / Laura Kask

    Index Scriptorium Estoniae

    Kask, Laura, 1988-

    2017-01-01

    Euroopa Parlamendi määrusest 910/2014, E-identimise ja e-tehingute usaldusteenuste seadusest, e-allkirjade tasemetest. Elektroonilise allkirja õiguslikust tähendusest ning vorminõuetest era- ja haldusõiguslikes toimingutes. Elektroonilise allkirja piiriülesest tunnustamisest

  20. Informe científico de investigador: Villata, Laura Sofía (2010-2011) 

    OpenAIRE

    Villata, Laura Sofía

    2011-01-01

    En el presente período se continuaron los estudios de la capacidad antioxidante de sustancias presentes en diferentes productos naturales: flavonas (Apigenina) y flavanonas (Naringenina, Hesperidina, Hesperitina)[1,2]. Estas sustancias se encuentran presentes principalmente en cítricos, naranja, limón, mandarina y pomelo y también en orégano, tomillo y otras especies vegetales que se utilizan tanto como condimentos aromáticos así también...

  1. ENTRE LAURA Y CRISTINA. NOTAS SOBRE LA RELACIÓN ENTRE BIOGRAFÍA, ACTIVISMO Y ACCIÓN COLECTIVA

    Directory of Open Access Journals (Sweden)

    Fernando Aiziczon

    2009-07-01

    Full Text Available The follows reflections want to research the possible relation between the biography, activism and collective action. First, I check puntually the contributions from the collective action theory, then I revise the explanations about the reason people decide to mobilize, finally I propose the construction of the habiltus militante concept. After that, I work about two cases of women who had taken part in two big and noticeable puebladas that happened in the north of Patagonia province of Neuquén, Argentina, between 1996-97, well-known like puebladas cutralquenses. From their interviews, Iwould try to start a debate about the different derives of their biographical and political trajectories.

  2. Ma tean, mida sa näitad end olevat teinud läinud suvel / Laura Kuusk

    Index Scriptorium Estoniae

    Kuusk, Laura, 1982-

    2006-01-01

    Kuraator Marco Laimre juhendamisel valminud Eesti Kunstiakadeemia III kursuse fotograafiaüliõpilaste suvepraktika tööde näitus "Ma tean, mida sa tegid läinud suvel / I know what you did last summer" Eesti Kunstiakadeemia galeriis kuni 3. X. Helina Kõrmi, Dmitri Gerassimovi, Kristjan-Jaak Tammiksaare, Anne-Mai Pällo, Tuuli Antsovi, Terje Ugandi, Ivar Veermäe, Riika Tauriaineni, Kätly Kaibaldi, Raul Viitungi ja Andrus Kaursoni töödest

  3. 75 FR 67770 - Sara Lee Corporation Including On-Site Leased Workers From EDS, Hewitt Packard, Sapphire...

    Science.gov (United States)

    2010-11-03

    ..., Deductions, Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial... this certification to include workers providing shared financial and information technology services at..., Deductions, Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial...

  4. In Ukraine, Fear of Being a Resurgent Russiaѫs Next Target / Nicholas Kulish, Sara Rhodin

    Index Scriptorium Estoniae

    Kulish, Nicholas

    2008-01-01

    Gruusia ja Venemaa vaheline konflikt on suurendanud ebakindlust Venemaa suhtes ka Ukrainas, Poolas ja Balti riikides. Eesti president Toomas Hendrik Ilves leiab, et Gruusia sündmustel on tõsised tagajärjed rahvusvahelise rahu jaoks. Vabariigi President töövisiidil Gruusias 12.-13.08.2008

  5. Feminism and Childcare: A Roundtable with Sara de Benedictis, Gideon Burrows, Tracey Jensen, Jill Rutter and Victoria Showunmi

    OpenAIRE

    Jo Littler; Alison Winch

    2016-01-01

    This is an edited transcript of a roundtable event held at City University London in late 2014. The point of this seminar was to ask: what progress have we made towards men and women equally sharing the childcare? Rearranging the domestic division of labour was a crucial issue foregrounded by second-wave feminism: but how much progress has actually been made since then? Second-wave feminists and beyond have recently been vocal in replying: ‘not so much.’ For example, Bea Campbell has argued t...

  6. Motivating the European voter: Parties, issues and campaigns in European Parliament elections / Sara B. Hobolt, Jae-Jae Spoon

    Index Scriptorium Estoniae

    Hobolt, Sara B.

    2012-01-01

    Valijate käitumisest Euroopa Parlamendi (EP) valimistel liikmesriikides (sh Eesti), valijakäitumise erinevustest võrreldes siseriiklike valimistega ja parteide mõjust valijakäitumisele. Tabelid, joonised

  7. OECD: Eesti tööandjad võiks haigushüvitist pikemalt maksta / Christopher Prinz ; intervjueerinud Laura Raus

    Index Scriptorium Estoniae

    Prinz, Christopher

    2011-01-01

    Paljudes OECD riikides on toimunud nihe töötuselt töövõimetusele. OECD ekspert leiab, et töövõimetuspensionäride arvu alandamiseks võiks pikendada perioodi, mille kestel maksab töötajale haigushüvitist tööandja ja et osalise töövõimetusega inimesi võiks käsitleda tavalise töötuna

  8. Los Consejos de Amalia a su hija Laura. Propaganda moral y construcciones genéricas en un texto escolar a comienzos del siglo XX en Argentina

    Directory of Open Access Journals (Sweden)

    Adrián Cammarota

    2012-01-01

    Full Text Available El trabajo analiza un texto escolar utilizado en las escuelas primarias a principios del siglo XX. El texto, que no fue único en su tipo, da cuenta de una serie de tópicos sostenidos asiduamente en las escuelas para firmar una supuesta naturaleza “femenina” y “masculina”. Los Consejos delimitaban el rol de las niñas en la futura vida social, acorde con los preceptos que estructuraron la denominada teoría de la domesticidad. Consideramos que esta obra tenía como finalidad defender un supuesto legado natural. Este parecía peligrar ante los avatares del proceso de modernización por el cual atravesó la Argentina a fines del siglo XIX, con el crecimiento urbano y su ingreso en el mercado mundial.

  9. Sõltuvussuhtes sõlmitud käendusleping : [magistritöö] / Laura Kask ; Tartu Ülikool, õigusteaduskond ; juhendaja: Irene Kull

    Index Scriptorium Estoniae

    Kask, Laura, 1988-

    2013-01-01

    Käendusest kui isiklikust tagatisest, perekondlikest sõltuvussuhetest käenduslepingus, sõltuvussuhtest juriidiliste isikute kohustuste käendamisel, sõltuvussuhtes sõlmitud globaalsest tagatiskokkuleppest

  10. The Iban Dairies of Monica Freeman 1949-1951. Including Ethnographical Drawings, Sketches, Paintings, Photographs and Letters, Laura P. Appell-Warren  (ed.

    Directory of Open Access Journals (Sweden)

    Antonio Guerreiro

    2012-09-01

    Full Text Available Few anthropologists have yet published their field dairies; until now Malinowski’s dairy is considered as one of the most fascinating piece of ethnographical writing. Monica Freeman’s dairies document the Freemans’ long Iban fieldwork in Sarawak (June 1949-May 1951, at the time a Crown colony (the State joined the Federation of Malaysia in 1963. This book is a welcome addition to both Anthropological litterature and Iban Studies. Derek Freeman (1916-2001, coming originally from New Zealan...

  11. E-kursus nõuab aega ja pühendumist / Ivo Leito, Irja Helm, Anne Krull ; intervjueerinud Laura Vetik

    Index Scriptorium Estoniae

    Leito, Ivo, 1972-

    2015-01-01

    Intervjuu Tartu Ülikooli keemiakursuse "Estimation of Measurement Uncertainty in Chemical Analysis" autorite Ivo Leito ja Irja Helmiga ning Tartu Kutsehariduskeskuse e-kursuse "Praktiline keemia" autori Anne Krulliga

  12. Riikide ähvardamine trahviga sai europarlamendilt rohelise tule / Laura Raus ; kommenteerinud Wolf Klinz, Ivo Strejcek, Nikolaos Chountis, Ville Itälä

    Index Scriptorium Estoniae

    Raus, Laura

    2011-01-01

    Europarlament kiitis eile heaks kuue õigusakti paketi, mis annab võimaluse hakata alates 2014. aastast trahvima euroala riike, kelle majandus on tasakaalust väljas ja kes selle vastu vajalikke meetmeid ette ei võta

  13. O tango e o relógio: dois percursos de leitura em Quando Dio ballava il tango, de Laura Pariani

    Directory of Open Access Journals (Sweden)

    Vera Horn

    2003-07-01

    Full Text Available L´emigrazione italiana vista dalla parte delle donne, il riscatto della memoria al suono del tango. Sedici donne che si incrociano costantmente raccontano le vicende dell´emigrazione italiana in Argentina, in un´arco di anni che comprende due secoli. tutte le sofferenze e dolori degli emigrati e dei loro discendenti. Il riscatto della loro memoria tramite Corazón, che raccoglie le fila del romanzo e ricrea de storie di famiglia per rincontrarsi col suo passato. Il tango pervade le vicende narrate, como sottofondo musicale ed inevitabile passo di danza. Un viaggio a ritroso in cerca della memoria e dell´identità.

  14. Mujeres militantes en el movimiento de Derechos Humanos de Argentina. El caso Tucumán

    Directory of Open Access Journals (Sweden)

    Rubén Isidoro Kotler

    2008-09-01

    Full Text Available Cet article analyse quelques caractéristiques de mouvements défenseurs des Droits de l'Homme dans la province de Tucuman (Argentine en mettant en exergue le militantisme des femmes dans ces organisations à partir de témoignages de : Laura Figueroa, avocate des Droits de l'Homme pour « l'Asociación de abogados por los derechos humanos », une organisation qui avait une petite mais intense participation au cours des premières années de transition vers la démocratie ; Sara Mrad, la principale leader de "Madres...mayo" dans la région de Tucuman, depuis 1981 jusqu'à nos jours ; Angela Nassif, la dirigeante historique du Parti Communiste Révolutionnaire dans la région du Tucuman et l’une des fondatrices de « l'Asamblea por los Derechos Humanos » dans cette province en 1984, et enfin Josefina Centurión, militante au H.I.JO.S Tucuman.El artículo pretende analizar algunas de las características del movimiento de derechos humanos de Tucumán, destacando la participación femenina en estas organizaciones a partir del testimonio de cuatro militantes : Laura Figueroa, abogada por los derechos humanos y ex miembro de la Asociación de Abogados por los derechos humanos, organización que tuvo una breve pero intensa vida en la transición democrática en la provincia de Tucumán ; Sara Mrad, referente del movimiento de Madres de Plaza de Mayo filial Tucumán desde los comienzos de la agrupación en 1981 hasta la actualidad ; Ángela Nassif, histórica dirigente del Partido Comunista Revolucionario y quien fuera una de las fundadoras de la Asamblea Permanente por los Derechos Humanos en Tucumán en 1984 ; y finalmente Josefina Centurión, activa militante en la organización H.I.J.O.S. en Tucumán.This paper aims to analyze some characteristics of de Human Right movement of Tucumán (Argentina stressing the militancy of women in those organizations, based on the testimonies of: Laura Figueroa, Lawyer of Human Right causes and

  15. Larger, Higher-level Academic Institutions in the US Do Not Necessarily Have Better-resourced Library Web Teams. A Review of: Connell, Ruth Sara.

    Directory of Open Access Journals (Sweden)

    Suzanne Lewis

    2008-12-01

    Full Text Available Objective – To discover how library Web teams’ staffing, backgrounds, tools, and professional development differ among various types of academic libraries.Design – Survey.Setting – Academic libraries in the United States.Subjects – Academic library Web team members.Methods – A systematic sample of every twelfth institution on The Carnegie Classification of Institutions of Higher Education list was used to establish a sample group. A Web search was carriedout to identify each institution’s library Web site and contact information for the Web site designer or most appropriate alternative person. Institutions were excluded from the sample if they had no Web site at all, had no library Web site, had a Web site that did not mention a library, or had a Spanish language Web site. In September 2006 an e-mail was sent to the contact for each institution in the sample group asking them to participate in an online survey. A follow up e-mail was sent two weeks later and the survey closed after one month. The survey respondents were asked to identify their institutions so that analysis of the results in relation to the sizeand type of institution could be carried out. The researchers used a simplified version of the Carnegie classification to sort the responding institutions into five main groups.Main Results – The systematic sample consisted of 288 institutions (sample size 6.5%. The profile of the responding institutions was as follows: associate’s colleges (35.5%, baccalaureate colleges (18.2%, master’s colleges and universities (20.9%, doctorate-granting universities (9% and special focus institutions (15.5%. A total of 110 institutions completed the survey, yielding a response rate of 38.19%, although not all respondents answered all the survey questions. The final sample of 110 was 2.5% of the total 4384 institutions on the Carnegielist. Seventy-one per cent of institutions with multiple libraries shared Web teams, with two-year colleges more likely (91.7% to share a Web team than four-year or above institutions (60.9%. The majority of responding institutions (94.4% used in-house library Web site design, with only 5.6% of respondents outsourcing this task.Nearly half (49% of respondents indicated that library Web design was done by one person and even the larger libraries did not necessarily have larger Web teams. Very few Web team members (4.9% had Web design as their primary role; the majority (83.5% indicated that it was just one component of their job. Web team members from master’s- and doctorate-granting institutions were more likely to have taught themselves Web design, while those from associate, baccalaureate and special focus colleges were more likely to have taken Web design courses. For all respondents, the most commonly listed quality for selection to the Web team was an interest in Web design and the most valued skill for library Web designers was the ability to organise information effectively.Knowledge of Web authoring software and basic HTML coding were the most commonly listed knowledge requirements for Web team members. A significant number of respondents indicated that they or other Web team members did not have access to Web authoring (36.9% and image editing (52% software. Generally (except for two very large institutions, the larger institutions were more likely to use database-driven systems for their library Web sites and the smaller institutions were more likely to use content management systems. Associate’s and special focus colleges were less likely than other types of institutions to use either database driven or content management systems. Associate’s institutions were more likely to achieve ADA (Americans with Disabilities Act Web accessibility compliance. Only 48.6% of respondents utilised usability testing during Web site design.Conclusion – The author expected that institutions providing higher levels of education would have better-resourced Web design and training, but the results of the survey did not support this expectation. One reason why associate’s colleges performed better than other institutions in some areas of Web design may be that these colleges tend to offer more Web design and computer technology courses than baccalaureate, master’s and doctorate-granting institutions. Web site design and testing attracted fewer resources than might be expected in academic libraries. Across all types of institutions, Web design tended to be the responsibility of a small team or one person, with most Web designers having other responsibilities apart from the library’s Web site. Just over half of the institutions surveyed did not implement usability testing of their library Web sites.

  16. The National Shipbuilding Research Program, 1990 Ship Production Symposium, Paper No. 4B-1: Solving SARA Compliance with Computerized Hazardous Materials Tracking

    National Research Council Canada - National Science Library

    Johnston, Don; Schoenleber, Dave

    1990-01-01

    ...) has forced facilities to keep track of hazardous materials as never before. EPCRA contains five major reporting requirements including planning notification, emergency release notification, Material Safety Data Sheet (MSDS...

  17. MULTICULTURALISM AND RELIGIOUS-BASED CONFLICT: EVENTS OF CONFLICT BASED ON ETHNICITY, RELIGION, RACE, AND INTER-GROUP RELATIONS (SARA IN THE CITY OF PONTIANAK

    Directory of Open Access Journals (Sweden)

    Lailial Muhtifah

    2013-06-01

    Full Text Available There is a tendency of similar idea that caught the conflict prevention and management efforts nowadays to the articles of the Charter of Medina which was religious-based and containing the theory of civil society. It I mostly on the handling of conflict which tends to take preventive measures and to stop the conflict directly, as well as making a comprehensive synergistic effort to mange conflict. Conflict prevention is a core component of a comprehensive Conflict Management Program. This paper explores the conflict that occurred in Ponianak between a group of people from ethnic Dayak and members of an Islamic organization in 2012 which includes an important lesson for the people of West Kalimantan, both for the government and the community elements especially in dealing with a dispute between different groups of people. An integrative prevention has been proven to be able to answer the question of handling a conflict that has a potential to escalate into a full-scale riot. This work concludes that an integrative conflict handling model may become a viable alternative model to be adopted by the community of West Kalimantan in particular and other societies in general. A synergic integrative conflict handling model that reflects local wisdom of the people of Pontianak is expected to inspire real peace for various communities with a multicultural background. Key words: multicultural, religious-based conflict, ethnicity, religion

  18. Isotropic quantum walks on lattices and the Weyl equation

    Science.gov (United States)

    D'Ariano, Giacomo Mauro; Erba, Marco; Perinotti, Paolo

    2017-12-01

    We present a thorough classification of the isotropic quantum walks on lattices of dimension d =1 ,2 ,3 with a coin system of dimension s =2 . For d =3 there exist two isotropic walks, namely, the Weyl quantum walks presented in the work of D'Ariano and Perinotti [G. M. D'Ariano and P. Perinotti, Phys. Rev. A 90, 062106 (2014), 10.1103/PhysRevA.90.062106], resulting in the derivation of the Weyl equation from informational principles. The present analysis, via a crucial use of isotropy, is significantly shorter and avoids a superfluous technical assumption, making the result completely general.

  19. Quantum walks, deformed relativity and Hopf algebra symmetries.

    Science.gov (United States)

    Bisio, Alessandro; D'Ariano, Giacomo Mauro; Perinotti, Paolo

    2016-05-28

    We show how the Weyl quantum walk derived from principles in D'Ariano & Perinotti (D'Ariano & Perinotti 2014Phys. Rev. A90, 062106. (doi:10.1103/PhysRevA.90.062106)), enjoying a nonlinear Lorentz symmetry of dynamics, allows one to introduce Hopf algebras for position and momentum of the emerging particle. We focus on two special models of Hopf algebras-the usual Poincaré and theκ-Poincaré algebras. © 2016 The Author(s).

  20. Multiphoton states and amplitude k-th power squeezing

    International Nuclear Information System (INIS)

    Buzek, V.; Jex, I.

    1991-01-01

    On the basis of the work of d'Ariano and coworkers a new type of multiphoton states is introduced. Amplitude k-th power squeezing of the multiphoton states are analysed. In particular, it is shown that even if the multiphoton states do not exhibit ordinary squeezing they can be amplitude k-th power squeezed

  1. Iga gümnasist saab õiguse õppida ettevõtluse põhitõdesid : ettevõtlusõpet takistab Eestis ärikogukonna passiivsus / Caroline Jenner, Hendrik Hindov ; intervjueerinud Laura Raus

    Index Scriptorium Estoniae

    Jenner, Caroline

    2011-01-01

    Intervjuu rahvusvahelise ettevõtlusorganisatsioonide koostöövõrgustiku Junior Achievement - Young Enterprise Europe juhi Caroline Jenner'i ja ettevõtja Hendrik Hindoviga ettevõtlus- ja majandusõppest gümnaasiumis

  2. Vaevaline koostöö uute kunstimuuseumide rajamise ja rahastamise protsessis = Thorny collaboration in the processes of founding and funding new art museums : II koht teaduspublikatsioonide kategoorias / Margaret Tali, Laura Pierantoni

    Index Scriptorium Estoniae

    Tali, Margaret

    2009-01-01

    Uuring tutvustab võrdlevalt uute kunstimuuseumide rajamisega seotud motivatsioone kolmes riigis ning mahukate ehitusprojektide rahastamist, keskendudes uute huvigruppide rollile Ida-Euroopa riiklike kunstimuuseumide tegevuses. Töö andmed on kogutud koostöös kolme muuseumiga: LUMU kunstimuuseum Budapestis, KUMU kunstimuuseum Tallinnas ja MSU kunstimuuseum Zagrebis

  3. Mart Busche, Laura Maikowski, Ines Pohlkamp, Ellen Wesemüller (Hg.: Feministische Mädchenarbeit weiterdenken. Zur Aktualität einer bildungspolitischen Praxis. Bielefeld: transcript Verlag 2010.

    Directory of Open Access Journals (Sweden)

    Martina Rauter

    2012-11-01

    Full Text Available Den gemeinsamen Ort für die Verhandlung von durchaus widersprüchlichen Positionen der Frauen- und Geschlechterforschung bildet die feministische Mädchenarbeit in einer unabhängigen Bildungseinrichtung. Die Autor/-innen begegnen wiederkehrender Kritik mit gezielter Wachsamkeit für bestehende Benachteiligungsstrukturen. Das Argumentationsrepertoire findet in dekonstruktiven, queer-feministischen und intersektionalen Theorien wirksame Erweiterungen. Die Aneignung dieser kritischen Stimmen erlaubt die Aktualisierung des Wertes der feministischen Mädchenarbeit für eine bildungspolitische Praxis.Feminist girls’ work in an independent educational institution establishes the common space for the negotiation of indeed contradictory positions of women’s and gender studies. The authors counter recurrent criticism with focused vigilance for existing structures of discrimination. The repertoire of reasoning is effectively expanded through deconstructivist, queer-feminist, and intersectional theories. The adoption of these critical voices allows an update of the value of feminist girls’ work for educational political practice.

  4. Torres, Andreína; Alvarado, Geannine & González, Laura. Violencia y seguridad ciudadana: algunas reflexiones. Ecuador: Facultad Latinoamericana de Ciencias Sociales (Flacso Ecuador y Centro Internacional de Investigaciones para el Desarrollo (IDRC-CRDI

    Directory of Open Access Journals (Sweden)

    Astrid Verónica Bermúdez Díaz

    2013-06-01

    Full Text Available Violencia y seguridad ciudadana: algunas reflexiones, es una obra de divulgación científica que hace parte de la Colección Frontera, una línea editorial en la que convergen los esfuerzos de la Facultad Latinoamericana de Ciencias Sociales, (Flacso-Ecuador, y el Centro Internacional de Investigaciones para el Desarrollo, (IDRC-CRDI por trascender la mirada nacionalista que ha recaído sobre las fronteras y rescatar las dinámicas y demandas locales que han sido ignoradas tanto en la producción de conocimiento como en la formulación e implementación de políticas públicas de seguridad ciudadana. El libro constituye un estado del arte sobre el concepto de seguridad ciudadana en Ecuador y su articulación con el diseño de políticas públicas en esta materia.

  5. RESENHA - OLIVEIRA, LAURA NOGUEIRA (ORG.. OUVIR PARA CONTAR: MEMÓRIAS DE ALUNOS NEGROS DO CURSO TÉCNICO EM QUÍMICA CEFET-MG DE 1964 A 1978. BELO HORIZONTE: CEFET-MG, 2015. 124P.

    Directory of Open Access Journals (Sweden)

    Fábio Liberato de Faria Tavares

    2016-09-01

    Full Text Available Resenha:Resumo: Neste livro, são apresentados o resultado de pesquisas, que se iniciaram no Arquivo Geral do CEFET, com o levantamento de dados acadêmicos e sociais dos alunos matriculados no curso técnico de Química Industrial da Escola Técnica de Belo Horizonte, desde o ano de 1964, quando ocorreu a sua fundação, até 1978, às vésperas da alteração de nome e perfil da Escola Técnica, com o oferecimento de graduações, como a de engenheiro de operações.Palavras Chave:História Oral, Estudantes Negros, Química CEFET-MGAbstract: In this book, we present the result of research that began in the General CEFET file with the survey of academic and social data of students enrolled in technical school of Industrial Chemistry at the Technical School of Belo Horizonte, from the year 1964 when it was its founding until 1978, on the eve of the change of name and profile Technical School, by offering graduations, as operations engineer.Keywords: Oral History, Black Students, CEFET QuímicaRecebido em: 07/12/2015  – Aceito em 23/06/2016

  6. Écrits sur le corps : Genre, colonialisme et espace public dans l’affaire Maria Hertogh (1950. Master 2 d’histoire contemporaine, EHESS, (dir. Laura L. Downs, 2010

    Directory of Open Access Journals (Sweden)

    Christina Wu

    2011-10-01

    Full Text Available Le 3 août 1950, la colonie de Singapour s'éveille sous une avalanche de reportages relatant le mariage discret d'une jeune néerlandaise de 13 ans avec un musulman malais de 22 ans. L'opinion publique est scandalisée par le jeune âge de la mariée. Maria Hertogh, la jeune fille en question, est déjà en fait sous le feu des projecteurs depuis que sa famille catholique hollandaise et sa mère adoptive musulmane malaise se disputent son droit de garde. Cette nouvelle avive donc les tensions déjà ex...

  7. HIV/AIDS misconceptions may be associated with condom use ...

    African Journals Online (AJOL)

    HIV/AIDS misconceptions may be associated with condom use among black South Africans: an exploratory analysis. Laura M Bogart, Donald Skinner, Lance S Weinhardt, Laura Glasman, Cheryl Sitzler, Yoesrie Toefy, Seth C Kalichman ...

  8. Screamy Bird

    DEFF Research Database (Denmark)

    Tarby, Sara; Cermak, Daniel

    2016-01-01

    Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016.......Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016....

  9. PREFACE: XIV Conference on Theoretical Nuclear Physics in Italy

    Science.gov (United States)

    Bombaci, I.; Covello, A.; Marcucci, L. E.; Rosati, S.

    2014-07-01

    This volume contains the invited and contributed papers presented at the 14th Conference on Theoretical Nuclear Physics in Italy held in Cortona, Italy, from 29-31 October, 2013. The meeting was held at the Palazzone, an elegant Renaissance Villa, commissioned by the Cardinal Silvio Passerini (1469-1529), Bishop of Cortona, and presently owned by the Scuola Normale Superiore di Pisa. The aim of this biennial Conference is to bring together Italian theorists working in various fields of nuclear physics to discuss their latest results and confront their points of view in a lively and informal way. This offers the opportunity to stimulate new ideas and promote collaborations between different research groups. The Conference was attended by 46 participants, coming from 13 Italian Universities and 11 Laboratories and Sezioni of the Istituto Nazionale di Fisica Nucleare - INFN. The program of the conference, prepared by the Organizing Committee (Ignazio Bombaci, Aldo Covello, Laura Elisa Marcucci and Sergio Rosati) focused on the following main topics: Few-Nucleon Systems Nuclear Structure Nuclear Matter and Nuclear Dynamics Relativistic Heavy Ion Collisions and Quark-Gluon Plasma Nuclear Astrophysics Nuclear Physics with Electroweak Probes Structure of Hadrons and Hadronic Matter. In the last session of the Conference there were two invited review talks related to experimental activities of great current interest. Giacomo De Angelis from the Laboratori Nazionali di Legnaro spoke about the INFN SPES radioactive ion beam project. Sara Pirrone, INFN Sezione di Catania, gave a talk on the symmetry energy and isospin physics with the CHIMERA detector. Finally, Mauro Taiuti (Università di Genova), National Coordinator of the INFN-CSN3 (Nuclear Physics Experiments), reported on the present status and future challenges of experimental nuclear physics in Italy. We gratefully acknowledge the financial support of INFN who helped make the conference possible. I Bombaci, A Covello

  10. Overcoming Endocrine Resistance by Targeting ER/FoxA1/IL-8 Axis

    Science.gov (United States)

    2015-10-01

    Creighton, Fugen Li, Martin Shea, Agostina Nardone, Tao Wang, Laura M. Heiser , Pavana Anur, Nicholas Wang, Catie Grasso, Paul Spellman, Carolina...Xiaoyong Fu, Rinath Jeselsohn, Resel Pereira, Emporia F. Hollingsworth, Chad J. Creighton, Fugen Li, Martin Shea, Agostina Nardone, Laura M. Heiser , Pavana...Rinath Jeselsohn, Emporia F. Hollingsworth, Dolores Lopez-Terrada, Chad J. Creighton, Agostina Nardone, Martin Shea, Laura M. Heiser , Pavana Anur

  11. Epimural Indicator Phylotypes of Transiently-Induced Subacute Ruminal Acidosis in Dairy Cattle

    OpenAIRE

    Wetzels, Stefanie U.; Mann, Evelyne; Metzler-Zebeli, Barbara U.; Pourazad, Poulad; Qumar, Muhammad; Klevenhusen, Fenja; Pinior, Beate; Wagner, Martin; Zebeli, Qendrim; Schmitz-Esser, Stephan

    2016-01-01

    The impact of a long-term subacute rumen acidosis (SARA) on the bovine epimural bacterial microbiome (BEBM) and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a 1-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA...

  12. Segnalazioni

    Directory of Open Access Journals (Sweden)

    Emanuele Monegato

    2014-11-01

    Full Text Available Antonietta Buonauro, Trauma, cinema e media. Immaginari catastrofici e cultura visuale del nuovo millennio, Roma, Bulzoni, 2014, 190 pp. ISBN 978-88-7870-921-8 Barbara Greco y Laura Pache Caballo, eds., Sobrenatural, fantástico y metarreal. La perspectiva de América Latina, Madrid, Biblioteca Nueva, 2014, 334 pp. ISBN 978-84-16095-64-3 Chiara Bolognese, Piste di un naufragio. Cartografia di Roberto Bolaño, Salerno, Arcoiris, 2014, 322 pp. ISBN 978-88-96583-59-3 Cinzia Scarpino, US Waste. Rifiuti e sprechi d’America. Una storia dal basso, Milano, Il Saggiatore, 2011, 325 pp. ISBN 9788865760871 Cinzia Schiavini, Sulle strade d’America. L’autobiografia di viaggio statunitense contemporanea, Milano, Shake, 2011, pp. 238, ISBN 978-88-97109-06-8 Gibson John, Fiction and the Weave of Life, Oxford & NY, OUP, 2007, 201 pp. ISBN 9780199299522 Gloria Staffieri, L’opera italiana. Dalle origini alle riforme del secolo dei Lumi (1590-1790, Roma, Carocci, 2014, 447 pp. ISBN 978-88-430-7108-1 Horacio Quiroga, I perseguitati, Salerno, Arcoiris, 2014, 64 pp. ISBN 978-88-96583-63-0 Lee Edelman, No Future: Queer Theory and the Death Drive, Durham, Duke University Press, 2004, 208 pp. ISBN 978-0822333692 Marco Canani and Sara Sullam, eds., Parallaxes. Virginia Woolf Meets James Joyce, Newcastle upon Tyne, Cambridge Scholars Publishing, 2014, 206 pp. ISBN 978-1-4438-5623-2 Miklos David, eds., Estática doméstica. Tres generaciones de cuentistas peruanos (1951-1981, México, UNAM, 2005, 353 pp. ISBN 970-32-2525-X Óscar de Borbolla, Le vocali maledette, Salerno, Arcoiris, 2014, 78 pp. ISBN 978-88-96583-43-2 Roald Dahl, The Hitch-Hiker, Impara l’inglese con Roald Dahl, note e glossario a cura di Marta Cai, Milano, Vallardi, 2014, 77 pp. ISBN 978-88-6731-451-5 Roberto Arlt, Un viaggio terribile, Salerno, Arcoiris, 2014, 95 pp. ISBN 978-88-96583-57-9 Ziauddin Sardar and Borin Van Loon, Introducing Cultural Studies, Cambridge, Icon Books, 1998, 175

  13. Brivaracetam: review of its pharmacology and potential use as adjunctive therapy in patients with partial onset seizures

    Directory of Open Access Journals (Sweden)

    Mumoli L

    2015-10-01

    Full Text Available Laura Mumoli,1 Caterina Palleria,2 Sara Gasparini,1 Rita Citraro,2 Angelo Labate,1 Edoardo Ferlazzo,1 Antonio Gambardella,1 Giovambattista De Sarro,2 Emilio Russo2 1Institute of Neurology, 2Institute of Pharmacology, University Magna Græcia, Catanzaro, Italy Abstract: Brivaracetam (BRV, a high-affinity synaptic vesicle protein 2A ligand, reported to be 10–30-fold more potent than levetiracetam (LEV, is highly effective in a wide range of experimental models of focal and generalized seizures. BRV and LEV similarly bind to synaptic vesicle protein 2A, while differentiating for other pharmacological effects; in fact, BRV does not inhibit high voltage Ca2+ channels and AMPA receptors as LEV. Furthermore, BRV apparently exhibits inhibitory activity on neuronal voltage-gated sodium channels playing a role as a partial antagonist. BRV is currently waiting for approval both in the United States and the European Union as adjunctive therapy for patients with partial seizures. In patients with photosensitive epilepsy, BRV showed a dose-dependent effect in suppressing or attenuating the photoparoxysmal response. In well-controlled trials conducted to date, adjunctive BRV demonstrated efficacy and good tolerability in patients with focal epilepsy. BRV has a linear pharmacokinetic profile. BRV is extensively metabolized and excreted by urine (only 8%–11% unchanged. The metabolites of BRV are inactive, and hydrolysis of the acetamide group is the mainly involved metabolic pathway; hepatic impairment probably requires dose adjustment. BRV does not seem to influence other antiepileptic drug plasma levels. Six clinical trials have so far been completed indicating that BRV is effective in controlling seizures when used at doses between 50 and 200 mg/d. The drug is generally well-tolerated with only mild-to-moderate side effects; this is confirmed by the low discontinuation rate observed in these clinical studies. The most common side effects are related to

  14. Profile of brivaracetam and its potential in the treatment of epilepsy

    Directory of Open Access Journals (Sweden)

    Ferlazzo E

    2015-11-01

    Full Text Available Edoardo Ferlazzo,1,2 Emilio Russo,3 Laura Mumoli,1 Chiara Sueri,2 Sara Gasparini,1,2 Caterina Palleria,3 Angelo Labate,1 Antonio Gambardella,1 Giovambattista De Sarro,3 Umberto Aguglia1,2 1Department of Medical and Surgical Sciences, Magna Græcia University, Catanzaro, 2Regional Epilepsy Centre, Bianchi-Melacrino-Morelli Hospital, Reggio Calabria, 3Institute of Pharmacology, Magna Græcia University, Catanzaro, Italy Abstract: Brivaracetam (BRV (UCB 34714 is currently under review by the US Food and Drug Administration and European Medicines Agency for approval as an add-on treatment for adult patients with partial seizures. Similar to levetiracetam (LEV, BRV acts as a high-affinity ligand of the synaptic vesicle protein 2A, however, it has been shown to be 10- to 30-fold more potent than LEV. Moreover, BRV does not share the LEV inhibitory activity on the high voltage Ca2+ channels and AMPA receptors, and it has been reported to act as a partial antagonist on neuronal voltage-gated sodium channels. The pharmacokinetic profile of BRV is favorable and linear, and it undergoes an extensive metabolism into inactive compounds, mainly through the hydrolysis of its acetamide group. Furthermore, it does not significantly interact with other antiepileptic drugs and more than 95% is excreted through the urine, with an unchanged fraction of 8%–11%. BRV has a half-life of approximately 8–9 hours and it is usually given twice daily. To date, a wide range of experimental studies have reported the effectiveness of BRV with regards to partial and generalized seizures. In humans, six randomized, placebo-controlled trials and two meta-analyses highlighted the efficacy, or good tolerability, of BRV as an add-on treatment for patients with uncontrolled partial seizures. A wide dose range of BRV has been evaluated in those trials (5–200 mg, but the most suitable for clinical use appears to be 50–100 mg/day. The most common adverse reactions to BRV are mild

  15. Välismaalaste seaduses sätestatud töö- ja ettevõtlusrände regulatsiooni väärkasutamine Eestis ja äriseadustiku muudatuste mõju töö- ja ettevõtlusrände regulatsiooni väärkasutamisele : [magistritöö] / Laura Sofia Annus ; Tartu Üliko

    Index Scriptorium Estoniae

    Annus, Laura Sofia

    2012-01-01

    Välismaalase mõistest ja tähtajalise elamisloa regulatsioonist, ettevõtte asutamise regulatsioonist, töö- ja ettevõtlusrände regulatsiooni mitte-eesmärgipärasest kasutamisest ja lahendustest selle peatamiseks

  16. FOUCAULT, Michel. A ordem do discurso: aula inaugural no Collège de France, pronunciada em 2 de dezembro de 1970. Tradução de Laura Fraga de Almeida Sampaio. São Paulo: Edições Loyola, 2012.

    Directory of Open Access Journals (Sweden)

    Ramon Taniguchi Piretti Brandão

    2016-03-01

    Full Text Available O presente livro é um fascículo onde Foucault adota um tom de conferência, relatando suas reflexões e pesquisas acerca das diversas abordagens possíveis do discurso e de como ele se dissemina em diferentes sociedades. O autor demonstra, dentre outras coisas, como o discurso exerce uma função de controle, de limitação e validação das regras de poder em diferentes períodos históricos e grupos sociais.

  17. Economic Analysis of National Nuclear Security Administration (NNSA) Modernization Alternatives

    Science.gov (United States)

    2007-11-01

    S. Helwig Rob Mahoney Joshua A. Minix David J. Nicholls Paul H. Richanbach Robert W. Thomas Laura M. Williams Approved for public release...Helwig Rob Mahoney Joshua A. Minix David J. Nicholls Paul H. Richanbach Robert W. Thomas Laura M. Williams iii PREFACE The Institute for Defense

  18. African Journal of AIDS Research - Vol 10, No 2 (2011)

    African Journals Online (AJOL)

    HIV/AIDS misconceptions may be associated with condom use among black South Africans: an exploratory analysis · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Laura M Bogart, Donald Skinner, Lance S Weinhardt, Laura Glasman, Cheryl Sitzler, Yoesrie Toefy, Seth C ...

  19. 'Film skal ses i biografen'

    DEFF Research Database (Denmark)

    svendsen, erik

    2010-01-01

    refleksioner over filmteoretiske tekster af Benjamin, John Ellis, , Todd McGowan, Barbara Klinger, Laura Mulvej og Slavoj Zizek Udgivelsesdato: 09-06-10......refleksioner over filmteoretiske tekster af Benjamin, John Ellis, , Todd McGowan, Barbara Klinger, Laura Mulvej og Slavoj Zizek Udgivelsesdato: 09-06-10...

  20. Leedu kunst on integratsioonivõimeline / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-

    2004-01-01

    Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones (Evaldas Jansas, Egle Rakauskaite) ja Rotermanni soolalaos (Loreta Bilinskaite-Burke, Laura Barbshtiene & Arturas Bumshteinas (G-Lab), Jonas Gasiunas, Arunas Gudaitis, Linas Jablonskis, Dainius Lishkevicius, Mindaugas Lukoshaitis, Gintaras Makarevicius, Deimantas Narkevicius, Egle Ridikaite, Irma Stanaityte, Laura Stasiulyte, Mindaugas Shimkus, Arturas Valiauga, Rimaldas Vikshraitis, Darius Zhiura). Kuraator Anders Kreuger leedu kunstniku kuvandiloomest

  1. PÖFFil esilinastub animafilm "Kärbeste veski" / Eva Samolberg

    Index Scriptorium Estoniae

    Samolberg, Eva

    2011-01-01

    PÖFFi raames toimuval 15. animafilmide festivalil Animated Dreams esilinastub Eesti Kunstiakadeemia animatsiooniosakonna magistrandi Anu-Laura Tuttelbergi lõputöö - animafilm "Kärbeste veski". Tallinna Ülikooli Akadeemilises raamatukogus on avatud Anu-Laura Tuttelbergi esilinastuva nukufilmi dekoratsioonide ja nukkude näitus

  2. 77 FR 20416 - Used Electronic Products: An Examination of U.S. Exports; Proposed Information Collection...

    Science.gov (United States)

    2012-04-04

    ...: Direct all written comments to Laura Bloodgood, Project Leader, U.S. International Trade Commission, 500... leader Laura Bloodgood ( [email protected] or 202-708-4726) or deputy project leader Andrea Boron..., volume, and value of, and foreign markets of significance for, exports of used electronic products from...

  3. Book Review: Commemoration as Conflict: Space, Memory and Identity in Peace Processes

    DEFF Research Database (Denmark)

    McQuaid, Sara Dybris

    2016-01-01

    Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7......Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7...

  4. Butanol/Gasoline Test Plan

    Science.gov (United States)

    2012-03-01

    authorities. METHODS FOR CLEANING UP: Contain spillage and then collect with non-combustible absorbent material, (e.g. sand, soil , diatomaceous earth...SARA 311/312 Hazards: Fire Hazard, Acute Health Hazard, and Chronic Health Hazard CERCLA SECTION 103 and SARA SECTION 304 (RELEASE TO THE ENVIROMENT

  5. En ny flugt ind i skoven

    DEFF Research Database (Denmark)

    Haarder, Jon Helt

    2008-01-01

    Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner......Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner...

  6. Journal of Food Technology in Africa - Vol 7, No 3 (2002)

    African Journals Online (AJOL)

    Identification of Lactic Acid Bacteria isolated from Opaque beer (Chibuku) for potential use as a starter culture. Chamunorwa A Togo, Sara B Sara B. Feresu, Anthony Mutukumira. http://dx.doi.org/10.4314/jfta.v7i3.19239 · Performance of different strains of Pleurotus species under Ghanaian conditions. K Vowotor, M Obodai.

  7. Use and Access of Grey Literature in Special Libraries may be Hindered by Lack of Visibility and Cataloguing. A review of: Ranger, Sara L. “Grey Literature in Special Libraries: Access in Use.” Publishing Research Quarterly 21.1 (Spring 2005: 53-63.

    Directory of Open Access Journals (Sweden)

    David Hook

    2006-03-01

    Full Text Available Objective – To examine the barriers to making grey literature (literature not controlled by commercial publishers easier to access in special libraries. Design – Interviews. Setting – Variety of special libraries (government, corporate and specialized academic in the United States. Subjects – Sixteen librarians from fourteen organizations in Washington, Michigan and Texas were interviewed. Four of the organizations were government libraries, four were corporate libraries and five were specialized academic libraries. One of the interviews was not used because the organization did not maintain a collection of paper‐based grey literature. Methods – Librarians were selected as possible interview subjects via three methods: some were previously familiar with the author; some were referred to the author by friends, family and colleagues; two candidates volunteered in response to a presentation of the project at a professional meeting. Interviews were conducted between February 2002 and May 2003. A standard set of seven questions were used, but often followed with further questions. The interviews were conducted either in the library or the librarian’s office. The interviews were tape‐recorded and the answers were written down. Interviews typically lasted between fifteen and thirty minutes and asked about the current state, holdings, access and use of grey literature in the special library. Main Results – Results from the interviews suggest a wide variance in the percentage of users that access grey literature. Grey literature was used less in the corporate libraries than the academic and government libraries. The percentage of the collection made up of grey literature also varied widely between the different libraries. Reports were found to be the most popular form of grey literature, although most of the libraries reported owning conference proceedings and newsletters in addition to reports. One interesting observation found during the interviews was that most of the users of grey literature are also producers of grey literature. The librarians surveyed reported that some of the reasons for using grey literature included use in research, to write (often more grey literature, interest in the topic, for class assignments, as records of previous practices, for localized studies, and for creating models and practices. Results found that for the libraries surveyed, much of the grey literature remains uncatalogued and what has been catalogued was done using a variety of methods. Over half of the libraries surveyed had their grey literature accessible online. Conclusion – Two main reasons were cited as explanations for why grey literature was not used as much as it should be: lack of cataloguing and visibility. In many of the libraries surveyed, much of the grey literature had not been catalogued, making it difficult to find and use the resources. Reasons cited for not cataloguing grey literature include lack of time, funds and/or knowledge. As well, in many of the libraries surveyed, it was found that the holdings of grey literature were not readily visible to the users, so users were not even aware that it existed. To improve the awareness and accessibility of grey literature, the author recommends regional depositories for grey literature, international standards for cataloguing and more cooperation between special libraries.

  8. Luiz Fernando Carvalho: An Auteur of Brazilian Television

    OpenAIRE

    CARTER, ELI LEE

    2013-01-01

    In this study I combine Pierre Bourdieu's theoretical model for cultural production with auteur theory in an analysis of the work of acclaimed film and television director Luiz Fernando Carvalho. Perhaps best-known in the U.S. for his brilliant feature Lavoura Arcaica (To the Left of the Father, 2001), based on the novel by Raduan Nassar, most of Carvalho's activity has been in television, where he has directed adaptations of works by Ariano Suassuna (A Pedra do Reino), E�a de Queiroz (Os M...

  9. REPRESENTASI ANTI DISKRIMINASI PADA FILM KARTUN 3D ZOOTOPIA (KAJIAN SEMIOTIKA ROLAND BARTHES

    Directory of Open Access Journals (Sweden)

    Ali Muqoddas

    2016-12-01

    Full Text Available Isu diskriminasi SARA seperti tiada habisnya terjadi di dunia ini, begitu juga di Indonesia. Hal ini mengakibatkan tema-tema tentang SARA menjadi sensitif ketika dibahas atau pun difilmkan. Hal ini mengakibatkan jarang ditemui film yang mengangkat tentang SARA. Lain halnya dengan Walt Disney. Walt Disney baru-baru ini merilis film kartun 3D yang mengangkat tema anti diskriminasi SARA yang berjudul Zootopia. Film ini menjadi menarik karena isu diskriminasi SARA yang diangkat dibalut dengan konsep yang kreatif hingga sensivitas isu SARA tersebut menjadi berkurang. Representasi anti diskriminasi SARA pada film Zootopia ini selanjutnya dikaji dengan metode semiotika Roland Barthes dengan pendekatan deskriptif kualitatif. Berdasarkan dari analisis, dapat disimpulkan bahwa film Zootopia memuat pesan ideologi tentang anti diskriminasi SARA bahwa kedudukan manusia dimata manusia yang lain pada hakikatnya adalah sama. Setiap manusia berhak dan wajib memperlakukan dan diperlakukan secara bijak tanpa memperdulikan background asal manusia itu sendiri. Penghargaan pada setiap individu tidak didasarkan pada faktor keturunan, ras, suku ataupun agama, namun didasarkan pada prestasi dari individu itu sendiri. Kata Kunci: diskriminasi SARA, Zootopia, Roland Barthes Abstract The issue of racial discrimination as an endless happen in this world, so also in Indonesia. This resulted in the themes of SARA be sensitive when discussed or filmed. This resulted in a rare film that raised about SARA. Another case with Walt Disney. Walt Disney recently released 3D animated film that mengangat theme of anti-discrimination SARA entitled Zootopia. This film is interesting because racial discrimination issues raised wrapped with a creative concept to the sensitivity of the racial issues be reduced. SARA anti-discrimination representation on film Zootopia is further studied with Roland Barthes semiotic methods with qualitative descriptive approach. Based on the analysis, it can

  10. The use of sodic monensin and probiotics for controlling subacute ruminal acidosis in sheep

    Directory of Open Access Journals (Sweden)

    Elizabeth Schwegler

    2015-02-01

    Full Text Available The aim of this work was to validate a protocol for induction of subacute ruminal acidosis (SARA (Experiment 1 and test the efficiency of probiotic Saccharomyces cerevisiae or monensin to avoid pH ruminal drops in sheep (Experiment 2. In Experiment 1, six ewes were fasted for two days and then fed most with concentrate during four days. Ewes in this protocol had ruminal fluid pH below 6.0 and kept it for 75 consecutive hours. In Experiment 2, 18 sheep were distributed into three groups: Control (CG, n = 6, monensin (MG, n = 6 and probiotic group (PG, n = 6. SARA was induced according Experiment 1. PG had lower pH (5.7 ± 0.1 than CG (6.0 ± 0.1 (P = 0.05, while MG (5.7 ± 0.1 was similar to both during SARA induction. SARA induction reduced ruminal protozoa population (P < 0.05 and increased chloride concentrations in ruminal fluid (P < 0.01. In serum, SARA increased concentrations of phosphorus (P < 0.01, AST (P < 0.01 and GGT (P < 0.01, but reduced LDH (P < 0.01. In conclusion, the protocol used for SARA induction was able to maintain ruminal pH between 5.5-6.0 for more than 48 hours. However, monensin and probiotics supplementation was not effective in preventing changes in ruminal and serum parameters during SARA.

  11. Alteration in Fecal Microbiota Associated with Grain-induced Subacute Ruminal Acidosis Challenge in Dairy Cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    in the field are often not detected. Thus, other and better markers of SARA are needed. The purpose of this research was to study the feces microbiome during SARA and assess the possibilities of using feces microbial markers as indicators of SARA. Methods: Six lactating, rumen cannulated, Danish Holstein cows...... were used in a blocked design study including two blocks. In the first block, two cows received control diet and two cows received SARA-challenge diet. In the second block, former control cows received SARA diet while two new cows received control diet. Cows received a total mixed ration (TMR; 24......% concentrate) for four weeks before the trial. SARA was induced by gradual substitution of 40% of TMR with grain pellets (50:50 wheat:barley) over 3 days. Full SARA diet was fed for four days. Rumen pH was measured continuously by indwelling probes (eCow). Feces samples were taken at 9 am and 9 pm on last day...

  12. Epimural indicator phylotypes of transiently-induced subacute ruminal acidosis in dairy cattle

    Directory of Open Access Journals (Sweden)

    Stefanie Urimare Wetzels

    2016-03-01

    Full Text Available The impact of a long-term subacute rumen acidosis (SARA on the bovine epimural bacterial microbiome (BEBM and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a one-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA isolation (4 sampling time points per cow: at the baseline before concentrate was fed, after the first SARA challenge, after the challenge break, and after the second SARA challenge. Ruminal pH was continuously monitored. The microbiome was determined using Illumina MiSeq sequencing of the 16S rRNA gene (V345 region. In total 1,215,618 sequences were obtained and clustered into 6,833 operational taxonomic units (OTUs. Campylobacter and Kingella were the most abundant OTUs (16.5% and 7.1%. According to ruminal pH dynamics, the second challenge was more severe than the first challenge. Species diversity estimates and evenness increased during the challenge break compared to all other sampling time points (P<0.05. During both SARA challenges, Kingella- and Azoarcus-OTUs decreased (0.5 and 0.4 fold-change and a dominant Ruminobacter-OTU increased during the challenge break (18.9 fold-change; P<0.05. qPCR confirmed SARA-related shifts. During the challenge break noticeably more OTUs increased compared to other sampling time points. Our results show that the BEBM re-establishes the baseline conditions slower after a SARA challenge than ruminal pH. Key phylotypes that were reduced during both challenges may help to establish a bacterial fingerprint to facilitate understanding effects of SARA conditions on the BEBM and their consequences for the ruminant host.

  13. Epimural Indicator Phylotypes of Transiently-Induced Subacute Ruminal Acidosis in Dairy Cattle.

    Science.gov (United States)

    Wetzels, Stefanie U; Mann, Evelyne; Metzler-Zebeli, Barbara U; Pourazad, Poulad; Qumar, Muhammad; Klevenhusen, Fenja; Pinior, Beate; Wagner, Martin; Zebeli, Qendrim; Schmitz-Esser, Stephan

    2016-01-01

    The impact of a long-term subacute rumen acidosis (SARA) on the bovine epimural bacterial microbiome (BEBM) and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a 1-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA isolation (4 sampling time points per cow: at the baseline before concentrate was fed, after the first SARA challenge, after the challenge break, and after the second SARA challenge). Ruminal pH was continuously monitored. The microbiome was determined using Illumina MiSeq sequencing of the 16S rRNA gene (V345 region). In total 1,215,618 sequences were obtained and clustered into 6833 operational taxonomic units (OTUs). Campylobacter and Kingella were the most abundant OTUs (16.5 and 7.1%). According to ruminal pH dynamics, the second challenge was more severe than the first challenge. Species diversity estimates and evenness increased during the challenge break compared to all other sampling time points (P < 0.05). During both SARA challenges, Kingella- and Azoarcus-OTUs decreased (0.5 and 0.4 fold-change) and a dominant Ruminobacter-OTU increased during the challenge break (18.9 fold-change; P < 0.05). qPCR confirmed SARA-related shifts. During the challenge break noticeably more OTUs increased compared to other sampling time points. Our results show that the BEBM re-establishes the baseline conditions slower after a SARA challenge than ruminal pH. Key phylotypes that were reduced during both challenges may help to establish a bacterial fingerprint to facilitate understanding effects of SARA conditions on the BEBM and their consequences for the ruminant host.

  14. Computer‐Assisted Library Instruction and Face‐to‐Face Library Instruction Prove Equally Effective for Teaching Basic Library Skills in Academic Libraries. A review of: Zhang, Li, Watson, Erin M. and Banfield, Laura. ʺThe Efficacy of Computer‐Assisted Instruction Versus Face‐to‐Face Instruction in Academic Libraries: A Systematic Review.ʺ The Journal of Academic Librarianship 33.4 (July 2007: 478‐484.

    Directory of Open Access Journals (Sweden)

    Stephanie Walker

    2008-03-01

    Full Text Available Objective – To conduct a systematic review of several studies comparing the efficacy of face‐to‐face versus computer‐assisted instruction (CAI for teaching basic library skills to patrons of academic libraries. Design – Systematic review of existing studies (randomised controlled trials and controlled trials.Setting ‐ College and university librariesSubjects – The subjects studied were patrons of any type of academic library, whether university, college, or other postsecondary institution, receiving instruction in basic library skills. Ten studies were included in the review, of which seven were done in the United States, two in Australia, and one in Canada. The total number of subjects in all of the studies under review was 1283. Nine of the studies focused on undergraduates enrolled in specific courses(undergraduate courses ranging widely in subject area, or in one case a first year experience program; the other study focused on library instruction methods taught to students in a graduate research methods course, yet the study was still intended to measure the efficacy of library instruction methods, yet the study was still intended to measure the efficacy of library instruction methods.Methods – One included study was a randomised controlled trial; the other nine were controlled trials. The date range under consideration was for studies done between 1990 and 2005. All original studies were required to compare the efficacy of face-to-face versus CAI instruction. Both information skills and students’ reactions to receiving the instruction were considered. To identify appropriate studies, searches were done across the following library and education‐related databases: LISA, ERIC, and Library Literature. The authors screened the 728 unique studies’ bibliographic information for relevance against four criteria: studies had to be of a particular type of design (randomised controlled trials,controlled trials, cohort studies, and case studies, with a sample size greater than one and with pre‐ and post‐test measurements;study participants had to be academic library patrons; the study needed to compare CAI and face‐to‐face instruction; and both the students’ information skills and reactions to the instruction had to be measured. This left 40 unique studies, which were then retrieved in full text. Next, studies were selected to meet the inclusion criteria further using the QUOROM format, a reporting structure used for improving the quality of reports of meta‐analyses of randomised trials (Moher et al 1896‐1900. Evaluation of methodological quality was then done using a dual method: authors Watson and Zhang assessed the studies independently, each using the “Checklist for Study Quality” developed by Downs and Black (Downs and Black 377‐384, adapted slightly to remove non‐relevant questions. After analysis, when additional information was needed, original study authors werecontacted. Finally, ten studies were included in the analysis.The instruction sessions covered many topics, such as catalog use, reading citations, awareness of library services and collections, basic searching of bibliographic databases, and more. But all could qualify as basic, rather than advanced, library instruction. All studies did pre‐ and posttests of students’ skills – some immediatelyafter instruction, and others with a time lapse of up to six weeks. Most authors created their own tests, though one adapted an existing scale. Individual performance improvement was not studied in many cases due to privacy concerns.Main Results ‐ Nine of the ten studies found CAI and face‐to‐face instruction equally effective; the tenth study found face to‐face instruction more effective. The students’ reaction to instruction methods varied – some students felt more satisfied with face‐to‐face instruction and felt that they learned better, while other studies found that students receiving CAI felt more confident. Some found no difference in confidence. It was impossible to carry out a metaanalysis of the studies, as the skills taught, methods used, and evaluation tools in each case varied widely, and the data provided by the ten studies lacked sufficient detail to allow meta‐analysis. As well, there were major methodological differences in the studies – some studies allowed participants the opportunities for hands‐on practice; others did not. The CAI tutorials also varied– some were clearly interactive, and in other studies, it was not certain that the tutorial allowed for interactivity. The authors of the systematic review identified possible problems with the selected studies as well. All studies were evaluated according to four criteria on the modified Downs‐Black scale: reporting, external validity, and two measures of internal validity (possible bias and possible confounding. A perfect score would have been 25; the mean score was 17.3. Areas where authors lost points included areas such as failure to estimate data variability, failure to report participants lost to followup, failure to have blind marking of pre and post‐tests, failure to allocate participants randomly, and a variety of other areas. As well, few studies examined participants’ confidence level with computers before they participated in instruction.Conclusion – Based on this systematic review, CAI and face‐to‐face instruction appear to be equally effective in teaching students basic library skills. The authors of the study are reluctant to state this categorically, and issue several caveats: aonly one trial was randomised; b seven of the studies were conducted in the USA, with the others being from Canada and Australia, and learning and teaching styles could be very different in other countries; c the students were largely undergraduates, and the authors are curious as to whether results would be similar with faculty, staff, or older groups (though of course, not all undergraduates are traditional undergraduates; d the tests ranged widely in design, and were largely developed individually, and the authors recommend developing a validated test; and e if the pre‐ and post‐tests are identical and given in rapid succession, this could skew results.

  15. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... Laura Butler of Parkersburg, W.Va., had "extreme pain in both eyes," she said. "Because I had ... with a corneal abrasion. "I was in severe pain and on medication for four weeks, and couldn' ...

  16. Notes on Paul Kuimet / Pille Epner

    Index Scriptorium Estoniae

    Epner, Pille

    2011-01-01

    Fotograaf Paul Kuimetist, tema loomingust, Tallinnas Hobusepea galeriis toimunud isikunäitusest "In Vicinity" (2010), mis uuris valglinnastumist, kohaspetsiifilisest installatsioonist "Untitled" (2010) ja näitusest "Not Necessarily So" (koos Laura Tootsiga, 2010) Linzis

  17. Veterinary and human medicine: learning from each other.

    Science.gov (United States)

    Honey, Laura

    2016-03-26

    A well-attended session at this year's joint SPVS/VPMA congress considered what lessons the medical and veterinary professions might learn from one another. Laura Honey reports. British Veterinary Association.

  18. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical Therapy-Lokomat T. George Hornby, PhD, PT Empowering ... Rogers, SW Marguerite David, MSW Kathy Hulse, MSW Physical Therapy after Spinal Cord Injury Laura Wehrli, PT ...

  19. Preventing Pressure Sores

    Medline Plus

    Full Text Available ... Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical Therapy-Lokomat T. George Hornby, PhD, PT Empowering ... Rogers, SW Marguerite David, MSW Kathy Hulse, MSW Physical Therapy after Spinal Cord Injury Laura Wehrli, PT ...

  20. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical Therapy-Lokomat T. George Hornby, PhD, PT Empowering ... Rogers, SW Marguerite David, MSW Kathy Hulse, MSW Physical Therapy after Spinal Cord Injury Laura Wehrli, PT ...

  1. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical Therapy-Lokomat T. George Hornby, PhD, PT Empowering ... Rogers, SW Marguerite David, MSW Kathy Hulse, MSW Physical Therapy after Spinal Cord Injury Laura Wehrli, PT ...

  2. Smart power flows at the island edge

    DEFF Research Database (Denmark)

    Watts, Laura

    2016-01-01

    Ethnographer of Futures and Associate Professor at IT University of Copenhagen, Laura Watts, talks about her response to the UK National Infrastructure Commission’s vision for the future of the electricity grid in her guest blog....

  3. Ernesto Preatoni soovis end 100 miljoni eest vabaks osta / Risto Berendson

    Index Scriptorium Estoniae

    Berendson, Risto, 1975-

    2004-01-01

    Prokurör Laura Vaik põhjendab, miks ta loobus tema enda ja Itaalia ärimehe Ernesto Preatoni advokaatide vahel sõlmitud esialgsest kokkuleppest, mille kohaselt oleks Preatoni maksnud riigile kokku 100 mln krooni

  4. HPV Prevention (A Cup of Health with CDC)

    Centers for Disease Control (CDC) Podcasts

    Human papillomavirus, or HPV, is a virus that can cause certain cancers and is the most commonly sexually transmitted infection in the U.S. In this podcast, Dr. Laura Viens discusses the importance of getting vaccinated against HPV.

  5. Aneta Fraczek-Szczypta

    Indian Academy of Sciences (India)

    Polysulphone composite membranes modified with two types of carbon additives as a potential material for bone tissue regeneration · ALICJA WEDEL-GRZENDA ANETA FRACZEK-SZCZYPTA MAURICIO TERRONES ANA LAURA ELÍAS MALGORZATA LEKKA ELZBIETA MENASZEK STANISLAW BLAZEWICZ.

  6. Iga maastik on hingeseisund = Every landscape is a condition of the spirit / Piret Karro

    Index Scriptorium Estoniae

    Karro, Piret, 1991-

    2016-01-01

    Laura Põllu isiknäitus "Sada ulma keset merd" Tartu Kunstimuuseumis (Tartmusis). Ruumiinstallatsioonis on kombineeritud maali-, video-, skulptuuri- ja tekstilahendusi. Helikujunduse autor on Juhan Vihterpal, kuraator Peeter Talvistu

  7. Entre el activismo y la intervención: El trabajo de organizaciones de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-05-31

    May 31, 2017 ... This book brings together the experiences and lessons learned from five civil ... Laura Georgina Freyermuth Joffre graduated in political science from the Universidad Nacional Autónoma de México. ... Project description ...

  8. Südames on armastuse kodu / Lembit Peterson, Marius Peterson

    Index Scriptorium Estoniae

    Peterson, Lembit, 1953-

    2006-01-01

    Theatrumis tuleb lavale Karol Wojtyla (Paavst Johannes Paulus II) kirjutatud näidend "Juveliiri poe ees". Lavastuses osaleb pea kogu perekond Petersonid. Laura, Marius, Mare, Maria ja Lembit Peterson endast ja peresidemetest

  9. 14. X avati graafikatriennaali noortenäituse [tingimisi olemas][tingimisi olematu] neljas ehk viimane alanäitus Viljandis Kilpkonna galeriis

    Index Scriptorium Estoniae

    2001-01-01

    Kuraator Rael Artel. Väljas on Laura Kallasvee "I love labels", Maiu Kurvitsa kontseptuaalne projekt "Odav jutt", Peeter Lauritsa "Paabeli torn" (1991), tundmatu kunstniku tekstiilist käsitöötoode.

  10. PENi kirjandusauhinnad selgunud : [sõnum

    Index Scriptorium Estoniae

    2002-01-01

    Nabokovi-preemia Mario Vargas Llosale; Laura Pelsi auhind Tony Kushnerile ja Maria Irene Fornesile; uudsena noortele kirjanike määratava Robert Binghami auhinna saavad Carolyn Cooke, Matthew Klam ja Manil Suri

  11. SHORTER MENSTRUAL CYCLES ASSOCIATED WITH CHLORINATION BY-PRODUCTS IN DRINKING WATER

    Science.gov (United States)

    Shorter Menstrual Cycles Associated with Chlorination by-Products in Drinking Water. Gayle Windham, Kirsten Waller, Meredith Anderson, Laura Fenster, Pauline Mendola, Shanna Swan. California Department of Health Services.In previous studies of tap water consumption we...

  12. 75 FR 48880 - Approval and Promulgation of Gila River Indian Community's Tribal Implementation Plan

    Science.gov (United States)

    2010-08-12

    ... in August 1995 by then-Governor Mary Thomas. Beginning in 1998, the GRIC DEQ, with assistance from.... See Letter dated June 22, 2009, from Margaret Cook, Executive Director, GRIC DEQ, to Laura Yoshii...

  13. Charting Transnational Native American Studies

    Directory of Open Access Journals (Sweden)

    Hsinya Huang

    2012-06-01

    Full Text Available Introduction to the Special Forum entitled "Charting Transnational Native American Studies: Aesthetics, Politics, Identity," edited by Hsinya Huang, Philip J. Deloria, Laura M. Furlan, and John Gamber

  14. Tartust pärit eurolauljate võiduvõimalused vähenesid / Karin Palo

    Index Scriptorium Estoniae

    Palo, Karin

    2005-01-01

    Tänavusest Eesti Eurovisiooni finaalist, lauljast Laura Põldverest lauludega "Moonwalk ja "Let's Get Loud" (viimane ansambli Suntribe koosseisus)" ja Julia Bomani esitatud laulu "Nevermore Island" väljajätmisest finaalvõistlusest

  15. Kurjade bakterite kõrvalmõju / Villu Zirnask

    Index Scriptorium Estoniae

    Zirnask, Villu, 1966-

    2012-01-01

    Alessandra Fogli Minnesota ülikoolist ning Laura Veldkamp Sterni ärikoolist kirjeldasid oma uuringus "Germs, social networks and growth" inimkontakti kaudu levivate haiguste esinemissageduse abil ühiskonna sotsiaalset struktuuri ning selle seost tehnoloogiate levimisega

  16. Literary text across cultures: Russian and English translations of L. Esquivel's «Como agua para chocolate»

    Directory of Open Access Journals (Sweden)

    О С Чеснокова

    2008-03-01

    Full Text Available The article focuses on the comparison of the translations of the novel «Como agua para chocolate» (1989 by Laura Esquivel into Russian and English and their semiotic manifestations.

  17. The Rethorics of Gaze in Luhrmann's "Postmodern Great Gatsby"

    Directory of Open Access Journals (Sweden)

    Paola Fallerini

    2014-05-01

    Adopting the perspective suggested by the rhetoric of the gaze (Laura Mulvey it is highlighted the metalinguistic and metatextual reflection through which this movie contributes to the critical interpretation of Fitzgerald’s novel.

  18. 76 FR 37194 - Surety Companies Acceptable In Federal Bonds; Termination; Clearwater Insurance Company

    Science.gov (United States)

    2011-06-24

    ... to the U.S. Department of the Treasury, Financial Management Service, Financial Accounting and...: June 16, 2011. Laura Carrico, Director, Financial Accounting and Services Division, Financial...; Termination; Clearwater Insurance Company AGENCY: Financial Management Service, Fiscal Service, Department of...

  19. 76 FR 37891 - Surety Companies Acceptable on Federal Bonds; Termination; Western Insurance Company

    Science.gov (United States)

    2011-06-28

    ... the U.S. Department of the Treasury, Financial Management Service, Financial Accounting and Services.... Laura Carrico, Director, Financial Accounting and Services Division, Financial Management Service. [FR...; Termination; Western Insurance Company AGENCY: Financial Management Service, Fiscal Service, Department of the...

  20. 77 FR 553 - Surety Companies Acceptable on Federal Bonds: Termination; Western Bonding Company

    Science.gov (United States)

    2012-01-05

    .... Department of the Treasury, Financial Management Service, Financial Accounting and Services Division, Surety..., 2011. Laura Carrico, Director, Financial Accounting and Services Division, Financial Management Service...: Termination; Western Bonding Company AGENCY: Financial Management Service, Fiscal Service, Department of the...

  1. Noortenäidend kulgeb teismeliste tempos / Sandra Sillaots

    Index Scriptorium Estoniae

    Sillaots, Sandra

    2009-01-01

    Pärnu Endla teatris etendunud lavastusest "Oma elu superstaarid". Autorid Triinu ja Laura-Marie Ojalo, lavastaja Enn Keerd, kunstnik Tuulikki Ojalo. Ka peategelase Eliis Vaiksaare (Lenna) osatäitmisest

  2. Fermi and the Art of Estimation

    Indian Academy of Sciences (India)

    IAS Admin

    The balance wheel will now shed some ... work best when used by someone with the ... [1] Laura Fermi, Atoms in the Family: My Life with Enrico Fermi, The. University of Chicago ... Geneva, European Organization for Nuclear Research, 1969.

  3. Translational selection in human: More pronounced in housekeeping genes

    KAUST Repository

    Ma, Lina; Cui, Peng; Zhu, Jiang; Zhang, Zhihua; Zhang, Zhang

    2014-01-01

    by Yuan Yuan, Baylor College of Medicine; Han Liang, University of Texas MD Anderson Cancer Center (nominated by Dr Laura Landweber) Eugene Koonin, NCBI, NLM, NIH, United States of America Sandor Pongor, International Centre for Genetic Engineering

  4. Reaktsioon / Rait Avestik

    Index Scriptorium Estoniae

    Avestik, Rait, 1974-

    2007-01-01

    Vastukaja "Eesti Ekspressi" kultuurilisas "Areen" ilmunud Liina Jürgeni kirjutisele, kus autor veebipäeviku vormis kajastas Vanemuises etendunud ameerika kirjaniku Laura Cunninghami tragikomöödiat "Beautiful Bodies", lavastaja Jüri Lumiste

  5. Meie igapäevane paanika / Ott Karulin

    Index Scriptorium Estoniae

    Karulin, Ott, 1980-

    2007-01-01

    Kahest Vanemuise teatri lavastusest Tartus - Saksa Kultuuri Instituudis etendunud Ingvar Ambjornseni-Axel Hellsteniuse "Elling" Ain Mäeotsa lavastuses ja Laura Cunninghami "Beautiful Bodies" Vanemuises, lavastaja Jüri Lumiste

  6. Determination of chilling temperature effects on nutrient elements ...

    African Journals Online (AJOL)

    PRECIOUS

    2009-12-01

    Dec 1, 2009 ... (Brassica oleracea L. Cv. Acephala) using the WDXRF spectroscopic ... considerably yield reductions in the cultivation areas at higher latitudes (Laura et al., ..... help us change usual plant fertilization regimes resis- tance of ...

  7. Ettepanek rollide ümbermõtestamiseks = Proposal for a rethinking of the roles / Jan Kaila, Japo Knuutila, Aliina Astrova

    Index Scriptorium Estoniae

    Kaila, Jan

    2013-01-01

    Paul Kuimeti ja Mika Rikala ühisnäitusest "Clouds and Waves" Hobusepea galeriis. Aliina Astrova kuraatoriettekanne Paul Kuimeti ja Laura Tootsi ühisnäitusel "Not Necessarily So" Temnikova & Kasela galeriis

  8. Living with Crohn's Disease | NIH MedlinePlus the Magazine

    Science.gov (United States)

    ... courtesy of Laura King Benjamin King, star of Disney Channel's hit TV series Liv and Maddie , helps ... root in so many homes that watch the Disney Channel and have children—especially considering the number ...

  9. Dragotsennaja osen / Tatjana Barmakova

    Index Scriptorium Estoniae

    Barmakova, Tatjana

    2004-01-01

    Moefirmade Dior, Yves Saint Laurent (jumestuskunstnik Linda Cantello), Guerlain (kunstnik Olivier Echaudemaison), Shiseido (kunstnik Tom Pecheux) meigikollektsioonidest. Diori, Kenzo ja Thierry Mugleri uutest parfüümidest. "Kenzoairi" parfüümipudeli disainis klaasikunstnik Laura de Santillana

  10. Comentario bibliográfico de La revisión judicial de las políticas sociales. Estudio de Caso

    Directory of Open Access Journals (Sweden)

    Bulit Goñi, Magdalena

    2011-12-01

    Full Text Available Comentario bibliográfico de ABRAMOVICH, Víctor y PAUTASSI, Laura (comp.: La revisión judicial de las políticas sociales. Estudio de casos, Editores del Puerto, Buenos Aires, 2009.

  11. Combining pain therapy with lifestyle: the role of personalized nutrition and nutritional supplements according to the SIMPAR Feed Your Destiny approach

    Directory of Open Access Journals (Sweden)

    De Gregori M

    2016-12-01

    Full Text Available Manuela De Gregori,1–3 Carolina Muscoli,2,4,5 Michael E Schatman,2,6 Tiziana Stallone,2,7 Fabio Intelligente,2,8 Mariangela Rondanelli,2,9 Francesco Franceschi,2,10 Laura Isabel Arranz,2,11 Silvia Lorente-Cebrián,2,12 Maurizio Salamone,2,13,14 Sara Ilari,2,5 Inna Belfer,2,15 Massimo Allegri2,16,17 1Pain Therapy Service, Fondazione IRCCS Policlinico San Matteo, Pavia, Italy; 2Study in Multidisciplinary Pain Research Group, 3Young Against Pain Group, Parma, Italy; 4Department of Health Sciences, Institute of Research for Food Safety and Health, University “Magna Graecia” of Catanzaro, Parma, Italy; 5IRCCS San Raffaele Pisana, Roccelletta di Borgia, Catanzaro, Italy; 6US Pain Foundation, Bellevue, WA, USA; 7ENPAB, Rome, 8Chronic Pain Service Anestesia Day-Surgery, IRCCS Humanitas Research Hospital, Rozzano, 9Department of Public Health, Section of Human Nutrition and Dietetics, Azienda di Servizi alla Persona di Pavia, University of Pavia, Pavia, 10Institute of Internal Medicine, Catholic University of Rome, Rome, Italy; 11Department of Nutrition, Food Sciences and Gastronomy, University of Barcelona, Barcelona, 12Department of Nutrition, Food Science and Physiology, Center for Nutrition Research, University of Navarra, Pamplona, Spain; 13Metagenics Italia srl, Milano, 14Italian Lifestyle Medicine Association, Bari, Italy; 15Faculty of Dentistry, McGill University, Montreal, QC, Canada; 16Department of Surgical Sciences, University of Parma, 17Anesthesia, Intensive Care and Pain Therapy Service, Azienda Ospedaliero, Universitaria of Parma, Parma, Italy Abstract: Recently, attention to the lifestyle of patients has been rapidly increasing in the field of pain therapy, particularly with regard to the role of nutrition in pain development and its management. In this review, we summarize the latest findings on the role of nutrition and nutraceuticals, microbiome, obesity, soy, omega-3 fatty acids, and curcumin supplementation as key elements in

  12. Overall survival and disease-free survival in endometrial cancer: prognostic factors in 276 patients

    Directory of Open Access Journals (Sweden)

    Tejerizo-García A

    2013-09-01

    Full Text Available Álvaro Tejerizo-García,1 Jesús S Jiménez-López,1 José L Muñoz-González,1 Sara Bartolomé-Sotillos,1 Laura Marqueta-Marqués,1 Gregorio López-González,1 José F Pérez-Regadera Gómez21Service of Obstetrics and Gynecology, 2Radiation Oncology Service, Hospital Universitario 12 de Octubre, Madrid, SpainObjective: The aim of the study reported here was to assess the disease-free survival and overall survival of patients with endometrial cancer and to determine independent factors affecting the prognosis.Materials and methods: This was a retrospective study of a single-center clinical series of 276 patients (mean age 64 years with histologically confirmed cancer of the corpus uteri. The standard treatments were extrafascial total hysterectomy and bilateral salpingo-oophorectomy with selective pelvic/para-aortic node dissection, according to risk for recurrence. Actuarial overall survival and disease-free survival were estimated according to the Kaplan–Meier method. Univariate and multivariate Cox proportional hazards analyses were used to assess the prognostic significance of the different variables.Results: The estimated median follow-up, determined using the inverse Kaplan–Meier method, was 45 months (95% confidence interval [CI] 41.2–48.8 for disease-free survival and 46 months (95% CI 43.0–49.0 for overall survival. The statistically significant variables affecting disease-free survival and overall survival were age, serous-papillary and clear-cell histological types, outer-half myometrial invasion, advanced International Federation of Gynecology and Obstetrics (FIGO stage, tumor grades G2 and G3, incomplete surgical resection, positive lymph nodes, lymphovascular space invasion, tumor remnants of >1 cm after surgery, and high-risk group. In the multivariate Cox regression model, predictors of tumor recurrence included advanced FIGO stage (hazard ratio [HR] 4.90, 95% CI 2.57–9.36, P < 0.001 and tumor grades G2 (HR 4.79, 95

  13. Identifying Objective Physiological Markers and Modifiable Behaviors for Self-Reported Stress and Mental Health Status Using Wearable Sensors and Mobile Phones: Observational Study.

    Science.gov (United States)

    Sano, Akane; Taylor, Sara; McHill, Andrew W; Phillips, Andrew Jk; Barger, Laura K; Klerman, Elizabeth; Picard, Rosalind

    2018-06-08

    these measures. We identified the physiological sensor, phone, mobility, and modifiable behavior features that were best predictors for stress and mental health classification. In general, wearable sensor features showed better classification performance than mobile phone or modifiable behavior features. Wearable sensor features, including skin conductance and temperature, reached 78.3% (148/189) accuracy for classifying students into high or low stress groups and 87% (41/47) accuracy for classifying high or low mental health groups. Modifiable behavior features, including number of naps, studying duration, calls, mobility patterns, and phone-screen-on time, reached 73.5% (139/189) accuracy for stress classification and 79% (37/47) accuracy for mental health classification. New semiautomated tools improved the efficiency of long-term ambulatory data collection from wearable and mobile devices. Applying machine learning to the resulting data revealed a set of both objective features and modifiable behavioral features that could classify self-reported high or low stress and mental health groups in a college student population better than previous studies and showed new insights into digital phenotyping. ©Akane Sano, Sara Taylor, Andrew W McHill, Andrew JK Phillips, Laura K Barger, Elizabeth Klerman, Rosalind Picard. Originally published in the Journal of Medical Internet Research (http://www.jmir.org), 08.06.2018.

  14. Factors that lessen the burden of treatment in complex patients with chronic conditions: a qualitative study

    Directory of Open Access Journals (Sweden)

    Ridgeway JL

    2014-03-01

    Full Text Available Jennifer L Ridgeway,1,2 Jason S Egginton,1,2 Kristina Tiedje,3 Mark Linzer,4,5 Deborah Boehm,4 Sara Poplau,6 Djenane Ramalho de Oliveira,7 Laura Odell,8 Victor M Montori,2,9 David T Eton1,2 1The Mayo Clinic Robert D. and Patricia E. Kern Center for the Science of Health Care Delivery, 2Division of Health Care Policy and Research, Department of Health Sciences Research, Mayo Clinic, Rochester, MN, USA; 3Department of Anthropology, Université Lumière Lyon 2, Lyon, France; 4Division of General Internal Medicine, Hennepin County Medical Center, 5University of Minnesota Medical School, 6Minneapolis Medical Research Foundation, Minneapolis, MN, USA; 7Department of Social Pharmacy, Universidade Federal de Minas Gerais, Brazil; 8Pharmacy Services, 9Knowledge and Evaluation Research Unit, Mayo Clinic, Rochester, MN, USA Purpose: Patients with multiple chronic conditions (multimorbidity often require ongoing treatment and complex self-care. This workload and its impact on patient functioning and well-being are, together, known as treatment burden. This study reports on factors that patients with multimorbidity draw on to lessen perceptions of treatment burden. Patients and methods: Interviews (n=50 and focus groups (n=4 groups, five to eight participants per group were conducted with patients receiving care in a large academic medical center or an urban safety-net hospital. Interview data were analyzed using qualitative framework analysis methods, and themes and subthemes were used to identify factors that mitigate burden. Focus groups were held to confirm these findings and clarify any new issues. This study was part of a larger program to develop a patient-reported measure of treatment burden. Results: Five major themes emerged from the interview data. These included: 1 problem-focused strategies, like routinizing self-care, enlisting support of others, planning for the future, and using technology; 2 emotion-focused coping strategies, like

  15. Finalizing a measurement framework for the burden of treatment in complex patients with chronic conditions

    Directory of Open Access Journals (Sweden)

    Eton DT

    2015-03-01

    Full Text Available David T Eton,1,2 Jennifer L Ridgeway,1,2 Jason S Egginton,1,2 Kristina Tiedje,3 Mark Linzer,4,5 Deborah H Boehm,4 Sara Poplau,6 Djenane Ramalho de Oliveira,7 Laura Odell,8 Victor M Montori,1,9 Carl R May,10 Roger T Anderson11 1Division of Health Care Policy and Research, Department of Health Sciences Research, Mayo Clinic, Rochester, MN, USA; 2Robert D and Patricia E Kern Center for the Science of Health Care Delivery, Mayo Clinic, Rochester, MN, USA; 3Department of Sociology and Anthropology, Université Lumière Lyon 2, Lyon, France; 4Division of General Internal Medicine, Hennepin County Medical Center, Minneapolis, MN, USA; 5University of Minnesota Medical School, University of Minnesota, Minneapolis, MN, USA; 6Minneapolis Medical Research Foundation, Minneapolis, MN, USA; 7Department of Social Pharmacy, Universidade Federal de Minas Gerais, Belo Horizonte, Minas Gerais, Brazil; 8Pharmacy Services, Mayo Clinic, Rochester, MN, USA; 9Knowledge and Evaluation Research Unit, Mayo Clinic, Rochester, MN, USA; 10Faculty of Health Sciences and NIHR CLAHRC Wessex, University of Southampton, Southampton, UK; 11School of Medicine, University of Virginia, Charlottesville, VA, USA Purpose: The workload of health care and its impact on patient functioning and well-being is known as treatment burden. The purpose of this study was to finalize a conceptual framework of treatment burden that will be used to inform a new patient-reported measure of this construct. Patients and methods: Semi-structured interviews were conducted with 50 chronically ill patients from a large academic medical center (n=32 and an urban safety-net hospital (n=18. We coded themes identifying treatment burden, with the themes harmonized through discussion between multiple coders. Four focus groups, each with five to eight participants with chronic illness, were subsequently held to confirm the thematic structure that emerged from the interviews. Results: Most interviewed patients (98

  16. Feminist film studies 40 years after ‘Visual Pleasure and Narrative Cinema’, a triologue

    OpenAIRE

    Laura Mulvey; Anna Backman Rogers; Annie van den Oever

    2015-01-01

    Forty years after the publication of her seminal essay ‘Visual Pleasure and Narrative Cinema’ in Screen, Laura Mulvey, together with Anna Backman Rogers, has edited Feminisms: Diversity, Difference, and Multiplicity in Contemporary Film Cultures, which is the latest instalment of The Key Debates series. NECSUS invited Laura Mulvey and Anna Backman Rogers to join Annie van den Oever, editor of NECSUS and series editor of The Key Debates, in a ‘triologue’, which in part reflects and re-empha...

  17. ACT-R/E: An Embodied Cognitive Architecture for Human-Robot Interaction

    Science.gov (United States)

    2013-01-01

    Threaded Cognition: An Integrated Theory of Concurrent Multitasking . Psychological Review, 115(1), 101–130, http://dx.doi.org/10.1037/0033-295X...Trafton, Naval Research Laboratory, Washington, DC, USA Email : greg.trafton@nrl.navy.mil Laura Hiatt, Naval Research Laboratory, Washington, DC, USA Email ...laura.hiatt@nrl.navy.mil Anthony Harrison, Naval Research Laboratory, Washington, DC, USA Email : anthony.harrison@nrl.navy.mil Frank Tamborello, Naval

  18. Overcoming Endocrine Resistance by Targeting ER/FoxA1/IL 8 Axis

    Science.gov (United States)

    2016-10-01

    Nardone, Carmine De Angelis, Laura M. Heiser , Pavana Anur, Nicholas Wang, Catherine S. Grasso, Paul Spellman, Obi L. Griffith, Anna Tsimelzon...presentations Publications Fu X, Jeselsohn R, Pereira R, Hollingsworth EF, Creighton CJ, Li F, Shea M, Nardone A, Angelis CD, Heiser LM, Anur P, Wang N...performed the bioinformatics analysis of RNA-Seq and ChIP-Seq data. Name: Laura Heiser Project Role: Collaborator Nearest person month worked: 1

  19. Anemia prevalence and treatment practice in patients with non-myeloid tumors receiving chemotherapy

    OpenAIRE

    Merlini,; Cartenì,; Iacobelli,; Stelitano,; Airoldi,Mairoldi; Balcke,Peter; Keil,Felix; Haslbauer,Ferdinand; Belton,Laura; Pujol,

    2013-01-01

    Laura Merlini,1 Giacomo Cartenì,2 Stefano Iacobelli,3 Caterina Stelitano,4 Mario Airoldi,5 Peter Balcke,6 Felix Keil,7 Ferdinand Haslbauer,8 Laura Belton,9 Beatriz Pujol10 1Department of Medical Oncology, Ospedale Civile S, Bortolo, Vicenza, 2Department of OncoHematology, Azienda Ospedaliera di Rilievo Nazionale "Antonio Cardarelli", Napoli, 3Department of Medical Oncology, Ospedale Clinicizzato SS Annunziata, Chieti, 4Department of Hematology, Azienda Ospedali...

  20. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-07

    Mar 7, 2018 ... ation with the pump units of various types operating in the optimal and correct mode. ... In the existing irrigation systems of the Sara- ... Journal of Fundamental and Applied Sciences is licensed under a Creative Commons ...

  1. Annual report of the Grenoble Institute of nuclear science

    International Nuclear Information System (INIS)

    Vignon, B.

    1988-01-01

    Research in theoretical nuclear physics; peripheral reactions and intermediate energy physics; characteristics of reaction mechanisms in heavy ion collisions; nuclear structure; fundamental interactions; interdisciplinary studies; experimental methods and instrumentation; and the SARA accelerator is presented [fr

  2. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  3. Preventing Pressure Sores

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  4. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  5. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  6. Hella hingega karmid naised / Krista Kaer

    Index Scriptorium Estoniae

    Kaer, Krista

    1996-01-01

    Tänapäeva kriminaalromaani inglise ja ameerika autoritest (Dame Phyllis Dorothy James, Joan Smith, Lynda La Plante (inglise); Sara Paretsky, Sue Grafton, Patricia Cornwell (ameerika) ja nende poolt loodud naisdetektiivi kujudest

  7. Bridging the gap between farmers and supermarkets in Nicaragua ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2014-07-03

    Jul 3, 2014 ... Elder chose to study smallholder farmers after working in Kenya as an ... Combining this data will help her gain expertise in qualitative and quantitative work. ... Sara Elder interviews smallholder farmers in Nicaragua.

  8. 75 FR 80037 - Poultry Programs; Notice of Request for an Extension and Revision of a Currently Approved...

    Science.gov (United States)

    2010-12-21

    ... DEPARTMENT OF AGRICULTURE Agricultural Marketing Service [Doc. No. AMS-PY-10-0098] Poultry... David Bowden, Jr., Chief, Standards, Promotion, & Technology Branch; Poultry Programs, AMS, U.S.... FOR FURTHER INFORMATION CONTACT: Sara Lutton, Standards, Promotion, & Technology Branch; Poultry...

  9. Investigating Asphaltenes Composition in Crude Oil Samples using ...

    African Journals Online (AJOL)

    MBI

    2015-12-22

    Dec 22, 2015 ... composition of asphaltenes by Iatroscan TLC-FID method was compared with the weight% of asphaltenes precipitated. ... SARA in the crude oil samples were determined in this work ..... Fractionation and characterization of.

  10. Nutrition from aquaculture and home gardens in Cambodia

    International Development Research Centre (IDRC) Digital Library (Canada)

    is about 76% carbohydrate, only 10% protein, and only 14% fat. Foods from animal sources ... to increase and diversify food production and provide low- ... Senior Program Specialist, Ottawa, Canada (awesley@idrc.ca) or. Sara Ahmed, Senior ...

  11. Mind Over Matter: Methamphetamine

    Science.gov (United States)

    ... Teaching Guide and Series / Methamphetamine Mind Over Matter: Methamphetamine (Meth) Print Order Free Publication in: English Spanish ... paranoia, aggressiveness, and hallucinations. The Brain's Response to Methamphetamine Hi, my name's Sara Bellum. Welcome to my ...

  12. Are You Shopping Smart for Prescription Drugs?

    Science.gov (United States)

    ... work well for them through the CR Best Buy Drugs program. Photo courtesy of Sara Jorde Photography A ... National Library of Medicine, the Consumer Reports Best Buy Drugs program helps consumers discuss drug choices with their ...

  13. Policy challenges in modern health care

    National Research Council Canada - National Science Library

    Mechanic, David

    2005-01-01

    ... for the Obesity Epidemic KENNETH E. WARNER 99 8 Patterns and Causes of Disparities in Health DAVID R. WILLIAMS 115 9 Addressing Racial Inequality in Health Care SARA ROSENBAUM AND JOEL TEITELBAU...

  14. Pop / Tõnis Kahu

    Index Scriptorium Estoniae

    Kahu, Tõnis, 1962-

    2008-01-01

    Heliplaatidest: Get Cape. Wear Cape. Fly "Searching For The Hows And Whys", The Black Crowes "Warpaint", Jonny Greenwood "There Will Be Blood", Tegan & Sara "The Con", Teräsbetoni "Myrskyntuoja", REM "Accelerate"

  15. 76 FR 11494 - List of Recipients of Indian Health Scholarships Under the Indian Health Scholarship Program

    Science.gov (United States)

    2011-03-02

    ... Collins, Sara Jane, University of Oklahoma, Cherokee Nation, Oklahoma Cook, David D., Rocky Vista... University, Oglala Sioux Tribe of the Pine Ridge Reservation, South Dakota Jim, Leroy, The Fielding Institute...

  16. 77 FR 44310 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2012-07-27

    ... JACINTA YEUNG CHEONG CHANG MICHAEL YIO-HOW CHENG NICOLAS VINCENT CHI TELLY TAI HSUAN CHINOY SAMIR MUSTAPHA... TONJA YVONNE SU JIN CHIN SU XIAOBO SARA SHAO SUEN SAMSON C. L. SY KEVIN NEIL TAN LAI HING THARALDSEN...

  17. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family ... play_arrow How is the delivery of a child affected by the mother's spinal cord injury? play_ ...

  18. Technical Guidance for Hazardous Analysis, Emergency Planning for Extremely Hazardous Substances

    Science.gov (United States)

    This current guide supplements NRT-1 by providing technical assistance to LEPCs to assess the lethal hazards related to potential airborne releases of extremely hazardous substances (EHSs) as designated under Section 302 of Title Ill of SARA.

  19. the capacity of megasphaera elsdenii strain ncimb 41125 to control ...

    African Journals Online (AJOL)

    David

    SARA include grain treatment to reduce starch degradation, feed additives such as ... Keywords: Megasphaera elsdenii, ruminal acidosis, dairy cattle, beef cattle, sheep, ...... Mastitis. Retained foetal membranes. Metritis/endometritis. Ketosis.

  20. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Kayvan Etebari1 Leila Matindoost2. Department of Sericulture, Faculty of Natural Resources, University of Guilan, Somehe Sara, Iran; Department of Entomology, Faculty of Agriculture, University of Guilan, Rasht, Iran ...

  1. Bacteriophage-antibiotic synergism to control planktonic and biofilm ...

    African Journals Online (AJOL)

    Bacteriophage-antibiotic synergism to control planktonic and biofilm producing clinical isolates of Pseudomonas aeruginosa. Amina Amal Mahmoud Nouraldin, Manal Mohammad Baddour, Reem Abdel Hameed Harfoush, Sara AbdelAziz Mohamed Essa ...

  2. Reforming the American Military Officer Personnel System

    Science.gov (United States)

    2015-12-02

    Lamping Lewis, Henry Leonard, Julia Pollak, Christopher Guo and Bernard Rostker, Tour Lengths, Permanent Changes of Station, and Alternatives for...Raymond E. Conley, Stephanie Young, William A. Williams, Jeffrey Engstrom, Barbara Bicksler, Sara Beth Elson, Joseph Jenkins , Lianne Kennedy

  3. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  4. Preventing Pressure Sores

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  5. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  6. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  7. Review of the Scientific Evidence of Using Population Normative Values for Post-Concussive Computerized Neurocognitive Assessments

    Science.gov (United States)

    2016-02-10

    R, Virginia Commonwealth University  Dr. Chris Giza, Professor of Pediatric Neurology and Neurosurgery, UCLA Brain Injury Research Center October...Sara Higgins , MPH Analyst, Grant Thornton LLP Kendal Brown, MBA Management Analyst, Information Innovators, Inc. Margaret Welsh Management

  8. Eczema (Atopic Dermatitis)Treatment

    Science.gov (United States)

    ... Lubricate or moisturize the skin two to three times a day using ointments such as petroleum jelly. Moisturizers should be ... Freeman Peter Hubbard Sara Jones Tony Lee Lara R. ... Kinyoun Lecture Series 2016 Kinyoun Lecture 2015 Kinyoun Lecture 2014 Kinyoun ...

  9. Depression among Congestive Heart Failure Patients: Results of a Survey from Central China

    Directory of Open Access Journals (Sweden)

    JPMS

    2011-10-01

    Full Text Available Tabish Hussain, Li Yu Shu, Xiang Cheng, Tumenjavkhlan Sosorburam, A.Seid Adji, Sara Tajammul, Aamra Sartaj (Union Hospital, Tongji Medical College, Huazhong University of Sciences and Technology, Wuhan, China (pages 38-42

  10. Assessing the viability of the Species at Risk Act in managing commercial exploitation and recovery of threatened and endangered marine fish in Canada

    OpenAIRE

    Druce, Courtney Danielle

    2012-01-01

    Commercially exploited threatened or endangered marine fish are consistently declined for listing under Canada’s Species at Risk Act (SARA), largely due to predicted socio-economic impacts associated with SARA’s prohibitions. However, commercial exploitation can be exempted from SARA’s general prohibitions. If exemptions were utilized, commercially exploited species could benefit from other aspects of SARA listing, and support continued economic opportunities for fishers. I conducted a litera...

  11. An Investigation into Rumen Fungal and Protozoal Diversity in Three Rumen Fractions, during High-Fiber or Grain-Induced Sub-Acute Ruminal Acidosis Conditions, with or without Active Dry Yeast Supplementation.

    Science.gov (United States)

    Ishaq, Suzanne L; AlZahal, Ousama; Walker, Nicola; McBride, Brian

    2017-01-01

    Sub-acute ruminal acidosis (SARA) is a gastrointestinal functional disorder in livestock characterized by low rumen pH, which reduces rumen function, microbial diversity, host performance, and host immune function. Dietary management is used to prevent SARA, often with yeast supplementation as a pH buffer. Almost nothing is known about the effect of SARA or yeast supplementation on ruminal protozoal and fungal diversity, despite their roles in fiber degradation. Dairy cows were switched from a high-fiber to high-grain diet abruptly to induce SARA, with and without active dry yeast (ADY, Saccharomyces cerevisiae ) supplementation, and sampled from the rumen fluid, solids, and epimural fractions to determine microbial diversity using the protozoal 18S rRNA and the fungal ITS1 genes via Illumina MiSeq sequencing. Diet-induced SARA dramatically increased the number and abundance of rare fungal taxa, even in fluid fractions where total reads were very low, and reduced protozoal diversity. SARA selected for more lactic-acid utilizing taxa, and fewer fiber-degrading taxa. ADY treatment increased fungal richness (OTUs) but not diversity (Inverse Simpson, Shannon), but increased protozoal richness and diversity in some fractions. ADY treatment itself significantly ( P PERMANOVA, P = 0.0001, P = 0.0452, P = 0.0068, Monte Carlo correction, respectively, and location was a significant factor ( P = 0.001, Monte Carlo correction) for protozoa. Diet-induced SARA shifts diversity of rumen fungi and protozoa and selects against fiber-degrading species. Supplementation with ADY mitigated this reduction in protozoa, presumptively by triggering microbial diversity shifts (as seen even in the high-fiber diet) that resulted in pH stabilization. ADY did not recover the initial community structure that was seen in pre-SARA conditions.

  12. Peranan Raja La Maddaremmeng Dalam Penyebaran Islam Di Bone

    Directory of Open Access Journals (Sweden)

    Nasruddin Nasruddin

    2014-06-01

    Full Text Available King Bone to Lamaddaremmeng XIII has a very large role and has the effect of early-early development of Islam in southern Sulawesi. He Maddaremeng is committed to enforce Sharia Law. His efforts were Eliminating slavery, Addition parewa Sara, to revamp the governance structure by adding positions previously unknown structure that positions parewa sara, eradication of idols, eliminating the arbitrary actions on others, Equal rights. Other efforts are trying to eliminate the differences in the degree of the community.

  13. Targets and special materials

    International Nuclear Information System (INIS)

    Blanc, R.; Bouriant, M.; Richaud, J.P.

    1997-01-01

    The target preparation group supplied a large number of samples to nuclear physicists for experiments using SARA and also other accelerators throughout the world. Particular preparation and projects include: 208 Pb, 116 Cd, 6 LiF, 123 Sb, In and Ta targets, strippers for SARA and GANIL, optical silicone disks for POLDER and GRAAL experiments, active participations for the AMS project and finally filament preparation for the GENEPI project. (authors)

  14. Ruminal acidosis: a review with detailed reference to the controlling agent Megasphaera elsdenii NCIMB 41125

    OpenAIRE

    Meissner, H.H.; Henning, P.H.; Horn, C.H.; Leeuw, K-J.; Hagg, F.M.; Fouché, G.

    2010-01-01

    Ruminal acidosis is discussed with reference to causes and economic and health implications. Distinction is made between the acute form which with proper adaptation to high energy diets is seldom encountered and the more problematic chronic or sub-acute form, commonly referred to as sub-acute ruminal acidosis (SARA). Apart from stepwise transition from roughage to concentrates, methods adopted to reduce SARA include grain treatment to reduce starch degradation, feed additives such as buffers ...

  15. Paducah Gaseous Diffusion Plant site environmental report for 1988

    International Nuclear Information System (INIS)

    Rogers, J.G.; Jett, T.G.

    1989-05-01

    Quantities of nonradiological chemical emissions are not included in this report this year. An addendum that will include the information will be published after the Superfund Amendments Reauthorization Act (SARA) Title III report is issued on July 1, 1989. When the addendum is published, probably in late July, a summary of the SARA Title III 313 report will be included. The SARA report provides the community with the opportunity to lean about estimated quantities of certain toxic chemicals used at a facility that are routinely or accidentally released into the environment. The addendum that will be published after the SARA report will summarize the SARA report and is expected to include some additional ''large quantity'' chemicals used or stored at the facilities that are not required to be reported by SARA Title III but are known to be emitted from the facilities. The addendum will not be all inclusive but will provide emissions information on the major chemical emissions to the air, water, or land from processes at the facilities

  16. In vitro residual anti-bacterial activity of difloxacin, sarafloxacin and their photoproducts after photolysis in water

    International Nuclear Information System (INIS)

    Kusari, Souvik; Prabhakaran, Deivasigamani; Lamshoeft, Marc; Spiteller, Michael

    2009-01-01

    Fluoroquinolones like difloxacin (DIF) and sarafloxacin (SARA) are adsorbed in soil and enter the aquatic environment wherein they are subjected to photolytic degradation. To evaluate the fate of DIF and SARA, their photolysis was performed in water under stimulated natural sunlight conditions. DIF primarily degrades to SARA. On prolonged photodegradation, seven photoproducts were elucidated by HR-LC-MS/MS, three of which were entirely novel. The residual anti-bacterial activities of DIF, SARA and their photoproducts were studied against a group of pathogenic strains. DIF and SARA revealed potency against both Gram-positive and -negative bacteria. The photoproducts also exhibited varying degrees of efficacies against the tested bacteria. Even without isolating the individual photoproducts, their impact on the aquatic environment could be assessed. Therefore, the present results call for prudence in estimating the fate of these compounds in water and in avoiding emergence of resistance in bacteria caused by the photoproducts of DIF and SARA. - Assessment of the residual anti-bacterial efficacies of difloxacin, sarafloxacin and their photoproducts in water, and estimating their impact on the aquatic environment in inducing resistance to microorganisms.

  17. AS RESSONÂNCIAS DA LITERATURA POPULAR DO NORDESTE NO ROMANCE DA PEDRA DO REINO E O PRÍNCIPE DO SANGUE DO VAI-E-VOLTA

    OpenAIRE

    Geice Peres Nunes

    2010-01-01

    A presente dissertação de mestrado intitulada As ressonâncias da literatura popular do nordeste no Romance dA Pedra do Reino e o príncipe do sangue do vai-e-volta foi elaborada por Geice Peres Nunes sob a orientação do Prof. Dr. Lawrence Flores Pereira, da Universidade Federal de Santa Maria. Nesse estudo, debruçamo-nos na influência da Literatura popular do nordeste e da poesia oral no Romance dA Pedra do Reino e o Príncipe do sangue do vai-e-volta, de Ariano Suassuna. Para tanto, lançamos m...

  18. A dorico order of architecture in Europe: ''At Lusitania... que mare attenticum spectrat...; A ordem dorica da arquitectura no nascer da Europa at Lusitania que Mare Atlanticum Speciat

    Energy Technology Data Exchange (ETDEWEB)

    Simoes, V.

    2004-07-01

    Investigating the Enigmatic Tower of Centum Celas, in it, the Precepts of the Doric Order of the Greek Architecture: the Pentagram, of the Divine Proportion, (the golden number: ? = 1,618); the Thermic Comfort of the Veranda Porch;. Near Centum Celas I discovered a primitive Greek Temple of same period (C. VI cent, B. C.), in the Lusitanian Gold and Tin Route Archetypes of the Patrimony of Human Childhood. In my opinion, our historians and archiologists have paid little attention to the migrations of what I call the Si(self) Arian of the Euro-Asian steppes, to the Neolithic's Communities of the Middle East and which was by them baptised Iberia. However the Si (self) Ariano turns European, with a man mutation, with the Greek thalassocracy, from Asian Troya to Occident Troia, where the Tagus flows into the sea. (Author)

  19. MIRAGENS E PRISMAS: O BARROCO DÁ MOVIMENTO ÀS IMAGENS HERMÉTICAS NA POESIA SUASSUNIANA

    Directory of Open Access Journals (Sweden)

    Paulo Caldas Neto

    2009-03-01

    Full Text Available RESUMO Este artigo visa a estudar a presença de uma vertente barroca na poesia contemporânea. Nada melhor que a lírica armorial de Ariano Suassuna para servir de investigação a nossas suspeitas. Sendo esse gênero da obra suassuniana tão pouco examinado, provavelmente não se conheça a sua importância para a construção do sentido de sua dramaturgia e de sua prosa de ficção (bem mais conhecidas. A relação desenhada entre a teoria da dobra barroca de Deleuze e os estudos sobre a estética dos Setecentos casou tranqüilamente com a finalidade de se descobrir a essência de todo o hermetismo. Ora o poema armorial é barroco, ora seu conjunto imagético pode até sugerir, fazendo com que o leitor pense que se trata de um esteticismo simbolista, a prova disso está no registro de substantivos concretos com suas letras iniciais maiúsculas. Daí, tem-se, em parte, o movimento da dobra, sempre mutante, oscilador. Na primeira seção, é feito um breve panorama da arte barroca, marcada por suas irregularidades. Na segunda seção, justifica-se o efeito que estas causam: as dobras. A partir delas, as correspondências entre as formas fixas do poema, a heráldica sertaneja e os problemas do Nordeste se completarão perfeitamente. PALAVRAS-CHAVE: Ariano Suassuna, poema, Barroco, dobra e hermetismo. ESPEJISMOS Y PRISMAS: EL BARROCO DA MOVIMIENTO A LAS IMAGÉNES HERMÉTICAS EN LA POESÍA SUASUNIANA RESUMEN Este artículo mira a estudiar la presencia de una vertiente barroca en la poesía contemporanea. Nada mejor que la lírica armonica de Ariano Suassuna para servir de investigación a nuestras sospechas. Siendo ese género de la obra suasuniana tan poco examinado, probablemente no se conozca su importancia para la construcción del sentido de su dramaturgia y de su prosa de ficción (bien más conocidas. La relación dibujada entre la teoría del doblez barroco de Deleuze y los estudios sobre la estética de los Setecientos cas

  20. Quantum Information Biology: From Information Interpretation of Quantum Mechanics to Applications in Molecular Biology and Cognitive Psychology

    Science.gov (United States)

    Asano, Masanari; Basieva, Irina; Khrennikov, Andrei; Ohya, Masanori; Tanaka, Yoshiharu; Yamato, Ichiro

    2015-10-01

    We discuss foundational issues of quantum information biology (QIB)—one of the most successful applications of the quantum formalism outside of physics. QIB provides a multi-scale model of information processing in bio-systems: from proteins and cells to cognitive and social systems. This theory has to be sharply distinguished from "traditional quantum biophysics". The latter is about quantum bio-physical processes, e.g., in cells or brains. QIB models the dynamics of information states of bio-systems. We argue that the information interpretation of quantum mechanics (its various forms were elaborated by Zeilinger and Brukner, Fuchs and Mermin, and D' Ariano) is the most natural interpretation of QIB. Biologically QIB is based on two principles: (a) adaptivity; (b) openness (bio-systems are fundamentally open). These principles are mathematically represented in the framework of a novel formalism— quantum adaptive dynamics which, in particular, contains the standard theory of open quantum systems.

  1. RNA structure alignment by a unit-vector approach.

    Science.gov (United States)

    Capriotti, Emidio; Marti-Renom, Marc A

    2008-08-15

    The recent discovery of tiny RNA molecules such as microRNAs and small interfering RNA are transforming the view of RNA as a simple information transfer molecule. Similar to proteins, the native three-dimensional structure of RNA determines its biological activity. Therefore, classifying the current structural space is paramount for functionally annotating RNA molecules. The increasing numbers of RNA structures deposited in the PDB requires more accurate, automatic and benchmarked methods for RNA structure comparison. In this article, we introduce a new algorithm for RNA structure alignment based on a unit-vector approach. The algorithm has been implemented in the SARA program, which results in RNA structure pairwise alignments and their statistical significance. The SARA program has been implemented to be of general applicability even when no secondary structure can be calculated from the RNA structures. A benchmark against the ARTS program using a set of 1275 non-redundant pairwise structure alignments results in inverted approximately 6% extra alignments with at least 50% structurally superposed nucleotides and base pairs. A first attempt to perform RNA automatic functional annotation based on structure alignments indicates that SARA can correctly assign the deepest SCOR classification to >60% of the query structures. The SARA program is freely available through a World Wide Web server http://sgu.bioinfo.cipf.es/services/SARA/. Supplementary data are available at Bioinformatics online.

  2. Usaha La Sangkuru Patau Dalam Mengembangkan Agama Islam Di Kerajaan Wajo

    Directory of Open Access Journals (Sweden)

    Nasruddin Nasruddin

    2014-12-01

    Full Text Available La Sangkuru Patau is one of the Arung Matoa Wajo has substantial powers. His remarks could be a law and society Wajo stick to what he says. So when La Sangkuru Patau said that he had converted to Islam, the community participated Wajo also embraced Islam. Arung Matoa Wajo La Sangkuru with doing business in developing Islam in Wajo that bring Datu Sulaiman to provide Islamic religious instruction in public Wajo, then set up a sara officers' special charge of handling issues such royal Friday prayers, warnings Islamic holidays , then hold the officer cadre sara 'that will be placed outside the capital of the kingdom (Tosora, sara officers' given the facilities, such as free of taxes, as well as the parallel position to the position of indigenous stakeholders.

  3. Wrox SharePoint 2010 SharePoint911 three-pack

    CERN Document Server

    Klindt, Todd; Mason, Jennifer; Rogers, Laura; Drisgill, Randy; Ross, John; Riemann, Larry; Perran, Amanda; Perran, Shane; Sanford, Jacob J; Stubbs, Paul; Caravajal, Steve

    2012-01-01

    The Wrox SharePoint 2010 SharePoint911 Three-Pack combines the contents of three full e-books written by the experts from SharePoint911.  That's over 1800 pages of hands-on advice from Todd Klindt, Shane Young, Laura Rogers, Randy Drisgill, Jennifer Mason, John Ross, and Larry Riemann, among others. In Beginning SharePoint 2010: Building Business Solutions with SharePoint (ISBN 978-0-470-61789-2) by Amanda Perran, Shane Perran, Jennifer Mason, and Laura Rogers, readers learn the core concepts, terminology, and features of SharePoint 2010. In Professiona

  4. The Carolina Autism Transition Study (CATS)

    Science.gov (United States)

    2017-07-01

    AWARD NUMBER: W81XWH-15-1-0093 TITLE: The Carolina Autism Transition Study (CATS) PRINCIPAL INVESTIGATOR: Laura Carpenter, MD RECIPIENT...Carolina Autism Transition Study (CATS) 5b. GRANT NUMBER W81XWH-15-1-0093 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER Laura Carpenter...provides a description of the Year 2 progress made and plans for Year 3 for the project entitled “The Carolina Autism Transition Study (CATS).” The goal of

  5. Data to DecisionsTerminate, Tolerate, Transfer, or Treat

    Science.gov (United States)

    2016-07-25

    and resources.  Degradation of current capability continues. Transfer – Opportunities and Consequences:  Requires a surgical knowledge of what...I N S T I T U T E F O R D E F E N S E A N A L Y S E S Data to Decisions—Terminate, Tolerate, Transfer , or Treat Laura A...Data to Decisions—Terminate, Tolerate, Transfer , or Treat For more information Laura Odell(lodell@ida.org, 703-845-2009 The Department

  6. Feminist film studies 40 years after ‘Visual Pleasure and Narrative Cinema’, a triologue

    Directory of Open Access Journals (Sweden)

    Laura Mulvey

    2015-04-01

    Full Text Available Forty years after the publication of her seminal essay ‘Visual Pleasure and Narrative Cinema’ in Screen, Laura Mulvey, together with Anna Backman Rogers, has edited Feminisms: Diversity, Difference, and Multiplicity in Contemporary Film Cultures, which is the latest instalment of The Key Debates series. NECSUS invited Laura Mulvey and Anna Backman Rogers to join Annie van den Oever, editor of NECSUS and series editor of The Key Debates, in a ‘triologue’, which in part reflects and re-emphasises the topics publicly discussed during the Feminisms symposia.

  7. Substorm associated radar auroral surges: a statistical study and possible generation model

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available Substorm-associated radar auroral surges (SARAS are a short lived (15–90 minutes and spatially localised (~5° of latitude perturbation of the plasma convection pattern observed within the auroral E-region. The understanding of such phenomena has important ramifications for the investigation of the larger scale plasma convection and ultimately the coupling of the solar wind, magnetosphere and ionosphere system. A statistical investigation is undertaken of SARAS, observed by the Sweden And Britain Radar Experiment (SABRE, in order to provide a more extensive examination of the local time occurrence and propagation characteristics of the events. The statistical analysis has determined a local time occurrence of observations between 1420 MLT and 2200 MLT with a maximum occurrence centred around 1700 MLT. The propagation velocity of the SARAS feature through the SABRE field of view was found to be predominately L-shell aligned with a velocity centred around 1750 m s–1 and within the range 500 m s–1 and 3500 m s–1. This comprehensive examination of the SARAS provides the opportunity to discuss, qualitatively, a possible generation mechanism for SARAS based on a proposed model for the production of a similar phenomenon referred to as sub-auroral ion drifts (SAIDs. The results of the comparison suggests that SARAS may result from a similar geophysical mechanism to that which produces SAID events, but probably occurs at a different time in the evolution of the event.

    Key words. Substorms · Auroral surges · Plasma con-vection · Sub-auroral ion drifts

  8. Perlindungan Hukum Kelompok Teisme dalam Sistem Negara Hukum Pancasila

    Directory of Open Access Journals (Sweden)

    Tomy Michael

    2017-05-01

    Full Text Available Di era global saat ini, suatu bangsa dituntut mampu bersaing dengan negara lain. Agar tidak terlepas dari unsur khas Indonesia maka penguatan Pancasila sebagai ideologi adalah keharusan. Pancasila yang melingkupi keragaman suku, agama, ras dan antar golongan (SARA kurang tercermin dalam UU Nomor 23 Tahun 2006. Permasalahan yang timbul yaitu hilangnya unsur khas Indonesia yaitu kepercayaan atau agama tradisional karena adanya diskriminasi dengan pengosongan kolom agama dalam Kartu Kelurga (KK dan Kartu Tanda Penduduk (KTP (Pasal 61 dan Pasal 64 UU No. 23-2006. Penelitian ini bertujuan untuk menganalisis korelasi hukum UU No. 23 tahun 2016 dengan keberadaan Pancasila dan SARA di Indonesia. Metode penelitian yang digunakan adalah penelitian hukum normatif. Hasil penelitian ini menunjukkan bahwa UU No. 23 Tahun 2006 tidak selaras dengan semangat Pancasila yang mengakui keragaman SARA dan bertentang dengan asas keadilan dalam UU No. 12Tahun 2011. In the global era, a nation supposedly able to compete with other countries. In order not to be separated from the typical elements of Indonesia, the strengthening of Pancasila as an ideology is a must. Pancasila surrounding ethnic, religious, racial and sectarian (SARA less diversity reflected in Law No. 23 of 2006. The problems that arise, namely the loss of the typical elements of Indonesia namely traditional religious beliefs or because of their discrimination by emptying the religion column in Family Card (KK and Identity Card (KTP (Article 61 and Article 64 of Law No. 23-2006. This study aims to analyze the correlation on Law No. 23of 2016 with the existence of Pancasila and SARA in Indonesia. The method used is a normative legal research. The result of this study reveals that the Law No. 23 of 2006 not in line with the spirit of Pancasila that recognizes the diversity of SARA and incompatible with the principles of justice on Law No. 12 of 2011.

  9. The concentration principle applied to spaceborne solar arrays. AGORA mission: Studies synthesis

    Science.gov (United States)

    Laget, R.

    1986-01-01

    Studies that led to selection of the distributed 25 kW SARA LOUVRE concept for the solar cell generator to be flown on the AGORA asteroid mission, and the major characteristics of such a spaceborne solar array are summarized. In the SARA LOUVRE concept, a parabolic cross section reflector concentrates incident light over the rear face of the identical, preceding reflector dish. The whole set of reflectors is pivotally commanded, thus compensating the effects of depointing. Geometric concentration factor is 10. End of life power level at 2.5 AU is 4.5 kW.

  10. An Investigation into Rumen Fungal and Protozoal Diversity in Three Rumen Fractions, during High-Fiber or Grain-Induced Sub-Acute Ruminal Acidosis Conditions, with or without Active Dry Yeast Supplementation

    Directory of Open Access Journals (Sweden)

    Suzanne L. Ishaq

    2017-10-01

    Full Text Available Sub-acute ruminal acidosis (SARA is a gastrointestinal functional disorder in livestock characterized by low rumen pH, which reduces rumen function, microbial diversity, host performance, and host immune function. Dietary management is used to prevent SARA, often with yeast supplementation as a pH buffer. Almost nothing is known about the effect of SARA or yeast supplementation on ruminal protozoal and fungal diversity, despite their roles in fiber degradation. Dairy cows were switched from a high-fiber to high-grain diet abruptly to induce SARA, with and without active dry yeast (ADY, Saccharomyces cerevisiae supplementation, and sampled from the rumen fluid, solids, and epimural fractions to determine microbial diversity using the protozoal 18S rRNA and the fungal ITS1 genes via Illumina MiSeq sequencing. Diet-induced SARA dramatically increased the number and abundance of rare fungal taxa, even in fluid fractions where total reads were very low, and reduced protozoal diversity. SARA selected for more lactic-acid utilizing taxa, and fewer fiber-degrading taxa. ADY treatment increased fungal richness (OTUs but not diversity (Inverse Simpson, Shannon, but increased protozoal richness and diversity in some fractions. ADY treatment itself significantly (P < 0.05 affected the abundance of numerous fungal genera as seen in the high-fiber diet: Lewia, Neocallimastix, and Phoma were increased, while Alternaria, Candida Orpinomyces, and Piromyces spp. were decreased. Likewise, for protozoa, ADY itself increased Isotricha intestinalis but decreased Entodinium furca spp. Multivariate analyses showed diet type was most significant in driving diversity, followed by yeast treatment, for AMOVA, ANOSIM, and weighted UniFrac. Diet, ADY, and location were all significant factors for fungi (PERMANOVA, P = 0.0001, P = 0.0452, P = 0.0068, Monte Carlo correction, respectively, and location was a significant factor (P = 0.001, Monte Carlo correction for protozoa

  11. Management of Sub-acute Ruminal Acidosis in Dairy Cattle for Improved Production: A Review

    OpenAIRE

    Kafil Hussain; Amjad Ul Islam; Surinder Kumar Gupta

    2011-01-01

    Sub-acute ruminal acidosis (SARA) is a well-recognized digestive disorder that is an increasing health problem in most dairy herds. Feeding diets high in grain and other highly fermentable carbohydrates to dairy cows increases milk production, but also increases the risk of SARA. Sub-acute ruminal acidosis is defined as periods of moderately depressed ruminal pH, from about 5.5 to 5.0. Sub-acute ruminal acidosis may be associated with laminitis and other health problems resulting in decreased...

  12. Implementation of Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) Health Authority by the Agency for Toxic Substances and Disease Registry

    International Nuclear Information System (INIS)

    Siegel, M.R.

    1990-01-01

    The Superfund Amendments and Reauthorization Act (SARA) of 1986 greatly expanded the health authority of the Comprehensive Environmental Response, Compensation, and Liability Act. One of the federal agencies most affected by SARA is the Agency for Toxic Substances and Disease Registry (ATSDR) of the U.S. Public Health Service. Among other responsibilities, ATSDR was mandated to conduct health assessments within strict time frames for each site on or proposed for the U.S. Environmental Protection Agency's National Priorities List. The author will review ATSDR's efforts to address this new statutory mandate, especially for federal facilities, and will focus on different conceptual frameworks for implementing the health assessment program

  13. 6th International Symposium on Molecular Allergology (ISMA

    Directory of Open Access Journals (Sweden)

    Christiane Hilger

    2016-10-01

    -allergic humans Almedina Kurtaj, Christoph Hillebrand, Gerda Fichtinger, Martin Danzer, Christian Gabriel, Theresa Thalhamer, Sandra Scheiblhofer, Josef Thalhamer, Richard Weiss P4 Analyzing the cross-reactivity profile of the major ragweed allergen Amb a 1 Martin Wolf, Michael Hauser, Ulrike Pichler, Teresa Twaroch, Gabriele Gadermaier, Christof Ebner, Hidenori Yokoi, Toshiro Takai, Alain Didierlaurent, Adriano Mari, Peter Briza, Heidrun Behrendt, Angela Neubauer, Frank Stolz, Fátima Ferreira, Michael Wallner P5 LTP (Pru p 3 sensitisation in skin prick test: which means in clinical practice? Sara Carvalho, Tatiana Lourenço, Joana Cosme, Fátima Cabral Duarte, Amélia Spínola Santos, Ana Célia Costa, Manuel Pereira Barbosa P6 IgE profiles, allergen exposure and lifestyle of 501 Austrian pupils: investigation of influences on the development of allergic sensitizations Teresa Stemeseder, Eva Klinglmayr, Bettina Schweidler, Lisa Lueftenegger, Stephanie Moser, Patrick Doppler, Roland Lang, Martin Himly, Gertie J. Oostingh, Arne Bathke, Joerg Zumbach, Thomas Hawranek, Gabriele Gadermaier P7 Molecular profiles of sensitization to perennial inhalant allergens in a middle European region Petr Panzner, Martina Vachova, Tomas Vlas, Marek Maly P8 Evolution of the IgE response to house dust mite allergen molecules in childhood Daniela Posa, Serena Perna, Stephanie Hofmaier, Laura Hatzler, Alexander Rohrbach, Carl-Peter Bauer, Ute Hoffmann, Johannes Forster, Fred Zepp, Antje Schuster, Philippe Stock, Ulrich Wahn, Linus Grabenhenrich, Thomas Keil, Susanne Lau, Kuan-Wei Chen, Yvonne Resch, Susanne Vrtala, Rudolf Valenta, Paolo Maria Matricardi P9 Tropomyosin (Pen a1: to include or not to include in skin prick testing? Joana Cosme, Sara Carvalho, Tatiana Lourenço, Amélia Spínola Santos, Manuel Pereira Barbosa Immunoallergy Department - Hospital de Santa Maria – Centro Hospitalar Lisboa Norte, Lisbon, Portugal, Lisbon, Portugal; Immunoallergy Department - Hospital de Santa Maria

  14. Music Activities for "Mama", "Mama" and "Papa", "Papa"

    Science.gov (United States)

    Cardany, Audrey Berger

    2011-01-01

    Jean Marzollo creates two beautiful texts using a child's first words, "Mama, Mama" and "Papa, Papa" as a recurring theme. Wildlife artist, Laura Regan, illustrates Marzollo's poetry with loving images of parents and children in the animal kingdom. Poetry and illustrations highlight the tenderness and care of Mama and Papa as they bond with their…

  15. Dzhässikavad toovad linna jõulurõõmu / Silja Joon

    Index Scriptorium Estoniae

    Joon, Silja, 1966-

    2008-01-01

    "Jazzkaare" kolm dzhässiõhtut Pärnus - 3. dets. Eliisabeti kirikus Raivo Tafenau, Ain Agan ja Laura Põldvere, 9. dets. Endla teatris Saksamaa vokaalansambel Berlin Voices (Esther Kaiser, Sarah Kaiser, Marc Secara, Kristofer Benn) ja 11. dets. Ammende villas norra laulja Gine Andressen. Berlin Voices soojendusansamblina esineb Pärnu noorte vokaalansambel Greip

  16. Moskvalased näevad eesti nüüdiskunsti / Johannes Saar

    Index Scriptorium Estoniae

    Saar, Johannes, 1965-

    2007-01-01

    Moskvas nüüdiskunsti keskuses avatakse 19.09.2007 eesti kunstnike grupinäitus "Tagurpidi bluus". Anna Hints, Laura Kuusk, Neeme Külm, Kristina Norman, Jüri Ojaver, Jaan Paavle, Jaan Toomik ja Paul Rodgers pakuvad videos, fotos ja installatsioonides mõtlemisainet kultuurilise konsensuse üle. Näituse korraldaja on Kaasaegse Kunsti Eesti Keskus

  17. Mesto vstretshi - Tallinn / Aleksandra Manukjan

    Index Scriptorium Estoniae

    Manukjan, Aleksandra

    2003-01-01

    22. juulil avatakse Rotermanni soolalaos rahvusvaheline Põhja- Euroopa kaasaegse kunsti näitus "Kohtumispaik". Eesti kuraator on Hanno Soans, nimetatud ka kuraatoreid teistest maadest. Osalejatest on esile toodud Laura Stasiulyte, Miklos Gaal ja Sandis Konrads, nimetatud veel 13 osaleja nimed. Projekti autor ja mänedžer on rootsi kunstnik Truls Olin

  18. Navy and Coast Guard Shipbuilding: Navy Should Reconsider Approach to Warranties for Correcting Construction Defects

    Science.gov (United States)

    2016-03-01

    As noted in the report, we found that different stakeholders within the Navy used the guaranty to accomplish differing and, at times, contradictory...staff members made key contributions to this report: Diana Moldafsky, Assistant Director; Laurier Fish; Joseph Franzwa; Ronald Freeman ; Laura

  19. "Why Do They Hate Us?": Leading amid Criticism, Crisis, and Disrespect

    Science.gov (United States)

    Karpinski, Carol F.

    2012-01-01

    Laura Dannon, an educator with experience as teacher, assistant principal, and principal, enjoys her profession. Faculty camaraderie and student/teacher busyness at her school have led her to think all is well. A sudden outburst by a new teacher causes her to reflect on what is really happening. What has changed? Have media criticism, movements…

  20. The First Reactor, 40th Anniversary (rev.)

    Energy Technology Data Exchange (ETDEWEB)

    Allardice, Corbin; Trapnell, Edward R; Fermi, Enrico; Fermi, Laura; Williams, Robert C

    1982-12-01

    This booklet, an updated version of the original booklet describing the first nuclear reactor, was written in honor of the 40th anniversary of the first reactor or "pile". It is based on firsthand accounts told to Corbin Allardice and Edward R. Trapnell, and includes recollections of Enrico and Laura Fermi.

  1. TRIHALOMETHANE LEVELS IN HOME TAP WATER AND SEMEN QUALITY

    Science.gov (United States)

    Trihalomethane Levels in Home Tap Water and Semen QualityLaura Fenster, 1 Kirsten Waller, 2 Gayle Windham, 1 Tanya Henneman, 2 Meredith Anderson, 2 Pauline Mendola, 3 James W. Overstreet, 4 Shanna H. Swan51California Department of Health Services, Division of Environm...

  2. Reasoning about Independence in Probabilistic Models of Relational Data (Author’s Manuscript)

    Science.gov (United States)

    2014-01-06

    computer vision and information retrieval. Näıvely specifying a joint distribution by hand requires an exponential number of states; however, Bayesian...Journal of the Royal Statistical Society. Series B (Methodological), pages 267–288, 1996. Ioannis Tsamardinos, Laura E. Brown, and Constantin F. Aliferis

  3. Feminist Film Theory and Criticism.

    Science.gov (United States)

    Mayne, Judith

    1985-01-01

    Discusses Laura Mulvey's 1975 essay, "Visual Pleasure and Narrative Cinema," and the ideas about feminist film theory and psychoanalysis as a critical tool which it raises. Suggests contradiction is the central issue in feminist film theory. Explores definitions of women's cinema. (SA)

  4. Sleep: a serious contender for the prevention of obesity and non ...

    African Journals Online (AJOL)

    Sleep: a serious contender for the prevention of obesity and non-communicable diseases. Dale E. Rae, Irshaad Ebrahim, Laura C. Roden. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.1080/16089677.2016.

  5. Первый сорт со второй попытки

    Index Scriptorium Estoniae

    2010-01-01

    ReUse Republic disainilaadast Kristiine Keskuses Tallinnas 3.-7. veebruaril 2010. Ürituse raames loovad noored disainerid tuntud moebrändide laojääkidest originaalesemeid ning müüvad neid. Taaskasutust propageeriva konkursi Uus-ReUse parimate tööde tutvustus. Võidutööks osutus Laura Toomsalu kilekottidest valmistatud valgusti

  6. 78 FR 55083 - Submission for OMB Review; 30-day Comment Request; Genomics and Society Public Surveys in...

    Science.gov (United States)

    2013-09-09

    ... site. The URL for this survey site will also be advertised separately through media and social media... information on the proposed project, contact: Laura M. Koehly, Ph.D., Senior Investigator, Social and... in health conditions and associated risk factors; The role of friends, family, media, and health...

  7. Fine5 tantsuteater võitis Vitebskis teise preemia

    Index Scriptorium Estoniae

    2006-01-01

    22. - 26. XI Valgevenes toimunud kaasaegse koreograafia konkursil "International Festival of Modern Choreography" võitsid Laura Kvelstein ja Dmitri Kruus lühiteostega "1 spot, 2 shadows" teise preemia. Konkursi raames toimunud meistriklasse juhendas Fine5 koreograaf Tiina Ollesk

  8. Preserve America News

    Science.gov (United States)

    Hillary Clinton, and Mrs. Laura Bush on stage at the Sewall-Belmont House. Mrs. Bush was joined by Secretary of the Interior Dirk Kempthorne and Senators Hillary Clinton (NY) and Pete Domenici (NM), who Save America's Treasures established by the Clinton Administration. Secretary Dirk Kempthorne, Senator

  9. Kõik on nii nagu enne, aga miski pole enam endine / Martin Rünk

    Index Scriptorium Estoniae

    Rünk, Martin

    2010-01-01

    Anders Härmi kuraatoriprojekt "Next to Nothing" ("Eimillestki edasi") Eesti Kaasaegse Kunsti Muuseumis 22. augustini 2010. Pikemalt Martin Creedi (Suurbritannia), Laura Tootsi, Triin Tamme, Dénes Farkasi, Neeme Külma ja Kaido Ole töödest

  10. Margus Laanet - erakust mässaja / Erle Selling

    Index Scriptorium Estoniae

    Selling, Erle

    2001-01-01

    Eesti päritolu kunstnikust Margus Laanetist (s. 16. juulil 1965 Väike-Maarjas), kes peab oma kodumaaks Hondurast, elab peamiselt Guatemalas, korraldab näitusi ka teistes Ladina-Ameerika maades. Tema üheksast isiknäitusest (1989-2000), retseptsioonist. Mehhiko kunstiteadlase Karen Reiman Cordero, argentiina kunstiteadlase Laura Malosetti-Costa ja M. Laaneti kommentaarid.

  11. Fruit and vegetable phytochemicals: chemistry, nutritional value, and stability

    National Research Council Canada - National Science Library

    González-Aguilar, Gustavo A; Rosa, Laura A. de la; Alvarez-Parrilla, Emilio

    2010-01-01

    ... and Their Relation to Human Health Alma E. Robles-Sardin, Adriana Ver´ o nica Bola˜ n os-Villar, Gustavo A. Gonz´ a lez-Aguilar, and Laura A. de la Rosa 155 Chapter 7. Chemistry, Stability, and Biological Actions ...

  12. Saaremaa noored said hakkama eduka filmiga! / Minni Saapar

    Index Scriptorium Estoniae

    Saapar, Minni

    2006-01-01

    Saaremaa Ühisgümnaasiumi abituriendid Laura Tõhk ja Marili Pärtel said oma filmiga "Fallen Angel" 11. ja 12. novembrini Rakvere Teatrikinos toimunud "Noorte filmipäevadel Rakveres 2006" parima dokumentaalfilmi auhinna. Konkursi 21 filmi seast said viis filmi auhinna ja kolm eriauhinna.

  13. Integrating Operational Energy Implications into System-Level Combat Effects Modeling: Assessing the Combat Effectiveness and Fuel Use of ABCT 2020 and Current ABCT

    Science.gov (United States)

    2015-01-01

    Endy M. Daehner, John Matsumura, Thomas J. Herbert , Jeremy R. Kurz, Keith Walters Integrating Operational Energy Implications into System-Level... George Guthridge, and Megan Corso for their clear guid- ance and assistance throughout the study. We also received valuable information and insights from...helped with processing modeling and simulation outputs. Laura Novacic and Donna Mead provided invaluable administrative assistance and help with

  14. Rescuing the Soiled Dove: Pop Culture's Influence on a Historical Narrative of Prostitution

    Science.gov (United States)

    Voelkel, Micki; Henehan, Shelli

    2018-01-01

    American popular culture romanticises relationships between sex workers and their customers; novels, films and television depict prostitutes as innocents in need of rescue by a wealthy or powerful man. Miss Laura's Social Club, a restored Victorian brothel in Fort Smith, Arkansas, USA, functions both as an informal house museum and the visitor…

  15. inquests on five persons who died after blood transfusio

    African Journals Online (AJOL)

    Inquests held at Cape Town on 3, 8 and I7 March 1956 at Magis- trates Court Cape Town before Mr. J. H. Basson, additional magistrate, assisted by Dr. R. J. ... surgical operation to control the uterine bleeding. (e) Laura M. C. Schenk, .... unusual-circumstances and are most unlikely to be repeated in the future. The general ...

  16. Science.gov (United States)

    2005-09-01

    Screen break: nursing students Jackie Walsh, Laura Robinson and Liz Midgley join 'matron' Sandra McQuat, a ward manager at Beatson Oncology Centre, the Western Infirmary, Glasgow, as they try out nurse training 1950s style for a new BBC series to be televised this autumn. The series, Thoroughly Modern Matron, was filmed at Belvoir Park Hospital, Belfast.

  17. Maakondliku Liivide etluskonkursi võitis gümnasist Marian Heinat / Ene Kallas

    Index Scriptorium Estoniae

    Kallas, Ene

    2008-01-01

    Maakondliku Juhan ja Jakob Liivi etluskonkursi žüriisse kuulusid Ott Aardam, Käthe Pihlak, Piret Rauk, Vaido Luks ja Marili Pärtel. Grand prix' võitis Marian Heimat, laureaatideks tulid Liisa Saaremäel, Maria Pihlak ja Laura Oolup. Eripreemiad said Marii Metsmaa, Ermo Loik, Sander Aavik, Kaimar Nuut ja Priidu Aardam

  18. Spring Research Festival and NICBR Collaboration Winners Announced | Poster

    Science.gov (United States)

    By Carolynne Keenan, Contributing Writer, and Ashley DeVine, Staff Writer The winners of the 2014 Spring Research Festival (SRF), held May 7 and 8, were recognized on July 2, and included 20 NCI at Frederick researchers: Matthew Anderson, Victor Ayala, Matt Bess, Cristina Bergamaschi, Charlotte Choi, Rami Doueiri, Laura Guasch Pamies, Diana Haines, Saadia Iftikhar, Maria

  19. Naised leedu kunstnike pilgu läbi

    Index Scriptorium Estoniae

    2002-01-01

    Hansapanga galeriis leedu kaasaegse kunsti näitus "Õppides ja lauldes". Kuraator Kestutis Kuizinas. Osalevad Laura Stasiulyte, Gediminas ja Nomeda Urbonas, Vita Zaman. Videod ja slaidiprogrammid näitavad tõelisi või lavastatud episoode naiste elust tänapäeva Leedus

  20. Segmentation and Classification of Burn Color Images

    Science.gov (United States)

    2001-10-25

    SEGMENTATION AND CLASSIFICATION OF BURN COLOR IMAGES Begoña Acha1, Carmen Serrano1, Laura Roa2 1Área de Teoría de la Señal y Comunicaciones ...2000, Las Vegas (USA), pp. 411-415. [21] G. Wyszecki and W.S. Stiles, Color Science: Concepts and Methods, Quantitative Data and Formulae (New

  1. Teater valib parimad :"Maarja kuulutamine" püüab viit auhinda

    Index Scriptorium Estoniae

    2009-01-01

    Eesti teatriauhindade sõnalavastuste nominentide hulgas paistab silma Lembit Petersoni lavastus "Maarja kuulutamine" Theatrumis. See kandideerib nii parima lavastuse kui ka parima lavastaja tiitlile, samuti on parima naisnäitleja nominentidena välja toodud õed Laura ja Maria Peterson ning Lembit Peterson kandideerib ka parima meeskõrvalosa auhinnale samas lavastuses

  2. Mälestusmärk iseendale / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2009-01-01

    Lembit Petersonist ja tema lavastusest "Maarja kuulutamine", mille eest ta pälvis aastapreemia ja osatäitmiste eest samas lavastuses said aasta naisnäitlejapreemiad tema tütred Maria ja Laura Peterson. Poeg Marius Peterson sai preemia osatäitmise eest lavastuses "Linn"

  3. HPV Prevention (A Cup of Health with CDC)

    Centers for Disease Control (CDC) Podcasts

    2016-07-07

    Human papillomavirus, or HPV, is a virus that can cause certain cancers and is the most commonly sexually transmitted infection in the U.S. In this podcast, Dr. Laura Viens discusses the importance of getting vaccinated against HPV.  Created: 7/7/2016 by MMWR.   Date Released: 7/7/2016.

  4. Arenguabistajad süüdistavad Eestit jalalohistamises / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 1. juuli 2008, lk. 10. Valitsusväliseid ühendusi koondavas raportis kritiseeritakse Eestit väheste summade eraldamises rahvusvahelisele arenguabile. Lisa: Baltimaade arenguabi aastal 2007; Vt. samas raporti koostamisel osalenud ActionAidi esindaja Laura Sullivani kommentaari

  5. Two Classification Methods for Grouping Common Environmental Sounds in Terms of Perceived Pleasantness

    Science.gov (United States)

    2016-02-01

    NUMBER OF PAGES 24 19a. NAME OF RESPONSIBLE PERSON Kelly Dickerson a. REPORT Unclassified b. ABSTRACT Unclassified c . THIS...ARL-TR-7960 ● FEB 2016 US Army Research Laboratory Two Classification Methods for Grouping Common Environmental Sounds in Terms...of Perceived Pleasantness by Kelly Dickerson, Brandon S Perelman, Laura Sherry, and Jeremy R Gaston Approved for public

  6. Minority Undergraduate Research in Prostate Cancer: Bridging Opportunities for Post-Baccalaureate Education

    Science.gov (United States)

    2010-04-01

    Rubrics for the ASBMB Undergraduate Poster Competition 2007 Dr. David Usher (Dept. of Biological Sciences), Tyler Larsen and Laura Sloofman. A good site...did his research on a genetic disease called Spinal Muscular Atrophy, also known as SMA. "I did research up at the Children’s Hospital because this is a

  7. IDRC hosts the Science Writers and Communicators of Canada ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-09-20

    Sep 20, 2017 ... Marie Lambert-Chan, editor-in-chief of Québec Science, Scott Hannant, former ... Although Canada's Periodical Fund provides financial assistance to ... During the IDRC World Café, IDRC Program Management Officer Laura ...

  8. Kaitstud magistri- ja doktoritööd 2014

    Index Scriptorium Estoniae

    2015-01-01

    Magistritööd kaitsesid: Ekaterina Ermolaeva, Helena Haller, Kadri Kallast, Ville-Matti Aleksi Kataja, Laura Kiiroja, Alina-Ruxanda Mircea, Tatjana Pilipoveca, Liina Sieberk, Katsiaryna Suryna, Fatemeh Tavakoli, Ele Viskus; doktoritööd kaitses Vadim Verenitš

  9. A World of Magic: Conference Papers from the Selected Sessions of the AACRAO Annual Meeting (79th, Orlando, FL, April 18-23, 1993).

    Science.gov (United States)

    Russell, Michele, Ed.

    Papers on aspects of college admission, records, and institutional research functions are: "How To Improve Office Morale" (Victor Swenson); "Staff Meetings: How To Save Hours per Month and Develop Your Staff" (LuAnn Harris, Shelley Olsen); "Selling SPEED/ExPRESS" (Laura Patterson, Thomas Scott); "Advisement and…

  10. Kristiina Uslar Londoni klaasivõistluse finaalis

    Index Scriptorium Estoniae

    2006-01-01

    Londonis avati rahvusvahelise klaasikonkursi "The Bombay Sapphire Prize" 2006. aasta finalistide näitus. Eestit esindab Kristiina Uslar tööga "Data Turbine". Konkursi peaauhinna võitis hispaania kunstnik Jaune Plensa, parima uustulnuka auhinna inglise klaasikunstnik Laura Birdsall

  11. 77 FR 40553 - High Seas Driftnet Fishing Moratorium Protection Act; Identification and Certification Procedures...

    Science.gov (United States)

    2012-07-10

    .... obligations under applicable international trade law, including the World Trade Organization (WTO) Agreement... CONTACT: Laura Cimo, Trade and Marine Stewardship Division, Office of International Affairs, NMFS, at (301... organizations calling for international restrictions on the fishing activities or practices described in the...

  12. "Never Enough": Bridging the Chasm between College Women's Achievements and Their Anguish

    Science.gov (United States)

    Choate, Laura A.

    2017-01-01

    Laura H. Choate demonstrates a disconnect between what female undergraduates are achieving and how they actually feel about themselves and their accomplishments; she suggests a variety of interventions to counterbalance the cultural pressures that undermine college women's overall self-esteem and mental health.

  13. Meteor Beliefs Project: ``Year of Meteors''

    Science.gov (United States)

    McBeath, Alastair; Drobnock, George J.; Gheorghe, Andrei Dorian

    2011-10-01

    We present a discussion linking ideas from a modern music album by Laura Veirs back to a turbulent time in American history 150 years ago, which inspired poet Walt Whitman to compose his poem "Year of Meteors", and the meteor beliefs of the period around 1859-1860, when collection of facts was giving way to analyses and theoretical explanations in meteor science.

  14. Interview

    DEFF Research Database (Denmark)

    Sarauw, Laura Louise; Hessel, Niklas

    2011-01-01

    Laura Louise Sarauw har netop forsvaret sin ph.d.-afhandling i Pædagogik ved Københavns Universitet. Hun har undersøgt, hvordan det har påvirket ti humanistiske uddannelser, at deres studieordninger med universitetsreformen i 2003 blev skrevet om, så de fokuserede på de erhvervsmæssige kompetence...

  15. Maalimine lubatud! 2014 A.D. = Painting allowed! 2014 A.D. / Jaan Elken

    Index Scriptorium Estoniae

    Elken, Jaan, 1954-

    2014-01-01

    Kaasaegsest maalikunstist Eestis. Vaadeldakse eredamaid hetki 2014. a. maalinäitustelt: Merike Estna isiknäitus Kumus, Eesti Kunstnike Liidu "Kevadnäitus", näitus "Sund" ja noorte maalikunstnike näitus "Cant go on, must go on" Tallinna Kunstihoones, Laura Põllu isiknäitus Hobusepea galeriis

  16. Um diálogo entre Ocidente e Oriente

    Directory of Open Access Journals (Sweden)

    Marco Catalão

    2011-10-01

    Full Text Available Entrevista realizada em agosto de 2011 com a professora Laura Cerrato, em que se debatem alguns elementos da poética do escritor argentino Roberto Juarroz (1925-1995, especialmente sua relação com o Budismo e a tradição oriental.

  17. Harvard Education Letter. Volume 26, Number 5, September-October 2010

    Science.gov (United States)

    Walser, Nancy, Ed.

    2010-01-01

    "Harvard Education Letter" is published bimonthly at the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) Scenes from the School Turnaround Movement: Passion, Frustration, Mid-Course Corrections Mark Rapid Reforms (Laura Pappano); (2) The Media Savvy Educator:…

  18. Harvard Education Letter. Volume 23, Number 2, March-April 2007

    Science.gov (United States)

    Chauncey, Caroline, Ed.

    2007-01-01

    "Harvard Education Letter" is published bimonthly at the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) More Than "Making Nice": Getting Teachers to (Truly) Collaborate (Laura Pappano); (2) "Doing the Critical Things First": An Aligned Approach to PreK and Early Elementary Math;…

  19. Harvard Education Letter. Volume 23, Number 4, July-August 2007

    Science.gov (United States)

    Chauncey, Caroline, Ed.

    2007-01-01

    "Harvard Education Letter" is published bimonthly by the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) Meeting of the Minds: The Parent-Teacher Conference Is the Cornerstone of School-Home Relations. How Can It Work for All Families? (Laura Pappano); (2) In Search of That "Third…

  20. Vastutada lustides ja vastupidi / interv. Eva-Liisa Linder

    Index Scriptorium Estoniae

    2006-01-01

    Lavakunstikooli XXII lend räägib kooliajast, õpetajatest ja õppetööst. Kõnelevad Mihkel Kabel, Martin Kõiv, Risto Kübar, Lauri Lagle, Tõnn Lamp, Mari-Liis Lill, Markus Luik, Ragne Pekarev, Laura Peterson, Ursula Ratasepp, Inga Salurand, Veiko Tubin, Nero Urke, Britta Vahur ja Sergo Vares

  1. InfoDOMAIN. Fall 2011

    Science.gov (United States)

    2011-09-01

    NIOC Sugar Grove LT Stephen Gray , NATO Training Mission Afghanistan CTTC Andrew Hodyl, NIOC Colorado IT3 Adam Kissinger, SUSLA Korea LCDR Sven...Gauthier, NCTS Naples CTR1 Laura Geigel, NIOC Maryland IT3 Stephen Gerrald, NIOC Norfolk CTTC Derrick Gillespie, NIOC Texas CTR1 Eileen Girardy NIOC

  2. Controlling Mosquitoes Outside

    Centers for Disease Control (CDC) Podcasts

    Mosquitoes can carry viruses, like West Nile, Zika, dengue, and chikungunya. In this podcast, Mr. Hubbard will teach you and his neighbor, Laura, ways to help reduce the number of mosquitoes outside your home. Tips include eliminating areas of standing water where mosquitoes lay eggs and using larvicides to kill young mosquitoes.

  3. Runoff Characterization and Variations at McMurdo Station, Antarctica

    Science.gov (United States)

    2014-05-13

    Boulevard Arlington, VA 22230 Laura Elliot and Corey Chan Antarctic Support Contract 7400 S. Tucson Way Centennial , CO 08112 Michael Diamond...then along the road and down Hut Point Road. Sub-basin 2 has the largest area and encompasses the majority of the snowfield and the depression above

  4. 75 FR 35815 - Ocean Transportation Intermediary License Applicants

    Science.gov (United States)

    2010-06-23

    ..., TX 76011. Officers: Omar Kolaghassi, Manager (Qualifying Individual), Laura Alicia, Manager. Application Type: New OFF & NVO License. CALS Logistics USA, Inc. (OFF & NVO), 755 North Route 83, Suite 215.... Premium Star Logistics LLC dba O.P. Premium Star Logistics (OFF & NVO), 4200 Lightning Court, Bakersfield...

  5. 77 FR 204 - Federal Acquisition Regulation; Technical Amendments

    Science.gov (United States)

    2012-01-03

    ... Parts 4, 8, 15, 19, 22, 23, 28, 42, and 52 Government procurement. Dated: December 21, 2011. Laura... paragraph (a)(2) ``http:// www.sba.gov/GC/pcr.html'' and adding ``http://www.sba.gov/content/ procurement-center-representatives'' in its place. PART 22--APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITIONS 22...

  6. Working in the Virtual Stacks: The New Library and Information Science

    Science.gov (United States)

    Kane, Laura Townsend, Ed.

    2011-01-01

    Thanks in part to technology, the boundaries of library positions are dissolving. It is no longer practical to discuss the profession in terms of traditional library types, and in today's library, the relationship between librarians and technology is stronger than ever. In this informative volume, veteran author Laura Townsend Kane interviews…

  7. Ammende pakub suvemuusikat / Silja Joon

    Index Scriptorium Estoniae

    Joon, Silja, 1966-

    2007-01-01

    Kontsertidest Pärnus Ammende villas: 5. juulil "Mõeldes Sinule" (Laura Põldvere, Jorma Toots, Marti Tärn, Ahto Abner), 12. juulil Kadri Voorand, Jürmo Eespere, Mihkel Mälgand ja Tanel Ruben, 19. juulil Tõnu Naissoo, Raul Vaigla ja Marko Naissoo kontserdiga "Tõnu Naissoo Eclectic Electric Trio", 26. juulil Holger Marjamaa kvartett (Holger Marjamaa, Mairo Marjamaa, Peedu Kass ja Dmitri Nikolajevski)

  8. Journal of Endocrinology, Metabolism and Diabetes of South Africa ...

    African Journals Online (AJOL)

    Sleep: a serious contender for the prevention of obesity and non-communicable diseases · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Dale E. Rae, Irshaad Ebrahim, Laura C. Roden, 48-49. http://dx.doi.org/10.1080/16089677.2016.1150574 ...

  9. Omas mahlas / Raineras Vilumaa

    Index Scriptorium Estoniae

    Vilumaa, Raineras

    2004-01-01

    Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones kuni 11. VII ja Rotermanni soolalaos kuni 8. VIII. Kuraatorid Anders Härm, Eha Komissarov ja Hanno Soans. 26. VI esitlesid kunstnikud Arturas Bumshteinas, Laura Garbshtiene (G-Lab) ja helilooja Antanas Jasenka oma heliinstallatsioone

  10. Giving Muslim Girls "A Voice": The Possibilities and Limits to Challenging Patriarchal Interpretations of Islam in One English Community

    Science.gov (United States)

    Keddie, Amanda

    2009-01-01

    This paper presents the philosophies and practices of "Laura", a young English community liaison worker and former religious studies teacher who has recently converted to Islam. Drawing on data generated from a qualitative and predominantly interview-based research project that investigated issues of pedagogy and social justice in…

  11. Assessing 21st Century Skills: A Guide to Evaluating Mastery and Authentic Learning

    Science.gov (United States)

    Greenstein, Laura

    2012-01-01

    The Common Core State Standards clearly define the skills students need for success in college and the 21st century workplace. The question is, how can you measure student mastery of skills like creativity, problem solving, and use of technology? Laura Greenstein demonstrates how teachers can teach and assess 21st century skills using authentic…

  12. LUCY: A New Path to Diversity

    Science.gov (United States)

    Marrah, Arleezah; Mills, Roxanne

    2011-01-01

    This article describes the Librarianship Upgrades for Children and Youth Services (LUCY), a multifaceted multicultural continuing education program for librarians developed by the Library and Information Science Program at Old Dominion University. The Institute of Museum and Library Services (IMLS) funds LUCY through the Laura Bush 21st century…

  13. Looking outside the (voice)box.

    Science.gov (United States)

    Gartrell, Nanette; Rothblum, Esther

    2014-01-01

    Laura S. Brown, PhD, is a clinical and forensic psychologist in independent practice in Seattle, Washington. The bulk of her scholarly work has been in the fields of feminist therapy theory, trauma treatment, lesbian and gay issues, assessment and diagnosis, ethics and standards of care in psychotherapy, and cultural competence. She has authored or edited ten professional books, including the award-winning Subversive Dialogues: Theory in Feminist Therapy, as well as more than 140 other professional publications. She has also recently published her first book for general audiences, Your turn for care: Surviving the aging and death of the adults who harmed you. Laura has been featured in five psychotherapy training videos produced by the American Psychological Association. She was President of American Psychological Association Divisions 35 (Society for the Psychology of Women), 44 (Society for the Psychological Study of Lesbian, Gay and Bisexual Issues), and 56 (Trauma Psychology). Laura was also President of the Washington State Psychological Association. She is the founder and Director of the Fremont Community Therapy Project, a low-fee psychotherapy training clinic in Seattle. In the fall of 2000, she was the on-site psychologist for the reality show Survivor: The Australian Outback. In 1987, Laura lost her voice and was diagnosed with spasmodic dysphonia. In 1988, she found her voice again.

  14. Cannes südames / Mirkka Maikola

    Index Scriptorium Estoniae

    Maikola, Mirkka

    2011-01-01

    Nicolas Winding Refni filmist "Drive" (USA 2011). Lisaks tegid oma pingerea Cannes´is nähtud filmidest Eesti filmikriitikud ja -tegijad Jaan Ruus, Jaak Lõhmus, Tristan Priimägi, Jaak Kilmi, Andris Feldmanis, Maria Ulfsak-Šeripova ja Laura Talvet

  15. 77 FR 25510 - GPS Funds I, et al.; Notice of Application

    Science.gov (United States)

    2012-04-30

    ...] GPS Funds I, et al.; Notice of Application April 24, 2012. AGENCY: Securities and Exchange Commission... the Act to invest in certain financial instruments. Applicants: GPS Funds I, GPS Funds II (each a.... FOR FURTHER INFORMATION CONTACT: Laura L. Solomon, Senior Counsel, at (202) 551-6915 or Daniele...

  16. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... V Morales1 Laura E Bortoni2 Paula C Turk-Noceto1 Elio A Prieto1. Centro de Altos Estudios en Ciencias Humanas y de la Salud, Universidad Abierta Interamericana (UAI); Instituto de Oncología Ángel H Roffo, Buenos Aires, Argentina; Consejo Nacional de Investigaciones Científicas y Técnicas, Buenos Aires, Argentina ...

  17. Noorte looming : [luuletused

    Index Scriptorium Estoniae

    2007-01-01

    Sisu: Kuked ja kanad / Laura Trull ; "Ma igatsen õnne..." / Kattre Adramees ; Usk / Riinu Ansperi ; Talveüllatus / Aile Eldemeel ; Vastutus / Riinu Ansperi ; Pisike peni / Indrek Kuka ; Tere, talv! / Villi Brandt ; Minu kool / Kaisa Tamm ; Selle teeraja mälestuseks / Anni Vanin

  18. Diagnosis and management of feline hyperthyroidism: current perspectives

    OpenAIRE

    Grauer, Gregory F; Schermerhorn,Thomas; Armbrust,Laura; Vaske,Heather

    2014-01-01

    Heather H Vaske, Thomas Schermerhorn, Laura Armbrust, Gregory F Grauer Department of Clinical Sciences, Kansas State University, Manhattan, KS, USA Abstract: Previous and ongoing research has provided insights to the pathophysiology and diagnosis of hyperthyroidism as well as new treatment modalities. This paper reviews the etiology, clinical presentation, and clinicopathologic changes associated with hyperthyroidism, and provides a thorough explanation of confirmatory testing and treatment ...

  19. "Butterfly under a Pin": An Emergent Teacher Image amid Mandated Curriculum Reform

    Science.gov (United States)

    Craig, Cheryl J.

    2012-01-01

    The author examines 1 experienced teacher's image of teaching and how it was purposely changed--through external intervention and against the individual's will--from the view of teacher as curriculum maker to the view of teacher as curriculum implementer. Laura's account of the "butterfly under a pin" image, a version of the…

  20. African Journal of AIDS Research - Vol 5, No 2 (2006)

    African Journals Online (AJOL)

    Talking about sex in Botswana: social desirability bias and possible implications for HIV-prevention research · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Kata Chillag, Greg Guest, Arwen Bunce, Laura Johnson, Peter H Kilmarx, Dawn K Smith, 123-131.

  1. 76 FR 10083 - 60-Day Notice of Proposed Information Collection: DS-7652, U.S. National Commission for UNESCO...

    Science.gov (United States)

    2011-02-23

    ... UNESCO (IO/UNESCO). Form Number: DS-7646. Respondents: U.S. college and university students applying for... students at U.S. colleges and universities, will submit descriptions of self-designed proposals for brief... Collection: DS-7652, U.S. National Commission for UNESCO Laura W. Bush Traveling Fellowship ACTION: Notice of...

  2. 16 moeõppetundi itaalia stiilis / Nicole Picart, Richard Gianorio, Marie Varvoux

    Index Scriptorium Estoniae

    Picart, Nicole

    2007-01-01

    Itaalia moekunstnikud Gianfranco Ferre, Frida Giannini (Gucci), Graeme Black (Ferragamo), Angela Missioni (Missioni), Laura Lusuardi (Max Mara), Roberto Cavalli, Donatella Versace, Silvia Venturini (Fendi), Gaia Trussardi, Tomas Maier (Bottega Veneta), Dolce & Gabbana, Cristina Ortiz (Brioni), Rossella Jardini (Moschino), Alberta Ferretti, Giorgio Armani, Dean ja Dan Caten (Dsquared 2) iseloomustavad ideaalset naist, itaalia stiili, ajatut moodi ja kommenteerivad oma moekunstnikuks saamist. Lisatud fotod moekunstnikest

  3. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... PhD Sigmund Hough, PhD Laura Tuck, PsyD Terrie Price, PhD Heather Taylor, PhD Michelle Meade, PhD Jonathon ... the most important thing for families to know right away? play_arrow What are the main concerns ...

  4. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... PhD Sigmund Hough, PhD Laura Tuck, PsyD Terrie Price, PhD Heather Taylor, PhD Michelle Meade, PhD Jonathon ... arrow Why are high-dose steroids often used right after an injury? play_arrow What is meant ...

  5. Looking at Citizenship through a Literary Lens

    Science.gov (United States)

    Tavares, Laura

    2017-01-01

    President Barack Obama once said he believes that he learned how to be a good citizen by reading novels. In this article, Laura Tavares looks at the ways that ELA teachers can use fiction to illustrate social and ethical awareness, humility, and a tolerance for difference--all traits that are necessary to be a good citizen. By putting themselves…

  6. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Lotfali Saghatforoush1 Laura Valencia Matarranz2 Firoozeh Chalabian3 Shahriare Ghammamy4 Fatemeh Katouzian5. Department of Chemistry, Payame Noor University, 19395-4697, Tehran, I.R. of Iran; Departamento de Quimica Inorganica, Facultad de Quimica, Universidade de Vigo, 36310 Vigo Pontevedra, Spain ...

  7. 77 FR 18883 - Surety Companies Acceptable on Federal Bonds; Change in Business Address and Redomestication...

    Science.gov (United States)

    2012-03-28

    ... directed to the U.S. Department of the Treasury, Financial Management Service, Financial Accounting and...: March 18, 2012. Laura Carrico, Director, Financial Accounting and Services Division, Financial...: Financial Management Service, Fiscal Service, Department of the Treasury. ACTION: Notice. SUMMARY: This is...

  8. 76 FR 38459 - Surety Companies Acceptable on Federal Bonds-Redomestication and Change in Business Address...

    Science.gov (United States)

    2011-06-30

    ... directed to the U.S. Department of the Treasury, Financial Management Service, Financial Accounting and...: June 22, 2011. Laura Carrico, Director, Financial Accounting and Services Division, Financial...: Financial Management Service, Fiscal Service, Department of the Treasury. ACTION: Notice. SUMMARY: This is...

  9. Consumer Health

    Science.gov (United States)

    Bibel, Barbara

    2010-01-01

    This article presents an annotated bibliography of 19 titles that focus on cancer and health-care reform. These include: (1) Anderson, John W. "Stand by Her: A Breast Cancer Guide for Men." AMACOM: American Management Assn.; (2) Carstensen, Laura L. "A Long Bright Future: An Action Plan for a Lifetime of Happiness, Health, and Financial Security."…

  10. Advice for Fund Raisers: Know Your Donors and Never Let Them See You Sweat

    Science.gov (United States)

    Masterson, Kathryn

    2008-01-01

    The psychology behind getting the big gift and making "the ask" for it was a major topic at Fund Raising Day in New York 2008, which drew representatives from across the nonprofit world, including charities, hospitals, colleges, and museums. Laura Fredricks, who was vice president for philanthropy at Pace University from 2002 until earlier this…

  11. Fooling the feeling of doing: a goal perspective on illusions of agency

    NARCIS (Netherlands)

    Dannenberg, L.A.

    2012-01-01

    Machtige en succesvolle mensen zijn ongevoelig voor de illusie van agency (sturend vermogen). Dit komt omdat mensen die hun doel hebben bereikt of weten hoe ze dat kunnen bereiken, zich minder op de uitkomst van hun handelen hoeven te focussen. Dit blijkt uit onderzoek van Laura Dannenberg. Als

  12. Siidii / Kreete Reval

    Index Scriptorium Estoniae

    Reval, Kreete

    2003-01-01

    Heliplaatidest: Lõkõrig "Süä kisk", Laura Pausini "From The Inside", Gary Moore "Back To The Blues", Ayako Lister "The Japanese Koto", Massive Attack "100th Window", ERSO & Arvo Volmer "Eduard Tubin: 2. ja 5. sümfooniad", Claire's Birthday "Future Is Now!"

  13. Siidii / Kreete Reval

    Index Scriptorium Estoniae

    Reval, Kreete

    2003-01-01

    Heliplaatidest: Laura Pausini "From The Inside", Gary Moore "Back To The Blues", Ayako Lister "The Japanese Koto", Massive Attack "100th Window", Erso & Arvo Volmer "Eduard Tubin: 2. ja 5. sümfooniad", Claire's Birthday "Future Is Now!", Lõkõriq "Süa kisk"

  14. Postimehe fotograaf võitis konkursi "Eesti foto 2004" / Neeme Korv

    Index Scriptorium Estoniae

    Korv, Neeme, 1974-

    2004-01-01

    Pärnu Uue Kunsti Muuseumi ja fotoajakirja "Cheese" fotokonkursil osales 67 fotograafi. Grand prix' võitis Ove Maidla broomõlitehnikas fotodega, millel kujutatakse maastikke, aega ja inimesi. Järgnesid Kristo Rihm, Anu Vahtra ja Märten Kross. Parim noor fotograaf oli Laura Nõmmik

  15. Euroliit jagab kirjanduspreemiaid

    Index Scriptorium Estoniae

    2009-01-01

    Euroopa Komisjon kuulutas välja esimesed Euroopa kirjanduspreemia laureaadid: Paulus Hochgatterer (Austria), Mila Pavicevic (Horvaatia), Emmanuelle Pagano (Prantsusmaa), Szécsi Noémi (Ungari), Karen Gillece (Iirimaa), Daniele Del Giudice (Itaalia), Laura Sintija Černiauskaitė (Leedu), Carl Frode Tiller (Norra), Jacek Dukaj (Poola), Dulce Maria Cardos (Portugal), Pavol Rankov (Slovakkia), Helena Henschen (Rootsi)

  16. La moral de los superhéroes

    Directory of Open Access Journals (Sweden)

    Jhon Rozo Mila

    2015-12-01

    Full Text Available Los superhéroes, el deber moral y la obligación; El caso de Spider-Man y los X-Men. Laura Victoria Bolaño Pérez; Universidad del Rosario, colección Ópera Prima, Bogotá, 2012, 309 págs.

  17. Food for rumination : developing novel feeding strategies to improve the welfare of veal calves

    NARCIS (Netherlands)

    Webb, L.E.

    2014-01-01

    Summary of thesis entitled: “Food for Rumination – Developing novel feeding strategies to improve the welfare of veal calves”, Laura Webb

    Veal calves are typically fed high levels of milk replacer supplemented with solid feed, which tends to contain a relatively small roughage component.

  18. Cultivating Inquiry-Driven Learners: A College Education for the Twenty-First Century

    Science.gov (United States)

    Conrad, Clifton; Dunek, Laura

    2012-01-01

    Inquiry-driven learners anticipate, embrace, and adapt to disruptive change. Clifton Conrad and Laura Dunek advance a transformative purpose of a college education. They invite stakeholders from across higher education to engage in vigorous dialogue about the aims of a college education--and how to realize those aims. Increasingly influenced by…

  19. Klaasis on pinget / Reet Varblane ; kommenteerinud Kati Kerstna, Kairi Orgusaar

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    2009-01-01

    Klaasi kui (kunsti)materjali kasutamisest, mitmete erialade sümbioosist. Laura Mattioli Rossi, Rosa Barovier Mentasti ja Adriano Berengo kureeritud näitusest "Glass Stress" ("Klaasipinge") tänavusel Veneetsia biennaalil. Eesti klaasikunstist, Kai Koppeli eestvedamisel toimunud Haapsalu klaasipäevadest "Kasuta päeva"

  20. 75 FR 50748 - Marine Mammals; File No. 14514

    Science.gov (United States)

    2010-08-17

    ..., Silver Spring, MD 20910; phone (301) 713-2289; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th... INFORMATION CONTACT: Amy Sloan or Laura Morse, (301) 713- 2289. SUPPLEMENTARY INFORMATION: On May 3, 2010... Policy Act of 1969 (42 U.S.C. 4321 et seq.), a final determination has been made that the activity...

  1. 77 FR 45592 - Marine Mammals; File No. 17157

    Science.gov (United States)

    2012-08-01

    ..., Silver Spring, MD 20910; phone (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th... INFORMATION CONTACT: Laura Morse or Jennifer Skidmore, (301) 427-8401. SUPPLEMENTARY INFORMATION: On May 21... 1969 (42 U.S.C. 4321 et seq.), a final determination has been made that the activity proposed is...

  2. Diversity in the Workplace [in HRD].

    Science.gov (United States)

    1995

    These four papers are from a symposium that was facilitated by Laura Bierema at the 1995 conference of the Academy of Human Resource Development (HRD). "The Status of Valuing and Managing Diversity in Fortune 500 Manufacturing and Fortune 500 Service Organizations: Perceptions of Top Human Resource Professionals" (Sandra J. Johnson) reports a…

  3. Gombrowicz tra esilio e straduzione

    Directory of Open Access Journals (Sweden)

    Vera Horn

    2006-12-01

    Full Text Available L'esilio argentino dello scrittore polacco Witold Gombrowicz raccontato da Laura Pariani nel romanzo La straduzione; il tentativo di tradursi; il tentativo di tradurre il Ferdyduke in spagnolo e conquistare pubblico; critica e traduzione nel mondo argentino; la straduzione come fallimento.

  4. INHIBITION OF TOBACCO SMOKE-INDUCED LUNG INFLAMMATION BY A CATALYTIC ANTIOXIDANT

    Science.gov (United States)

    AMathematical Model for the Kinetics of the Male Reproductive Endocrine SystemLaura K. Potter1,2, H.A. Barton2 and R.W. Setzer21Curriculum in Toxicology, UNC-Chapel Hill, NC; 2US EPA, ORD, NHEERL, ETD, RTP, NCIn this presentation a model for the hormonal regul...

  5. PV Module Reliability Workshop | Photovoltaic Research | NREL

    Science.gov (United States)

    Gok, Cara Fagerholm, David M. Burns, Timothy J. Peshek, Laura S. Bruckman, Roger H. French Backsheet Chen, C. H. Hsueh, W. J. Hsieh Accurately Measuring PV Power Loss Due to Soiling-Michael Gostein and Walters, Stephen Barkaszi Tracking PV Changes: Bridging Between Thin-Film Cells and Modules-Russell

  6. Women Warriors: Why the Robotics Revolution Changes the Combat Equation

    Science.gov (United States)

    2016-03-01

    Secretary Leon Panetta and General Martin Dempsey, U.S. Department of Defense, “Elimination of the 1994 Direct Ground Combat Definition and Assignment... Feminism and International Relations, eds. J. Ann Tickner and Laura Sjoberg, (London: Routledge, 2011): 146 and 162. Photos Page 100. Photo by IDF

  7. Kampen om Kinas medier: Fri presse eller socialistisk propaganda

    DEFF Research Database (Denmark)

    Dombernowsky, Laura Møller

    2012-01-01

    Mens unge kinesere sætter deres lid til, at kommercielle medier vil øge den journalistiske frihed, råber kritikere vagt i gevær. De frygter, at de socialistiske idealer ryger i svinget. ANALYSE af Laura Dombernowsky, Beijing, Kina...

  8. Uudised

    Index Scriptorium Estoniae

    2007-01-01

    USAs Bostoni Berklee muusikakolledzhis tudeeriv Laura Põldvere annab Eestis kolm heliplaadi "Muusa" esitluskontserti (26. okt. Pärnu klubis Mirage). 28. nov. Tallinna linnahallis esinevast Rootsi popbändist Ace Of Base. Wembley staadionil hümne laulnud Hannahi heliplaat "Everything is Changing" sai Inglismaal kriitika osaliseks

  9. 77 FR 25013 - Notice To Rescind Notice of Intent To Prepare an Environmental Impact Statement; Mahoning and...

    Science.gov (United States)

    2012-04-26

    ... the EIS could be completed, the funding reality is such that the project could not be designed or... and Construction (A, B). Authority: 23 U.S.C. 315; 49 CFR 1.48. Issued on: April 16, 2012. Laura S...

  10. Eesti noor kunst Pariisis

    Index Scriptorium Estoniae

    2007-01-01

    Pariisis Montrouge'is 22. IX-12. X avatud rahvusvahelisel noorte kunstnike näirusel "Jeune creation europeenne / Euroopa noored loojad" näeb ka eesti kunstnike Maarit Murka, Alvar Reisneri, Jaanus Samma, Noolegrupi (Villem Jahu, Triinu Jürves, Harry Rull, Rannar Laur), Laura Kuuse, Helen Meleski, Marge Monko ja Reimo Võsa-Tangsoo töid. Kuraator Anneli Porri

  11. Caracterización ecológica de comunidades de microorganismos planctónicos marinos, basada en relaciones entre la distribución de tamaños, composición química y taxonomía

    OpenAIRE

    Arin, Laura

    2002-01-01

    Memoria de tesis doctoral presentada por Laura Arin Carrau para obtener el título de Doctora en Biología por la Universitat Autònoma de Barcelona (UAB), realizada bajo la dirección de la Dra. Marta Estrada Miyares del Institut de Ciències del Mar (ICM-CSIC).-- 176 pages

  12. The Double Bind for Women: Exploring the Gendered Nature of Turnaround Leadership in a Principal Preparation Program

    Science.gov (United States)

    Weiner, Jennie Miles; Burton, Laura J.

    2016-01-01

    In this study of nine participants in a turnaround principal preparation program, Jennie Miles Weiner and Laura J. Burton explore how gender role identity shaped participants' views of effective principal leadership and their place within it. The authors find that although female and male participants initially framed effective leadership…

  13. "Puhastuse" esimesed osatäitjad teada / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2011-01-01

    Eesti-Soome koostöös valmiva Antti Jokise filmis "Puhastus" mängib vana Aliidet Liisi Tandefelt, Aliidet nooruspäevil Laura Birn, Hansu Peter Franzén, Martinit Tommi Korpela, Aliide vanemaid Anne Reemann ja Elmo Nüganen

  14. Wangai et al., Afr. J. Infect. Dis. (2011) 5(1): 1 - 6 SENSITIVITY OF ...

    African Journals Online (AJOL)

    AJTCAM

    Wangai et al., Afr. J. Infect. Dis. (2011) 5(1): 1 - 6. 1. SENSITIVITY OF MICROSCOPY COMPARED TO MOLECULAR DIAGNOSIS OF P. FALCIPARUM: IMPLICATIONS ON MALARIA TREATMENT IN EPIDEMIC AREAS IN. KENYA. Laura Nyawira Wangai 1,2, Muriira Geoffrey Karau 3, Paul Nthakanio Njiruh 4, Omar Sabah 5 ...

  15. the Cecil John Adams Travelling Fellowship

    African Journals Online (AJOL)

    1994-09-14

    Sep 14, 1994 ... 1886 it boasted a coffee-shop, two chemists and a branch of the Standard Bank. ... him a son in 1898 but the infant died at the age of 6 months. By 1900 Florence ... By this time, he had married Laura Green. She was carrying ...

  16. Vabadussamba parimad ideed tulid tudengitelt / Garel Püüa

    Index Scriptorium Estoniae

    Püüa, Garel

    2007-01-01

    Tallinna Vabadussamba ideekonkursil teise koha saavutanud töö "Meie inimesed" keskendus moodsa linnaruumi loomisele (autorid Marten Kaevats, Mihkel Kaevats, Ülo Kaevats, Peeter Vihma, Merit Kask ja Martin Sookael), kolmanda koha töö "Illusioon" oli abstraktsem (autorid Martin Tago, Tõnis Malkov, Kertu Tuberg ja Laura Kuusk). Kommenteerib Ülar Mark

  17. Gerli Padar läheb Eurovisioonile. Eurolaulu valiti 1,3 miljoni miljoni eest

    Index Scriptorium Estoniae

    2007-01-01

    3. veebr. toimunud laulukonkursi Eurolaul 2007 võitis . Gerli Padar lauluga "Partners in Crime" (helilooja Hendrik Sal-Saller, sõnad Berit Veiber), teisele kohale jäi "Romeo ja Julia" Hele Kõre ja Kristjan Kasearu esituses, kolmandale Laura looga "Sunflowers". Telefonihääletusest ETV saates Eurolaul 2007

  18. Publications | Page 282 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Visit the IDRC Digital Library now. ... Use this search tool to locate a specific publication for your field of research. ... Panama's Darién National Park is the largest national park in Central America and a UNESCO ... Laura Dávila is back in school. ... Consider a Latin American worker who, at some point in the past, has taken.

  19. A Decision Support Model Using Life Cycle Cost (LCC) Analysis to Select Cost-Effective Alternatives for Hazardous Materials

    Science.gov (United States)

    1993-09-01

    AF89-071. Washington: GPO, 1989. 159 14. Diaz , SSgt Laura, 648 Med Sq/SGHL. Personal interview. Brooks AFB, San Antonio TX, 14 July 1993. 15. EA...Training Strateav of the Acauisition Management of Hazardous Materials Program. Draft Report. McLean VA, August 1991. 36. Moore, SSgt Alicia . AL/OEVP

  20. Inimene kronesteetilise kaameraga / Andreas W

    Index Scriptorium Estoniae

    Andreas W, pseud., 1969-

    2011-01-01

    Fotofilmifestival 14. oktoobril kinos Sõprus. Fotofilmist. Rahvusvahelisest fotofilmi konkursist "Ajatu lugu". Grand prix' pälvis Anu-Laura Tuttelberg, 2. koha Andri Allas ja Krõõt Tarkmeel, 3. koha Gerald Assouline (Prantsusmaa). Lühidalt festivalil näidatud Gusztáv Hámosi fotofilmidest (Saksamaa)