The Invention of the Jury in " The Auto Mary " by Ariano Suassuna
Directory of Open Access Journals (Sweden)
Ezilda Claudia de Melo
2016-06-01
Full Text Available It identified the intersections between the jury and literature , the "Auto da Compadecida " Ariano Suassuna . He embarked at the intersection field between law and Literary Arts to identify the characters, ritual and emotion in the jury of the show presented by him . The trial is the real key to understanding this work and is the intersection point of this research, with the law as it is intended to relate the institution of the jury from the buildings Ariano Suassuna . It was concluded that emotionality gives on the rationality of the jury.
Directory of Open Access Journals (Sweden)
Tereza Aline Pereira de Queiroz
1998-01-01
Full Text Available O artigo tem por objetivo discutir, a partir da análise das peças teatrais Auto da Compadecida, de Ariano Suassuna, e La Diestra de Dios Padre, de Enrico Buenaventura, a presença do imaginário medieval ibérico no continente americano.This article intends to discuss the maintenance of iberian medieval imaginaire in the american continent analysing the plays Auto da Compadecida by Ariano Suassuna and La Diestra de Dios Padre by Enrico Buenaventura.
Kuimet, Paul, 1984-
2016-01-01
Paul Kuimet, Dénes Kalev Farkas ja Laura Kuusk räägivad, kuidas valmisid nende kunstnikuraamatud ja mis oli projekti tõukejõuks. Paul Kuimeti fotoraamat "In Vicinity", Dénes Kalev Farkasi raamatud "Evident in Advance" ja "Credo", Laura Kuuse raamat "Pop-up-book"
Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, Bil
2009-01-01
This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintainability by eliminating the requirement for problem-dependent re-compilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multiphysics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the FUN3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU-standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.
Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, Bil
2009-01-01
This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintainability by eliminating the requirement for problem-dependent re-compilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multiphysics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the FUN3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU-standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.
Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Chirstopher O.; Kleb, Bil
2010-01-01
This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintainability by eliminating the requirement for problem-dependent re-compilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multi-physics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the FUN3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU-standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.
Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, William L.
2013-01-01
This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintain ability by eliminating the requirement for problem dependent recompilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multi-physics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the Fun3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.
Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, Bil
2011-01-01
This users manual provides in-depth information concerning installation and execution of Laura, version 5. Laura is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 Laura code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintainability by eliminating the requirement for problem dependent re-compilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multi-physics coupling. As a result, Laura now shares gas-physics modules, MPI modules, and other low-level modules with the Fun3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU-standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.
ACHP | News | Laura Bush Announces Preserve America Grants Budget
Search skip specific nav links Home arrow News arrow Laura Bush Announces Preserve America Grants Budget Laura Bush Announces Preserve America Grants Budget First Preserve America Communities Also Announced ) Jan. 15, 2004, Washington, DCÂMrs. Laura Bush announced today that the President's budget for FY 2005
2012 SARA Students Technical Report
International Nuclear Information System (INIS)
Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet
2012-01-01
The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of
2012 SARA Students Technical Report
Energy Technology Data Exchange (ETDEWEB)
Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory
2012-07-30
The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the
Laura Kallasvee ei aja kärbseid pähe / Laura Kallasvee ; intervjueerinud Margit Tõnson
Kallasvee, Laura, 1979-
2010-01-01
Laura Kallasvee fotostuudiost, postkaardiseeriast "Lubadused", raamatust "Toit. Kirg", digifotograafiast, inspiratsiooniallikatest, moefotode pildistamisest, ebaprofessionaalsusest visuaalses ruumis, fotogeenilisusest
Laura Ashley - lugu armastusest ja loomejõust
2008-01-01
Laura Ashley (1925-1985) edulugu. 1953. a. hakkasid Bernard ja Laura Ashley käsitsi trükkima tekstiile oma korteris Londonis. 1954. a. asutasid nad firma Ashley Mountney Limitied. 1957. a. importis firma oma toodangut Euroopasse, USA-sse ja Austraaliasse. 1977. a. sai L. Ashley Queen's Award for Export Achievement auhinna. Firma põhitegevuseks on saanud kodusisustamiseks vajalike tekstiilide tootmine
Laura: Soybean variety lacking Kunitz trypsin inhibitor
Directory of Open Access Journals (Sweden)
Srebrić Mirjana
2010-01-01
Full Text Available Grain of conventional soybean varieties requires heat processing to break down trypsin inhibitor's activity before using as food or animal feed. At the same time, protein denaturation and other qualitative changes occur in soybean grain, especially if the temperature of heating is not controlled. Two types of trypsin inhibitor were found in soybean grain the Kunitz trypsin inhibitor and the Bowman-Birk inhibitor. Mature grain of soybean Laura is lacking Kunitz trypsin inhibitor. Grain yield of variety Laura is equal to high yielding varieties from the maturity group I, where it belongs. Lacking of Kunitz-trypsin inhibitor makes soybean grain suitable for direct feeding in adult non ruminant animals without previous thermal processing. Grain of variety Laura can be processed for a shorter period of time than conventional soybeans. This way we save energy, and preserve valuable nutritional composition of soybean grain, which is of interest in industrial processing.
International Nuclear Information System (INIS)
Belmont, J.L.; Fruneau, M.; Martin, P.
1989-05-01
SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration
Interpreting the SARA and RCRA training requirements
International Nuclear Information System (INIS)
Moreland, W.M.; Wells, S.M.
1987-01-01
The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements
Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.
O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J
2008-04-01
Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.
System Analysis and Risk Assessment system (SARA) Version 4.0
International Nuclear Information System (INIS)
Sattison, M.B.; Russell, K.D.; Skinner, N.L.
1992-01-01
This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis
Laura Mariani, Sarah Bernhardt, Colette e l'arte del travestimento ...
African Journals Online (AJOL)
User
Laura Mariani, Sarah Bernhardt, Colette e l'arte del travestimento,. Bologna, Il Mulino, 1996. Anche questo secondo libro che Laura Mariani dedica alla storia delle attrici si svolge al confine tra storia del teatro e storia delle donne: un intreccio fertile di suggestioni e spunti teorici. Tema dell'indagine, condotta soprattutto ...
Põletavatest küsimustest / Laura Kuusk
Kuusk, Laura, 1982-
2007-01-01
Eesti Kunstiakadeemia magistrantide põlevkiviteemaline näitus "Depressioon" Rael Arteli galeriis Tartus kuni 4. veebruarini. Laura Pählapuu, Siiri Taimla, Risto Tali, Tõnu Narro, Alina Korsmiku ja Mikk Freibergi töödest
The relationship between SARA fractions and crude oil stability
Directory of Open Access Journals (Sweden)
Siavash Ashoori
2017-03-01
Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.
Fotograafid loevad ja tekstlevad / Laura Kuusk
Kuusk, Laura, 1982-
2008-01-01
Kollektiivne näituseprojekt "Minnes vastu lugejate soovidele" Tartu Linnaraamatukogu keldris tegutsevas Rael Artel Gallerys. Ühisnäitusel osalesid noored fotograafid Kristiina Hansen, Taaniel Raudsepp, Krõõt Tarkmeel ja Laura Toots ning projektiruumi moderaator Rael Artel
Layering of life (Sara novel of Peter Sarić
Directory of Open Access Journals (Sweden)
Kostić Dragomir J.
2015-01-01
Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safeguard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.
Wood, M. A.; Oswalt, T. D.; SARA Collaboration
2000-12-01
We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.
Gene : CBRC-SARA-01-1996 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL
Directory of Open Access Journals (Sweden)
Jessica N Snowden
Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.
Chevitarese, André Leonardo; Universidade Federal do Rio de Janeiro - UFRJ; Justi, Daniel Brasil; Universidade Federal do Rio de Janeiro
2017-01-01
Este trabalho pretende discutir que os teólogos alemães, comprometidos com a ideologia nazista, inclusive através do juramento de lealdade que fizeram ao Führer, não optaram pelo “silêncio virtual” nem demonstraram “um interesse limitado” pelo Jesus histórico. Muito pelo contrário, eles não apenas potencializaram o “retrato” de Jesus como sendo um ariano, como também o popularizaram, por meio de seus escritos, de suas homilias e de suas experiências cotidianas. Deve-se ter atenção aqui: a con...
Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi
Directory of Open Access Journals (Sweden)
M. Sidi Ritau'din
2017-06-01
Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.
Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)
DEFF Research Database (Denmark)
Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong
2014-01-01
at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...
ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN
Directory of Open Access Journals (Sweden)
Sulistyastuti Sutomo
2015-01-01
Full Text Available Not only does art have self-fullfillment, but it also has axiological benefits both socially, culturally, religiously, and economiclally. So does Sara Douda dance. Sara Douda aesthetics is first contained in its whole dance movements. In addition, it can also be found in the whole dance equipments. Moreover, this dance aesthetics may also be contained in the verbal symbols in the speech forms prior to the dance performance. However, both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and religious values in the Loli community about their honoring their ancestors, having social harmony, and highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance. Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda
"Operation Exhibition" - fotokunst uues valguses / Laura Lepp
Lepp, Laura
2011-01-01
Šotimaal Glasgow's 22.-27. aprillini avatud Ida-Euroopast pärit noorte fotograafide näitusest, mille korraldasid Glasgow' ülikoolis õppivad kunstiajaloo üliõpilased Laura Lepp (Eesti) ja Jevgenia Judova (Läti). Eestit esindavad näitusel Rene Suurkaev ja Marin Sild
Symbols and Sexual Perversion of Laura Wingfield in Tennesse Willimas’s The Glass Menagerie
Directory of Open Access Journals (Sweden)
Retnowati Retnowati
2015-07-01
Full Text Available The Glass Menagerie, a play written by Tennessee Williams, is full of symbols in which some of them refer to the sexual perversion in the character of the play such as Laura Wingfield. The research applied library research by taking data from the script of the play, then analysed based on the two theories, those were the theory of symbol and psychological theory called sexual perversions. The symbols in this play was analyzed, especially those related to Laura Wingfield. There were symbols like the glass collection, glass unicorn, blue roses, fire escape and Jim O’Connor which explained the sexual perversion of Laura Wingfield. These symbols were clues to understand the psycological problems suffered by Laura. It can be concluded that The cause of the strange sexual desire is because of her being abnormal because she is crippled and suffers from pleurosis.
System Analysis and Risk Assessment System (SARA), Version 4.0
International Nuclear Information System (INIS)
Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.
1992-02-01
This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs
User's Manual for the Langley Aerothermodynamic Upwind Relaxation Algorithm (LAURA)
Gnoffo, Peter A.; Cheatwood, F. McNeil
1996-01-01
This user's manual provides detailed instructions for the installation and the application of version 4.1 of the Langley Aerothermodynamic Upwind Relaxation Algorithm (LAURA). Also provides simulation of flow field in thermochemical nonequilibrium around vehicles traveling at hypersonic velocities through the atmosphere. Earlier versions of LAURA were predominantly research codes, and they had minimal (or no) documentation. This manual describes UNIX-based utilities for customizing the code for special applications that also minimize system resource requirements. The algorithm is reviewed, and the various program options are related to specific equations and variables in the theoretical development.
Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural
Directory of Open Access Journals (Sweden)
Tiara Kharisma
2017-12-01
Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.
77 FR 27253 - Proposed Collection, Laura Bush 21st Century Librarian Grant Program Evaluation
2012-05-09
... Century Librarian Grant Program Evaluation AGENCY: Institute of Museum and Library Services, National... evaluate and make improvements to the Laura Bush 21st Century Librarian (LB21) Grant Program. The... proposes clearance of the Laura Bush 21st Century Librarian Grant Program Evaluation. The 60-day Notice for...
Aastahitt 2008. Chalice "Supervõimed". Laura "Destiny" / Kallervo Karu
Karu, Kallervo
2009-01-01
Aastahitt 2008 valimisest (võitis Kerli Kõivu lugu "Walking on Air") ja kontserdist ETV ja Raadio 2 koostööna Tallinnas Club von Überblingenis. Heliplaadist. Laura Põldvere esitatavast eurolaulust
Building a story: myths and realities in the autobiography of Laura Orvieto
Directory of Open Access Journals (Sweden)
Caterina Del Vivo
2014-01-01
Full Text Available Laura Orvieto (Milan 1876 - Florence 1953, children’s writer, always loved telling stories. She asked everyone to tell her stories and, if she couldn’t find anyone available, she told stories to younger children. These stories were inspired by the many books she read and by the fairy tales told by old women. As an adult, once a writer, her most successful work was inspired by classical mythology and the small adventures of her own children. But in the second half of the 1930s many things changed for a family from the Florentine Jewish middle classes, with the increasing pressure of racial marginalization. In around 1936 Laura decided to abandon her usual themes, and instead to turn to her origins and tell her own story, and that of her husband Angiolo and their respective families. The Storia di Angiolo e Laura is written in a simple and direct style, close to Orvieto’s other work. But in the final pages she allows space for statements that illustrate her painful crisis of conscience. Today we can ask to what extent these pages reflect a real biographical journey: other sources complete, confirm or deny the events and states of mind expressed in the book. A parallel reading of a few chapters and other documents reveals less well-known aspects of the thinking and frame of mind of Laura and her family and illustrates her working methods. Received: 27/05/2013 / Accepted: 20/06/2013 How to reference this article Del Vivo, C. (2014. Costruirsi una storia: miti e realtà nell’autobiografia di Laura Orvieto. Espacio, Tiempo y Educación, 1(1, pp. 55-75. doi: http://dx.doi.org/10.14516/ete.2014.001.001.003
System Analysis and Risk Assessment (SARA) system
International Nuclear Information System (INIS)
Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.
1986-01-01
Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable
Concurrent software system design supported by SARA at the age of one
Energy Technology Data Exchange (ETDEWEB)
Campos, I.M.; Estrin, G.
A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.
Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning
Thomas, S. M.; Su, Y. C.; Hummel, P. R.
2016-12-01
Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance
Kus lõpeb maastik? / Laura Põld ; intervjueerinud Kristel Schwede
Põld, Laura, 1984-
2013-01-01
Viinis tegutseva eesti kunstniku Laura Põllu loomingulisest teekonnast, kunstiprojektidest "Katse lavastada maastikku" (Tallinna Kunstihoone galerii, 31.05.-23.06.2013) ja "Das Ende der Landschaft, das Ende der Stadt" (Galerie Gut Gasteil, Prigglitz, Austria, 27.04.-16.06.2013)
SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS
International Nuclear Information System (INIS)
Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.
2015-01-01
SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index
The erudite humility of the historian: the 'critical epistemology' of Georges Lantéri-Laura.
Basso Lorini, Elisabetta
2017-06-01
This paper analyses the historical and epistemological work of the French psychiatrist Georges Lantéri-Laura (1930-2004) within the context of the French 'tradition' of history and philosophy of sciences, with special reference to Georges Canguilhem and Michel Foucault. After an introduction devoted to a critical survey of the most recent works on the history and historiography of psychiatry in French, the paper outlines Lantéri-Laura's approach by focusing especially on the role played by the methodological concept of 'semiology' as regards the relation between medicine and psychiatry. The last part of the paper draws attention to the relation between the history and philosophy of psychiatry in light of Lantéri-Laura's 'critical epistemology'.
Directory of Open Access Journals (Sweden)
Mohammad Supriyadi
2015-12-01
Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.
NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...
Laura Laur, personnage hologramme. De l'intersubjectivité dans la littérature
Directory of Open Access Journals (Sweden)
Isabelle Boisclair
2015-01-01
Full Text Available La construction particulière de Laura Laur, de Suzanne Jacob (1983, effaçant la voix du personnage principal au profit de quatre personnages de son entourage (deux frères et deux amants, est ici prise en exemple pour aborder l’intersubjectivité, selon laquelle tout échange entre deux sujets participe à la production des subjectivités de chacun d’entre eux. Compte tenu du sexe des instances narratives (ce sont quatre hommes qui dessinent, depuis leurs positions respectives, une femme, est aussi considérée la dimension genrée du travail des rapports intersubjectifs dans la constitution du soi. Laura Laur apparaît ainsi comme un hologramme trahissant les attentes des uns et des autres envers le féminin. The singular construction of Suzanne Jacob’s Laura Laur (1983, which effaces the voice of the main character in favour of that of four characters from her entourage (two brothers and two lovers is taken here as an example for approaching intersubjectivity, an approach according to which every exchange between two subjects contributes to the production of their subjectivity. Taking into account the sex of the narrative instances (four men depicting a woman from their various perspectives, the gendered dimension of the role of intersubjective relations in the constitution of the self is also considered. Laura Laur then appears as a hologram that betrays the various expectations associated with the feminine.
NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...
Directory of Open Access Journals (Sweden)
X. Y. Jiang
2014-08-01
Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.
NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...
arXiv Laura++ : a Dalitz plot fitter
Back, John; Harrison, Paul; Latham, Thomas; O'Hanlon, Daniel; Qian, Wenbin; del Amo Sanchez, Pablo; Craik, Daniel; Ilic, Jelena; Otalora Goicochea, Juan; Puccio, Eugenia; Silva Coutinho, Rafael; Whitehead, Mark
The Dalitz plot analysis technique has become an increasingly important method in heavy flavour physics. The Laura++ fitter has been developed as a flexible tool that can be used for Dalitz plot analyses in different experimental environments. Explicitly designed for three-body decays of heavy-flavoured mesons to spinless final state particles, it is optimised in order to describe all possible resonant or nonresonant contributions, and to accommodate possible CP violation effects.
NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...
Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion
Energy Technology Data Exchange (ETDEWEB)
Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS
2009-07-01
Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench
Calculations for the design and modification of the 2 cyclotrons of S.A.R.A
International Nuclear Information System (INIS)
Albrand, P.S.; Belmont, J.L.; Ripouteau, F.
1983-09-01
S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron
Zhao, Bryan M; Hoffmann, F Michael
2006-09-01
Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.
NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...
Wood, M. A.
2003-12-01
The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.
SarA is a negative regulator of Staphylococcus epidermidis biofilm formation
DEFF Research Database (Denmark)
Martin, Christer; Heinze, C.; Busch, M.
2012-01-01
Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...
NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...
Ground-water resources of the Laura area, Majuro Atoll, Marshall Islands
Hamlin, S.N.; Anthony, S.S.
1987-01-01
The water system that supplies the heavily populated Dalap-Uliga-Darrit (DUD) area of Majuro atoll, Marshall Island, relies almost entirely upon airstrip catchment of rain water. Droughts cause severe water supply problems and water rationing is required, even during periods of normal rainfall. The Laura area contains a substantial lens of fresh groundwater that could be developed for export to the DUD area 30 mi to the east. Study of the groundwater resource at Laura involved a survey of existing wells, installation of monitoring wells and test holes, compilation of continuous records of rainfall and water level fluctuations, and collection of water quality data. Test hole data permitted the definition of three geohydrologic units which correlate well with similar units in Bikini and Enewetak atolls. The units consist of two layers of unconsolidated reef and lagoon sediments resting on a dense, highly permeable limestone. The potable water zone, or freshwater nucleus, of the lens is contained mostly within the unconsolidated layers, which are much less permeable than the basal limestone. Recharge to the Laura freshwater lens is estimated to be 1.8 mil gal/day, based on an average annual rainfall of 140 in. Sustainable yield is estimated to be about 400,000 gal/day. Shallow skimming wells or infiltration galleries similar to those used on Kwajalein atoll would be appropriate to develop the freshwater lens. The impact of development on the lens can be determined by monitoring the salinity in developed water and in a network of monitor wells. (Author 's abstract)
Frize, Monique
2013-01-01
This book presents the extraordinary story of a Bolognese woman of the settecento. Laura Maria Caterina Bassi (1711-1778) defended 49 Theses at the University of Bologna on April 17, 1732 and was awarded a doctoral degree on May 12 of the same year. Three weeks before her defense, she was made a member of the Academy of Sciences in Bologna. On June 27 she defended 12 additional Theses. Several of the 61 Theses were on physics and other science topics. Laura was drawn by the philosophy of Newton at a time when most scientists in Europe were still focused on Descartes and Galen. This last set of Theses was to encourage the University of Bologna to provide a lectureship to Laura, which they did on October 29, 1732. Although quite famous in her day, Laura Bassi is unfortunately not remembered much today. This book presents Bassi within the context of the century when she lived and worked, an era where no women could attend university anywhere in the world, and even less become a professor or a member of an academ...
Directory of Open Access Journals (Sweden)
Jorge A. Orrego-Ruiz
2014-06-01
Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...
The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)
Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.
2017-01-01
We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.
Directory of Open Access Journals (Sweden)
Fredy Alberto Reyes
2012-06-01
Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p
Gender Transformations and Colonial Displacements in Laura Antillano's "Tuna de mar"
Reid, Alana
2015-01-01
This paper examines the trajectories of two characters in Laura Antillano's short story, "Tuna de mar" (1991), as they navigate interrelated systems of power and attempt to position themselves closer to, or further away from, the margins. Set in the late eighteenth century, the tale features a female protagonist who escapes prostitution…
Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy
2011-09-01
The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.
Directory of Open Access Journals (Sweden)
P. Balamurugan
2017-07-01
Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.
Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows
DEFF Research Database (Denmark)
Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.
2015-01-01
BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...
Transferring generic SARA/OSHA training to US Department of Energy facilities
International Nuclear Information System (INIS)
White, A.; McKinley, T.
1989-01-01
The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs
Trouble makers : Laura Poitras and the problem of dissent
Danchev, Alex
2015-01-01
This review article considers three works by the distinguished documentary film-maker Laura Poitras: My country, my country (2006); The oath (2010); and the recently released Citizenfour (2014), focusing on the whistle-blower Edward Snowden. Poitras describes these works as a trilogy about American power after 9/11, but they are also about disobedience and resistance, or the problem of dissent. The article argues for the significance (and the virtue) of Poitras's project, as film maker and tr...
Rakesh K. Kapania named Norris and Laura Mitchell Professor of Aerospace Engineering
Crumbley, Liz
2008-01-01
Rakesh K. Kapania, a professor in the Department of Aerospace and Ocean Engineering in the College of Engineering at Virginia Tech, was appointed the Norris and Laura Mitchell Professor of Aerospace Engineering by the Virginia Tech Board of Visitors during the board's quarterly meeting March 31.
NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...
SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization
Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.
2018-05-01
Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.
NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w
DA POÉTICA DO ENGAJAMENTO NA LITERATURA POLICIAL DE LAURA LIPPMAN
Directory of Open Access Journals (Sweden)
Isabella Santos Mundim
2013-04-01
Full Text Available Este artigo propõe investigar como se dá a relação da literatura policial de Laura Lippman com um projeto ético determinado. Com base na leitura de obras selecionadas, pretende-se analisar como essa autora se vale da inventividade da linguagem para traduzir, em narrativa, o fenômeno da violência e a falência das instituições.
DEFF Research Database (Denmark)
Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette
2017-01-01
The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...
Directory of Open Access Journals (Sweden)
Grit Grigoleit
2011-03-01
Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.
Teaching Laura Kipnis's "Love's Labors" in "Ways of Reading"
Fike, Matthew A.
2013-01-01
This essay describes a method of teaching a very challenging anthology piece: Laura Kipnis's "Love's Labors" (chapter 1 of her 2003 "Against Love: A Polemic"). The method, although designed for a critical thinking course, should also provide resources for those who teach Kipnis's work in writing courses. Using…
Layering of life (Sara novel of Peter Sarić)
Kostić, Dragomir J.
2015-01-01
Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...
NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
Directory of Open Access Journals (Sweden)
Tirshem Kumar Kaushik
2015-05-01
Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.
Unusta, säilita, mäleta : kunstnikud materialiseerivad mälu / Laura Põld
Põld, Laura, 1984-
2015-01-01
Rahvusvaheline näitus "Tracing the Memory" Vaal galeriis 17. detsembrist 2014 kuni 17. jaanuarini 2015, kuraatorid Annika Toots ja Slavomira Ondrušová. Eksponeeriti Daniela Krajčová, Jan Nálevka, Katarina Poliačiková, Laura Tootsi ja Milan Vagač'i installatsioone. Kunstnike eluloolisi andmeid
Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010
Beaulé, Sophie
2014-01-01
With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...
Directory of Open Access Journals (Sweden)
Abdullah K. Shehabat
2016-09-01
Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.
Digital Repository Service at National Institute of Oceanography (India)
Panampunnayil, S.U.
on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...
A simple blowdown code for SUPER-SARA loop conditions
International Nuclear Information System (INIS)
Fritz, G.
1981-01-01
The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section
NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic
Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility
International Nuclear Information System (INIS)
Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.
1995-01-01
Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs
Directory of Open Access Journals (Sweden)
Eva Parrondo Coppel
2016-11-01
Full Text Available «Placer visual y cine narrativo», de Laura Mulvey (Screen, 1975, es un artículo nuclear en la configuración de la teoría feminista del cine y su notable influencia ha excedido este ámbito teórico. En el presente trabajo historiográfico nos proponemos realizar una lectura crítica del mismo a la luz de la creciente institucionalización del feminismo a partir de la década de 1980. Para ello nos aproximamos a este texto clásico desde tres ángulos interrelacionados: su contexto histórico, su con-texto teórico y la cuestión de las premisas metodológicas sobre las que se sostiene. En la primera parte de este trabajo, situamos «Placer visual y cine narrativo» en el contexto del movimiento feminista británico post-mayo del 68, el cual se caracterizó por el antagonismo entre las feministas funcionalistas, las marxistas-culturalistas y las psicoanalíticas. Asimismo, nos ocupamos de los primeros textos psicoanalíticos de la teoría feminista del cine, escritos por Claire Johnston y Pam Cook (1973-1975, frente a los cuales Mulvey se posiciona en su artículo. Por medio de esta doble contextualización proponemos, en la segunda parte, que si bien Mulvey dice utilizar el psicoanálisis y, de hecho, hace un amplio uso de terminología psicoanalítica, las bases conceptuales de «Placer visual y cine narrativo» son realmente sociológicas, lo cual (tal y como concluimos es sobre todo palpable en su particular combate contra el Inconsciente, piedra angular del psicoanálisis.Palabras clave: teoría del cine, feminismo, historiografía, Inconsciente, Laura Mulvey, Claire Johnston, Pam Cook.AbstractLaura Mulvey’s «Visual Pleasure and narrative Cinema» (Screen, 1975 is a key essay in the configuration of feminist film theory and its outstanding influence has exceeded this theoretical field. The aim of this historiographical paper is to undertake a critical reading of it in the light of the increasing institucionalization of feminism from
International Nuclear Information System (INIS)
Sattison, M.B.; Russell, K.D.; Skinner, N.L.
1994-07-01
The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities
Tõhk, Laura
2006-01-01
Saaremaa Ühisgümnasiumi abituriendid Laura Tõhk ja Marili Pärtel pälvisid oma filmiga "Fallen Angel" Rakveres toimunud noorte filmipäevadel parima dokumentaalfilmi ja Pärnu rahvusvahelise dokumentaal- ja antropoloogiafilmide festivali tunnustuse
NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens
NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed
Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow
Fletcher, Jack M.; Morris, Robin D.
2014-01-01
Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…
Una musa de la modernidad: Laura Méndez de Cuenca (1853-1928
Directory of Open Access Journals (Sweden)
Mílada Bazant
2013-01-01
Full Text Available Este trabajo aborda la trayectoria biográfica, magisterial y literaria de una de las primeras feministas de México, Laura Méndez de Cuenca. Mujer liberal y moderna, madre soltera, quien se atrevió a transgredir las normas sociales católicas de su tiempo y vivió una vida libre, pagando un precio muy alto por esa libertad. Su legado de 2000 páginas es un tratado de educación y un compendio literario de todos los géneros.
Una musa de la modernidad: Laura Méndez de Cuenca (1853-1928)
Mílada Bazant
2013-01-01
Este trabajo aborda la trayectoria biográfica, magisterial y literaria de una de las primeras feministas de México, Laura Méndez de Cuenca. Mujer liberal y moderna, madre soltera, quien se atrevió a transgredir las normas sociales católicas de su tiempo y vivió una vida libre, pagando un precio muy alto por esa libertad. Su legado de 2000 páginas es un tratado de educación y un compendio literario de todos los géneros.
Laura Jensen. Patriots, Settlers and the Origins of American Social Policy.
Directory of Open Access Journals (Sweden)
Evelyne Thévenard
2006-04-01
Full Text Available Dans son ouvrage sur les origines de l’Etat-Providence aux Etats-Unis, Laura Jensen réfute la thèse de l’historiographie classique, qui privilégie le New Deal et la Great Society dans le processus d’élaboration de la protection sociale américaine. Mais surtout, elle s’applique à démontrer que, contrairement à la thèse de Theda Skocpol (Protecting Soldiers and Mothers, les droits sociaux et leur contribution à la construction de la nation et à la définition de la citoyenneté ne datent pas des...
Directory of Open Access Journals (Sweden)
Iserhard, C. A.
2010-01-01
Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.
Combined LAURA-UPS solution procedure for chemically-reacting flows. M.S. Thesis
Wood, William A.
1994-01-01
A new procedure seeks to combine the thin-layer Navier-Stokes solver LAURA with the parabolized Navier-Stokes solver UPS for the aerothermodynamic solution of chemically-reacting air flowfields. The interface protocol is presented and the method is applied to two slender, blunted shapes. Both axisymmetric and three dimensional solutions are included with surface pressure and heat transfer comparisons between the present method and previously published results. The case of Mach 25 flow over an axisymmetric six degree sphere-cone with a noncatalytic wall is considered to 100 nose radii. A stability bound on the marching step size was observed with this case and is attributed to chemistry effects resulting from the noncatalytic wall boundary condition. A second case with Mach 28 flow over a sphere-cone-cylinder-flare configuration is computed at both two and five degree angles of attack with a fully-catalytic wall. Surface pressures are seen to be within five percent with the present method compared to the baseline LAURA solution and heat transfers are within 10 percent. The effect of grid resolution is investigated and the nonequilibrium results are compared with a perfect gas solution, showing that while the surface pressure is relatively unchanged by the inclusion of reacting chemistry the nonequilibrium heating is 25 percent higher. The procedure demonstrates significant, order of magnitude reductions in solution time and required memory for the three dimensional case over an all thin-layer Navier-Stokes solution.
Russo, Emilio; Mumoli,Laura; Palleria,Caterina; Gasparini,Sara; Citraro,Rita; Labate,Angelo; Ferlazzo,Edoardo; Gambardella,Antonio; De Sarro,Giovambattista
2015-01-01
Laura Mumoli,1 Caterina Palleria,2 Sara Gasparini,1 Rita Citraro,2 Angelo Labate,1 Edoardo Ferlazzo,1 Antonio Gambardella,1 Giovambattista De Sarro,2 Emilio Russo2 1Institute of Neurology, 2Institute of Pharmacology, University Magna Græcia, Catanzaro, Italy Abstract: Brivaracetam (BRV), a high-affinity synaptic vesicle protein 2A ligand, reported to be 10–30-fold more potent than levetiracetam (LEV), is highly effective in a wide range of experimental models of focal an...
Directory of Open Access Journals (Sweden)
John M Morrison
2012-03-01
Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.
Venkataraman, Rohini; Yusuf, Kamran
2017-01-01
Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.
Severe accident recriticality analyses (SARA)
Energy Technology Data Exchange (ETDEWEB)
Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H
2001-11-01
Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated
Severe accident recriticality analyses (SARA)
International Nuclear Information System (INIS)
Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.
2001-01-01
Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady
Creation and (Re)presentation of Historical Discourse in Isle of Passion by Laura Restrepo
Daniela Melis
2011-01-01
Published in Colombia in 1989, but neglected until the author’s later distinction, Laura Restrepo’s first novel, Isle of Passion , focuses on historical facts, as well as on the issues that arise when the impact of events is articulated in official discourse. This study—drawing from Walter Mignolo’s idea of decolonial theory—explores how Restrepo’s attempt to rewrite history following “an-other logic, an-other language, an-other thinking” contributes to the decolonization of knowledge, being...
Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow
Fletcher, Jack M.; Morris, Robin D.
2014-01-01
Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...
Goldrick-Rab, Sara; Kelly, Andrew P.
2016-01-01
In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…
Severe Accident Recriticality Analyses (SARA)
Energy Technology Data Exchange (ETDEWEB)
Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)
1999-11-01
Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding
Severe Accident Recriticality Analyses (SARA)
International Nuclear Information System (INIS)
Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.
1999-11-01
Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding
Directory of Open Access Journals (Sweden)
R. Ortiz
2017-09-01
Full Text Available The leaching tower is located in the Santa Laura saltpeter works office in Chile. In recent years studies have been carried out, using Non Destructive Techniques (TND, which have determined that the tower is in good condition. However, there are doubts regarding the actual dimensions of the construction elements affected by the desfibration. The present study had the objective of evaluate defibred wood elements, from the leaching tower of the Santa Laura saltpeter works office, using the resistography technique. Additional studies of ultrasound and xylohigrometry were also developed. The obtained results establish that the reduction of the dimensions of the evaluated elements does not present significant difference and that there are no deep damages in the woods. The study confirms that the building is not at risk.
Averis, Kate
2016-01-01
This article explores and analyses the representation of violence in contemporary Colombian culture. Violence has come to characterise Colombian society since the onset of the current armed conflict, with devastating consequences for its population. Within this context, this article examines tendencies in contemporary literary representations of violence, with a focus on La multitud errante (2001) by Laura Restrepo, one of Colombia’s foremost writers. It begins with an outline of the origins ...
Autoficción y trabajo de memoria en La casa de los conejos de Laura Alcoba
Directory of Open Access Journals (Sweden)
Bruno Ragazzi
2014-02-01
Full Text Available The article explores discursive representations within the field of memory in La casa de los conejos by Laura Alcoba. The choice of autofiction as a genre allows discovering new mnemic narratives around the unequal confrontation between Montoneros and right-wing repressive forces. These novel ways of viewing the past are connected to what Ricoeur has called “work of memory”, a therapeutic elaboration on memory that enables a community to reach hope and forgiveness.
Sara, a patient with borderline personality structure: A "crisis" management
Directory of Open Access Journals (Sweden)
Paola Marinelli
2015-05-01
Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma.
Worthen, Helena Harlow
2012-01-01
The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…
Puertas, Mario Munoz
2016-01-01
En esta tesis analizo La isla de la pasión de Laura Restrepo cimentando mi cuadro argumentativo, esencialmente, en conceptos teóricos de narratología (Gérard Genette), de historiografía (Hayden White) y de la Teoría Decolonial (Enrique Dussel, Walter Mignolo y Aníbal Quijano). El objetivo de la presente investigación es analizar si la novela La isla de la pasión (1989), de Laura Restrepo, corresponde a una utopía novelada o una historia ficcional perteneciente a la modernidad, colonialismo y ...
Directory of Open Access Journals (Sweden)
Diego O Andrey
Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.
Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia
Directory of Open Access Journals (Sweden)
Tjitske F. Lawerman
2017-12-01
Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced
Husband, Judith
2013-05-01
Judith Husband speaks to the BDJ about current challenges facing dentistry, the new BDA PEC and her love of social media site Twitter. The only catch is she has accepted the challenge issued by interviewer and fellow Twitter enthusiast Laura Pacey of answering every question, in 140 characters or less. Follow on Twitter @Judith_Husband and @The_BDJ.
International Nuclear Information System (INIS)
Bouldjedri, A.
1992-06-01
This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements
SAPHIRE technical reference manual: IRRAS/SARA Version 4.0
International Nuclear Information System (INIS)
Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.
1993-01-01
This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix
Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.
2018-04-01
The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.
Escribiendo el silencio: la contemplación poética de Sara Pujol
Directory of Open Access Journals (Sweden)
Gala, Candelas
2005-06-01
Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.
Os suínos da raça Bísara – oportunidades e desafios
Carvalho, Marieta
2015-01-01
A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...
Shatz, Marilyn
1994-01-01
Jeni Yamada's "Laura" and Michael Tomasello's "First Verbs" continue a tradition of providing useful information on the language ability of individuals in a depth rarely found in multisubject studies; however, these efforts are unusual for case studies in that both take strong theoretical positions on the essence of language and language learning.…
Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility
International Nuclear Information System (INIS)
Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.
1994-11-01
The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)
Language’s Configurations in La casa de los conejos by Laura Alcoba
Directory of Open Access Journals (Sweden)
Estefanía Luján Di Meglio
2018-01-01
Full Text Available This article studies a novel written in the argentinean posdictatorship, in French, La casa de los conejos (2007 by Laura Alcoba. The main concept of the paper is the mother and second tongue and its multiples links with the history –the history of state violence– that novel relates. First of all, it is studied the fact that text is written in French in spite of author’s mother tongue is Spanish: Alcoba had to go into exile during the period of the “Triple A” in Argentina. In second place, it is observed that beyond this fact, there are several words written in Spanish. Such words work as metonymy of a whole language (Spanish, as a symbol of a history (the state terrorism and at the same time, they work as a metonymy of posdictatorship argentinean literature: those words represent the capital fact to telling a history in another way of that one of the oficial history.
Godwin, Allison; Potvin, Geoff
2017-01-01
This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…
Reading Sara Pujol Russell’s Poetry of Contemplation and Connection
Directory of Open Access Journals (Sweden)
Anita M. Hart
2012-06-01
Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.
Autoficción y trabajo de memoria en La casa de los conejos de Laura Alcoba
Directory of Open Access Journals (Sweden)
Bruno Ragazzi
2013-11-01
Full Text Available Este artículo se propone indagar acerca de las representaciones discursivas en el campo de memoria que se presentan en La casa de los conejos de Laura Alcoba. Se cree que la elección del género de la autoficción es una herramienta genérica que permite descubrir nuevas narrativas mnémicas en torno al enfrentamiento desigual entre Montoneros y las fuerzas represivas de la derecha. Estas novedosas maneras de ver el pasado se vinculan con lo que Ricoeur ha denominado “trabajo de memoria”, una elaboración terapéutica sobre el recuerdo que permite a un pueblo abrirse hacia la esperanza y el perdón.
Abdullah K. Shehabat
2016-01-01
This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...
International Nuclear Information System (INIS)
Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan
2013-01-01
Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques
DEFF Research Database (Denmark)
Christner, Martin; Heinze, Constanze; Busch, Michael
2012-01-01
to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...
Mujeres militantes en el movimiento de Derechos Humanos de Argentina. El caso Tucumán
Directory of Open Access Journals (Sweden)
Rubén Isidoro Kotler
2008-09-01
Full Text Available Cet article analyse quelques caractéristiques de mouvements défenseurs des Droits de l'Homme dans la province de Tucuman (Argentine en mettant en exergue le militantisme des femmes dans ces organisations à partir de témoignages de : Laura Figueroa, avocate des Droits de l'Homme pour « l'Asociación de abogados por los derechos humanos », une organisation qui avait une petite mais intense participation au cours des premières années de transition vers la démocratie ; Sara Mrad, la principale leader de "Madres...mayo" dans la région de Tucuman, depuis 1981 jusqu'à nos jours ; Angela Nassif, la dirigeante historique du Parti Communiste Révolutionnaire dans la région du Tucuman et l’une des fondatrices de « l'Asamblea por los Derechos Humanos » dans cette province en 1984, et enfin Josefina Centurión, militante au H.I.JO.S Tucuman.El artículo pretende analizar algunas de las características del movimiento de derechos humanos de Tucumán, destacando la participación femenina en estas organizaciones a partir del testimonio de cuatro militantes : Laura Figueroa, abogada por los derechos humanos y ex miembro de la Asociación de Abogados por los derechos humanos, organización que tuvo una breve pero intensa vida en la transición democrática en la provincia de Tucumán ; Sara Mrad, referente del movimiento de Madres de Plaza de Mayo filial Tucumán desde los comienzos de la agrupación en 1981 hasta la actualidad ; Ángela Nassif, histórica dirigente del Partido Comunista Revolucionario y quien fuera una de las fundadoras de la Asamblea Permanente por los Derechos Humanos en Tucumán en 1984 ; y finalmente Josefina Centurión, activa militante en la organización H.I.J.O.S. en Tucumán.This paper aims to analyze some characteristics of de Human Right movement of Tucumán (Argentina stressing the militancy of women in those organizations, based on the testimonies of: Laura Figueroa, Lawyer of Human Right causes and
Sedimentary facies and Holocene depositional processes of Laura Island, Majuro Atoll
Yasukochi, Toru; Kayanne, Hajime; Yamaguchi, Toru; Yamano, Hiroya
2014-10-01
The depositional processes that formed Laura Island, Majuro Atoll, Marshall Islands, were reconstructed based on a facies analysis of island sediments and spine ratios, and radiocarbon ages of foraminifera. Sedimentary facies were analyzed from trenches and drill cores excavated on the island and its adjacent reef flat. Depositional ages were obtained using benthic foraminifera (Calcarina) whose spines had not been abraded. The facies were classified into two types: gravelly and sandy. The initial sediments of these sites consisted of gravelly facies in the lower horizon and sandy facies in the upper horizon. Their ages were approximately 2000 cal BP and coincident with the onset of a 1.1-m decline in regional relative sea level, which enabled deposition of the gravelly facies. Half of the sand fraction of the sediment was composed of larger benthic foraminifera. The spine ratio showed that their supply source on the reef flat was located oceanside of the island. The supply source appears to have been caused by the relative sea-level fall. This indicates that the studied island was formed by a relative reduction in wave energy and enhanced foraminiferal supply, both of which were triggered by the late Holocene relative sea-level fall.
Quantum walks, deformed relativity and Hopf algebra symmetries.
Bisio, Alessandro; D'Ariano, Giacomo Mauro; Perinotti, Paolo
2016-05-28
We show how the Weyl quantum walk derived from principles in D'Ariano & Perinotti (D'Ariano & Perinotti 2014Phys. Rev. A90, 062106. (doi:10.1103/PhysRevA.90.062106)), enjoying a nonlinear Lorentz symmetry of dynamics, allows one to introduce Hopf algebras for position and momentum of the emerging particle. We focus on two special models of Hopf algebras-the usual Poincaré and theκ-Poincaré algebras. © 2016 The Author(s).
TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training
Energy Technology Data Exchange (ETDEWEB)
1989-03-01
This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.
Social humanoid robot SARA: development of the wrist mechanism
Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.
2018-01-01
This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.
Ortiz, R.; Jamet, A.; Moya, A.; González, M.; Varela, M. Paz; Hernández, M.; Fuentes, R.; Díaz, P.; Navarrete, J.
2015-01-01
La oficina salitrera Santa Laura, que es actualmente el lugar donde se mantiene la infraestructura industrial más completa del periodo del procesamiento del salitre, posee una Torre de Lixiviación que es considerada, por su singularidad, el ícono de la otrora industria salitrera en Chile. Esta impresionante estructura, construida casi en su totalidad con madera de Pino Oregón (Pseudotsuga menziesii) y elementos metálicos en sus uniones, sobrelleva desafortunadamente, después del cese del proc...
The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters
International Nuclear Information System (INIS)
Iazzourene, F.
1982-01-01
The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr
Directory of Open Access Journals (Sweden)
Anson Koch-Rein
2012-02-01
Full Text Available Laura Adamietz präsentiert in ihrer Dissertation eine präzise Analyse deutschen und internationalen Antidiskriminierungsrechts und bestehender Rechtsprechung in Sachen Geschlecht, sexuelle Orientierung und Geschlechtsidentität. Verbunden wird dies mit einem – nicht nur für ein juristisches Publikum lohnenden – Überblick über einschlägige, aber in der gängigen Rechtsauslegung unzureichend berücksichtigte geschlechterwissenschaftliche Erkenntnisse. Auf dieser Grundlage entwickelt die Autorin eine Auslegung des antidiskriminierungsrechtlichen Begriffs ‚Geschlecht‘ als „Geschlecht als Erwartung“, wodurch dieser gleichzeitig Komplexität und Anwendbarkeit gewinnt. Die Verbindung von theoretischer Sorgfalt, interdisziplinärer Perspektive und Lösungsorientierung ist ein zentrales Verdienst dieses Buches.Laura Adamietz’s dissertation presents a precise analysis of German and international anti-discrimination law and established jurisdiction regarding gender, sexual orientation, and gender identity. This is combined with an overview of pertinent, yet in current legal interpretation insufficiently considered, findings of gender studies, which is not only valuable for a legal readership. On this basis, the author develops an interpretation of the anti-discrimination juridical term ‘gender’ as “gender as expectation”, which adds both complexity and applicability to it. The combination of theoretical accuracy, interdisciplinary perspective, and solution orientation is a central merit of this book.
Instructional materials for SARA/OSHA training. Volume 1, General site working training
Energy Technology Data Exchange (ETDEWEB)
Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)
1988-04-01
This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.
Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts
Directory of Open Access Journals (Sweden)
Arina LUNGU-CIRSTEA
2011-03-01
Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff
Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer
Directory of Open Access Journals (Sweden)
Helena López
2013-07-01
Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.
A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta
Carvalho, Marieta
2014-01-01
A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...
Análise SWOT global da exploração dos suínos da raça Bísara
Carvalho, Marieta
2015-01-01
A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...
Creation and (Representation of Historical Discourse in Isle of Passion by Laura Restrepo
Directory of Open Access Journals (Sweden)
Daniela Melis
2011-06-01
Full Text Available Published in Colombia in 1989, but neglected until the author’s later distinction, Laura Restrepo’s first novel, Isle of Passion , focuses on historical facts, as well as on the issues that arise when the impact of events is articulated in official discourse. This study—drawing from Walter Mignolo’s idea of decolonial theory—explores how Restrepo’s attempt to rewrite history following “an-other logic, an-other language, an-other thinking” contributes to the decolonization of knowledge, being, community interests, and cultural heritage. The novel’s plot centers on a minor event in international history: the territorial dispute over the island of Clipperton, which was encountered by an English pirate escaping the Spaniards in the 1700’s, claimed by the Mexicans for its geographical proximity, owned (since 1930 by the French, and occasionally disputed by the English and US governments. Writing while personally experiencing the trauma of exile, Restrepo narrates the forgotten story of the Mexican soldiers—deployed with their families to defend the island—as a metaphor of marginalization. Clipperton, therefore, represents not only a geographical, but also a historical entity. This reading of Isle of Passion describes how its creative dis-order recovers a chapter of national history, finally retold by its silenced protagonists.
Isotropic quantum walks on lattices and the Weyl equation
D'Ariano, Giacomo Mauro; Erba, Marco; Perinotti, Paolo
2017-12-01
We present a thorough classification of the isotropic quantum walks on lattices of dimension d =1 ,2 ,3 with a coin system of dimension s =2 . For d =3 there exist two isotropic walks, namely, the Weyl quantum walks presented in the work of D'Ariano and Perinotti [G. M. D'Ariano and P. Perinotti, Phys. Rev. A 90, 062106 (2014), 10.1103/PhysRevA.90.062106], resulting in the derivation of the Weyl equation from informational principles. The present analysis, via a crucial use of isotropy, is significantly shorter and avoids a superfluous technical assumption, making the result completely general.
La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli
Directory of Open Access Journals (Sweden)
Umberto Fortis
2014-04-01
Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.
Performance of the OVERFLOW-MLP and LAURA-MLP CFD Codes on the NASA Ames 512 CPU Origin System
Taft, James R.
2000-01-01
The shared memory Multi-Level Parallelism (MLP) technique, developed last year at NASA Ames has been very successful in dramatically improving the performance of important NASA CFD codes. This new and very simple parallel programming technique was first inserted into the OVERFLOW production CFD code in FY 1998. The OVERFLOW-MLP code's parallel performance scaled linearly to 256 CPUs on the NASA Ames 256 CPU Origin 2000 system (steger). Overall performance exceeded 20.1 GFLOP/s, or about 4.5x the performance of a dedicated 16 CPU C90 system. All of this was achieved without any major modification to the original vector based code. The OVERFLOW-MLP code is now in production on the inhouse Origin systems as well as being used offsite at commercial aerospace companies. Partially as a result of this work, NASA Ames has purchased a new 512 CPU Origin 2000 system to further test the limits of parallel performance for NASA codes of interest. This paper presents the performance obtained from the latest optimization efforts on this machine for the LAURA-MLP and OVERFLOW-MLP codes. The Langley Aerothermodynamics Upwind Relaxation Algorithm (LAURA) code is a key simulation tool in the development of the next generation shuttle, interplanetary reentry vehicles, and nearly all "X" plane development. This code sustains about 4-5 GFLOP/s on a dedicated 16 CPU C90. At this rate, expected workloads would require over 100 C90 CPU years of computing over the next few calendar years. It is not feasible to expect that this would be affordable or available to the user community. Dramatic performance gains on cheaper systems are needed. This code is expected to be perhaps the largest consumer of NASA Ames compute cycles per run in the coming year.The OVERFLOW CFD code is extensively used in the government and commercial aerospace communities to evaluate new aircraft designs. It is one of the largest consumers of NASA supercomputing cycles and large simulations of highly resolved full
Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests
International Nuclear Information System (INIS)
Eifler, W.; Shepherd, I.M.
1983-01-01
Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix
International Nuclear Information System (INIS)
Ollivier, T.
1986-01-01
In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr
Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena
2018-01-15
The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.
El cancionero de los romances judeo-Espanoles de Sarajevo de Laura Papo-bojoteta
Directory of Open Access Journals (Sweden)
Muhamed Nezirović
1986-12-01
Full Text Available Los autores e investigadores europeos e americanos que se han ocupado desde principios de este siglo hasta nuestros días del fenómeno de los romances sefardíes de Bosnia, país en el cual vivía antes de la última Guerra Mundial una población judía muy activa y muy importante que Manuel Ortega, en esta época presidente de la Federación de las Asociaciones Sefardíes de Marruecos, caracterizaba en 1930 en estos términos: "Precisamente el grupo de Sefardíes de Sarajevo es uno de los que nos ha preocupado en todo momento por su situación privilegiada en el eje de las corrientes culturales del Oriente europeo, donde tan alto colocan el pabellón de la cultura hispana que ellos f ormaron en su mayor parte'', citan en tre los colectores de esta poesía bien a los judíos originarios de Bosnia como Dan S. Albachary, Maurice Levi o Kalmi Baruch, bien a los extranjeros como Leo Wiener, Manuel Manrique de Lara o Cynthia Crews. Ellos, sin embargo, omiten el nombre de una mujer bosníaca, Laura Papo-Bojoreta, que tiene un lugar destacado en la literatura judeoespañola de Yugoslavia no solamente como autora de unas obras literarias de gran valor, sino también como coleccionadora de los romances judíos de su país natal.
Ekström, Sandra
2012-01-01
En este trabajo investigamos las funciones de la intertextualidad en la novela La Isla de la Pasión de Laura Restrepo. Concentrándonos en citas y alusiones que refieren a Don Quijote de Cervantes, Robinson Crusoe de Defoe y la Biblia, y tomando en cuenta el contexto en el que aparecen, analizamos las funciones que estas referencias intertextuales cumplen en el nivel del relato en la novela de Restrepo. Constatamos que la intertextualidad entre La Isla de la Pasión y Don Quijote aparece como u...
J.C. Ott (Jan Cornelis)
2017-01-01
markdownabstractIn her book ‘Happiness’ Laura Hyman identifies some discourses, as defined by Foucault, about happiness among 19 middle-class respondents in the UK. A discourse is a way of thinking and communicating about some issue, and comparable to a ‘perception’ or a’ view’. The dominant
Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973
Directory of Open Access Journals (Sweden)
Guillermina Feudal
2017-12-01
Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.
Directory of Open Access Journals (Sweden)
Ortiz, R.
2015-12-01
Full Text Available The Santa Laura Saltpeter Work, which is nowadays the place where the most complete industrial infrastructure of the nitrate processing period is maintained, has a Leaching Tower that is considered by its uniqueness, the icon of the former nitrate industry in Chile. This impressive structure, built mostly in Oregon Pine wood (Pseudotsuga menziesii with metal junctions, unfortunately bears, after the plant stopped producing nitrate and iodine, the impact of its productive past and subsequent human actions because of neglect and lack of maintenance. This report, based on a visual, instrumental and structural inspection, is a diagnosis of the current condition of the building. The results indicate that the elements of the structure, with some exceptions, are in good condition and without changes in their mechanical properties. Structural analysis determined that the plant behavior is favorable, being able to withstand a seismic event of importance.La oficina salitrera Santa Laura, que es actualmente el lugar donde se mantiene la infraestructura industrial más completa del periodo del procesamiento del salitre, posee una Torre de Lixiviación que es considerada, por su singularidad, el ícono de la otrora industria salitrera en Chile. Esta impresionante estructura, construida casi en su totalidad con madera de Pino Oregón (Pseudotsuga menziesii y elementos metálicos en sus uniones, sobrelleva desafortunadamente, después del cese del proceso de fabricación de salitre y yodo, el impacto de su pasado productivo y posteriores acciones antrópicasambientales producto de su abandono y falta de mantenimiento. El presente informe, que contemplo inspección básica, instrumental y análisis estructural, es un diagnóstico del estado actual de conservación del edificio. Los resultados obtenidos indican que los elementos que conforman la estructura, con algunas excepciones, se encuentran en buen estado y sin alteración de sus propiedades mecánicas. El
Directory of Open Access Journals (Sweden)
Hans Christian Hagedorn
2011-01-01
Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.
Multiphoton states and amplitude k-th power squeezing
International Nuclear Information System (INIS)
Buzek, V.; Jex, I.
1991-01-01
On the basis of the work of d'Ariano and coworkers a new type of multiphoton states is introduced. Amplitude k-th power squeezing of the multiphoton states are analysed. In particular, it is shown that even if the multiphoton states do not exhibit ordinary squeezing they can be amplitude k-th power squeezed
Chamberlain, Heather; Samec, Ronald G.; Caton, Daniel Bruce; Van Hamme, Walter
2018-01-01
PY Aqr (GSC 05191-00853) is a solar Type (T ~ 5750K) eclipsing binary. It was observed in July to October, 2017 at Cerro Tololo in remote mode with the 0.6-m SARA South reflector. Two times of minimum light were calculated from our present observations, a primary and a secondary eclipse:HJD Min I = 2457951.7762±0.0006 HJD Min II = 2458019.5295±00.0003. Both weighted as 1.0.In addition, four timings were determined from online data given in IBVS 5600 and five observations at minima were determined from archived All Sky Automated Survey Data:HJD Min I = 2452908.3165, 2452912.33612 HJD Min II = 2452877.5621, 2452913.34465. All weighted as 0.5.ASAS Observations at minima: 2452094.688, 2453478.882, 2453266.576, 2452093.685 and 54729.600. Each weighted as 0.10The following linear and quadratic ephemerides were determined from all available times of minimum light:JD Hel Min I=2452951.7443±0.0008d + 0.402093441±0.000000099 X E {1} JD Hel Min I=2452951.7439±0.0007d + 0.4020912±0.0000007 X E +0.00000000018 ± 0.00000000006 X E2 {2}A BVRI Bessell filtered simultaneous Wilson-Devinney Program (W-D) solution reveals that the system has a mass ratio of ~0.34 and a component temperature difference of only ~40 K. One low luminosity (Tfact ~ 0.94, ~66 degree radius) large cool region of spots was iterated on the primary component in the WD Synthetic Light Curve computations. It appears in the Southern Hemisphere (colatitude 155 degrees). The Roche Lobe fill-out of the binary is ~17%. The inclination is ~86 degrees. An eclipse duration of ~10 minutes was determined for the primary eclipse and the light curve solution. Additional and more detailed information is given in this report.
International Nuclear Information System (INIS)
Aparo, M.; Dionisi, M.; Vicini, C.; Zeppa, P.; Frazzoli, F.V.; Remetti, R.; Portale, C.
1989-01-01
Nuclear Material Accountability, supported by Containment and Surveillance measures, is a foundamental means for an effective International Safeguard implemention in nuclear plants. Accountability is based on the verification that difference between a material quantity entering a given material balance and the quantity leaving that area in a given period of time, correspond and the amount of material actually present at the moment of the inspection. In the recent years International Safeguards appealing to the needs of timeliness in detecting diversion and concealing activities, devoted ReD efforts on a new Dynamic Accountability procedures (NRTMA) with particular concern with reprocessing plants. The present paper, which is the result of a research activity carried out in the frame of the Italian Support Programme to IAEA for Safeguards implementation, deals with a feasibility study of a NRTMA system to be applied to the EUREX pilot reprocessing plant. Such a feasibility study was performed by developing a computer program based on simulated plant generated data
International Nuclear Information System (INIS)
Dorado Delgado, Jennifer; Burbano Criollo, Juan Carlos; Molina Tabares, Jose Manuel; Carvajal Escobar, Yesid; Aristizabal, Hector Fabio
2006-01-01
In this study, space and time variability of monthly and annual rainfall was analyzed for the downstream influence zone of a Colombian supply-regulation reservoir, Sara-Brut, located on the Cauca valley department. Monthly precipitation data from 18 gauge stations and for a 29-year record (1975-2003) were used. These data were processed by means of time series completion, consistency analyses and sample statistics computations. Theoretical probabilistic distribution models such as Gumbel, normal, lognormal and wake by, and other empirical distributions such as Weibull and Landwehr were applied in order to fit the historical precipitation data set. The fit standard error (FSE) was used to test the goodness of fit of the theoretical distribution models and to choose the best of this probabilistic function. The wake by approach showed the best goodness of fit in 89% of the total gauges taken into account. Time variability was analyzed by means of wake by estimated values of monthly and annual precipitation associated with return periods of 1,052, 1,25, 2, 10, 20 and 50 years. Precipitation space variability is presents by means of ArcGis v8.3 and using krigging as interpolation method. In general terms the results obtained from this study show significant distribution variability in precipitation over the whole area, and particularity, the formation of dry and humid nucleus over the northeastern strip and microclimates at the southwestern and central zone of the study area were observed, depending on the season of year. The mentioned distribution pattern is likely caused by the influence of pacific wind streams, which come from the Andean western mountain range. It is expected that the results from this work be helpful for future planning and hydrologic project design
REPRESENTASI ANTI DISKRIMINASI PADA FILM KARTUN 3D ZOOTOPIA (KAJIAN SEMIOTIKA ROLAND BARTHES
Directory of Open Access Journals (Sweden)
Ali Muqoddas
2016-12-01
Full Text Available Isu diskriminasi SARA seperti tiada habisnya terjadi di dunia ini, begitu juga di Indonesia. Hal ini mengakibatkan tema-tema tentang SARA menjadi sensitif ketika dibahas atau pun difilmkan. Hal ini mengakibatkan jarang ditemui film yang mengangkat tentang SARA. Lain halnya dengan Walt Disney. Walt Disney baru-baru ini merilis film kartun 3D yang mengangkat tema anti diskriminasi SARA yang berjudul Zootopia. Film ini menjadi menarik karena isu diskriminasi SARA yang diangkat dibalut dengan konsep yang kreatif hingga sensivitas isu SARA tersebut menjadi berkurang. Representasi anti diskriminasi SARA pada film Zootopia ini selanjutnya dikaji dengan metode semiotika Roland Barthes dengan pendekatan deskriptif kualitatif. Berdasarkan dari analisis, dapat disimpulkan bahwa film Zootopia memuat pesan ideologi tentang anti diskriminasi SARA bahwa kedudukan manusia dimata manusia yang lain pada hakikatnya adalah sama. Setiap manusia berhak dan wajib memperlakukan dan diperlakukan secara bijak tanpa memperdulikan background asal manusia itu sendiri. Penghargaan pada setiap individu tidak didasarkan pada faktor keturunan, ras, suku ataupun agama, namun didasarkan pada prestasi dari individu itu sendiri. Kata Kunci: diskriminasi SARA, Zootopia, Roland Barthes Abstract The issue of racial discrimination as an endless happen in this world, so also in Indonesia. This resulted in the themes of SARA be sensitive when discussed or filmed. This resulted in a rare film that raised about SARA. Another case with Walt Disney. Walt Disney recently released 3D animated film that mengangat theme of anti-discrimination SARA entitled Zootopia. This film is interesting because racial discrimination issues raised wrapped with a creative concept to the sensitivity of the racial issues be reduced. SARA anti-discrimination representation on film Zootopia is further studied with Roland Barthes semiotic methods with qualitative descriptive approach. Based on the analysis, it can
DEFF Research Database (Denmark)
Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong
2014-01-01
in the field are often not detected. Thus, other and better markers of SARA are needed. The purpose of this research was to study the feces microbiome during SARA and assess the possibilities of using feces microbial markers as indicators of SARA. Methods: Six lactating, rumen cannulated, Danish Holstein cows...... were used in a blocked design study including two blocks. In the first block, two cows received control diet and two cows received SARA-challenge diet. In the second block, former control cows received SARA diet while two new cows received control diet. Cows received a total mixed ration (TMR; 24......% concentrate) for four weeks before the trial. SARA was induced by gradual substitution of 40% of TMR with grain pellets (50:50 wheat:barley) over 3 days. Full SARA diet was fed for four days. Rumen pH was measured continuously by indwelling probes (eCow). Feces samples were taken at 9 am and 9 pm on last day...
Directory of Open Access Journals (Sweden)
Laura Rorato
2018-01-01
Full Text Available This article analyses the representation of the impact of migration on family dynamics in three autobiographical works: Laura Pariani’s Il piatto dell’angelo (2013, Mary Melfi’s Italy Revisited. Conversations with my Mother (2009, and Antonella Di Pietrantonio’s Mia madre è un fiume (2011. All three authors were directly or indirectly affected by the wave of emigration that took place in Italy between the end of the 19th century and the first half of the 20th century. Pariani extends her observations to the present by focusing also on those South American women who are currently moving to Italy to work as cares for old people, often leaving their families behind. Motherhood and mothering are central themes in all three books. These works problematise the patriarchal notion of motherhood and highlight the need to move towards alternative concepts of motherhood that do not imply the subordination of women. Additionally, this article offers a reflection on the role that creative writing can play in challenging some of the most engrained stereotypes, such as those of the good mother versus the bad mother, partially related to our Christian tradition. Building on Podnieks and O’Reilly’s notion of “maternal texts” (1-2, this article argues that through fiction women are less inhibited in exploring the thornier aspects of motherhood as a social construction than they seem to be in everyday life.
Biokeemilised kõnelused katseklaasis / Laura Herm ; Herm, Laura; Rinken, Ago
Herm, Laura
2007-01-01
Artiklis räägitakse suhtlemise biokeemiast, sellistest biokeemilistest kõnelustest, mida peavad meid moodustavad närvirakud omavahel ja iseeneste sees, ning mida oma katseklaasides uurivad Tartu Ülikooli keemia instituudi bioorgaanilise keemia õppetooli õppurid ja teadurid
Epimural indicator phylotypes of transiently-induced subacute ruminal acidosis in dairy cattle
Directory of Open Access Journals (Sweden)
Stefanie Urimare Wetzels
2016-03-01
Full Text Available The impact of a long-term subacute rumen acidosis (SARA on the bovine epimural bacterial microbiome (BEBM and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a one-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA isolation (4 sampling time points per cow: at the baseline before concentrate was fed, after the first SARA challenge, after the challenge break, and after the second SARA challenge. Ruminal pH was continuously monitored. The microbiome was determined using Illumina MiSeq sequencing of the 16S rRNA gene (V345 region. In total 1,215,618 sequences were obtained and clustered into 6,833 operational taxonomic units (OTUs. Campylobacter and Kingella were the most abundant OTUs (16.5% and 7.1%. According to ruminal pH dynamics, the second challenge was more severe than the first challenge. Species diversity estimates and evenness increased during the challenge break compared to all other sampling time points (P<0.05. During both SARA challenges, Kingella- and Azoarcus-OTUs decreased (0.5 and 0.4 fold-change and a dominant Ruminobacter-OTU increased during the challenge break (18.9 fold-change; P<0.05. qPCR confirmed SARA-related shifts. During the challenge break noticeably more OTUs increased compared to other sampling time points. Our results show that the BEBM re-establishes the baseline conditions slower after a SARA challenge than ruminal pH. Key phylotypes that were reduced during both challenges may help to establish a bacterial fingerprint to facilitate understanding effects of SARA conditions on the BEBM and their consequences for the ruminant host.
Epimural Indicator Phylotypes of Transiently-Induced Subacute Ruminal Acidosis in Dairy Cattle.
Wetzels, Stefanie U; Mann, Evelyne; Metzler-Zebeli, Barbara U; Pourazad, Poulad; Qumar, Muhammad; Klevenhusen, Fenja; Pinior, Beate; Wagner, Martin; Zebeli, Qendrim; Schmitz-Esser, Stephan
2016-01-01
The impact of a long-term subacute rumen acidosis (SARA) on the bovine epimural bacterial microbiome (BEBM) and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a 1-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA isolation (4 sampling time points per cow: at the baseline before concentrate was fed, after the first SARA challenge, after the challenge break, and after the second SARA challenge). Ruminal pH was continuously monitored. The microbiome was determined using Illumina MiSeq sequencing of the 16S rRNA gene (V345 region). In total 1,215,618 sequences were obtained and clustered into 6833 operational taxonomic units (OTUs). Campylobacter and Kingella were the most abundant OTUs (16.5 and 7.1%). According to ruminal pH dynamics, the second challenge was more severe than the first challenge. Species diversity estimates and evenness increased during the challenge break compared to all other sampling time points (P < 0.05). During both SARA challenges, Kingella- and Azoarcus-OTUs decreased (0.5 and 0.4 fold-change) and a dominant Ruminobacter-OTU increased during the challenge break (18.9 fold-change; P < 0.05). qPCR confirmed SARA-related shifts. During the challenge break noticeably more OTUs increased compared to other sampling time points. Our results show that the BEBM re-establishes the baseline conditions slower after a SARA challenge than ruminal pH. Key phylotypes that were reduced during both challenges may help to establish a bacterial fingerprint to facilitate understanding effects of SARA conditions on the BEBM and their consequences for the ruminant host.
Paducah Gaseous Diffusion Plant site environmental report for 1988
International Nuclear Information System (INIS)
Rogers, J.G.; Jett, T.G.
1989-05-01
Quantities of nonradiological chemical emissions are not included in this report this year. An addendum that will include the information will be published after the Superfund Amendments Reauthorization Act (SARA) Title III report is issued on July 1, 1989. When the addendum is published, probably in late July, a summary of the SARA Title III 313 report will be included. The SARA report provides the community with the opportunity to lean about estimated quantities of certain toxic chemicals used at a facility that are routinely or accidentally released into the environment. The addendum that will be published after the SARA report will summarize the SARA report and is expected to include some additional ''large quantity'' chemicals used or stored at the facilities that are not required to be reported by SARA Title III but are known to be emitted from the facilities. The addendum will not be all inclusive but will provide emissions information on the major chemical emissions to the air, water, or land from processes at the facilities
International Nuclear Information System (INIS)
Kusari, Souvik; Prabhakaran, Deivasigamani; Lamshoeft, Marc; Spiteller, Michael
2009-01-01
Fluoroquinolones like difloxacin (DIF) and sarafloxacin (SARA) are adsorbed in soil and enter the aquatic environment wherein they are subjected to photolytic degradation. To evaluate the fate of DIF and SARA, their photolysis was performed in water under stimulated natural sunlight conditions. DIF primarily degrades to SARA. On prolonged photodegradation, seven photoproducts were elucidated by HR-LC-MS/MS, three of which were entirely novel. The residual anti-bacterial activities of DIF, SARA and their photoproducts were studied against a group of pathogenic strains. DIF and SARA revealed potency against both Gram-positive and -negative bacteria. The photoproducts also exhibited varying degrees of efficacies against the tested bacteria. Even without isolating the individual photoproducts, their impact on the aquatic environment could be assessed. Therefore, the present results call for prudence in estimating the fate of these compounds in water and in avoiding emergence of resistance in bacteria caused by the photoproducts of DIF and SARA. - Assessment of the residual anti-bacterial efficacies of difloxacin, sarafloxacin and their photoproducts in water, and estimating their impact on the aquatic environment in inducing resistance to microorganisms.
Overcoming Endocrine Resistance by Targeting ER/FoxA1/IL-8 Axis
2015-10-01
Creighton, Fugen Li, Martin Shea, Agostina Nardone, Tao Wang, Laura M. Heiser , Pavana Anur, Nicholas Wang, Catie Grasso, Paul Spellman, Carolina...Xiaoyong Fu, Rinath Jeselsohn, Resel Pereira, Emporia F. Hollingsworth, Chad J. Creighton, Fugen Li, Martin Shea, Agostina Nardone, Laura M. Heiser , Pavana...Rinath Jeselsohn, Emporia F. Hollingsworth, Dolores Lopez-Terrada, Chad J. Creighton, Agostina Nardone, Martin Shea, Laura M. Heiser , Pavana Anur
The use of sodic monensin and probiotics for controlling subacute ruminal acidosis in sheep
Directory of Open Access Journals (Sweden)
Elizabeth Schwegler
2015-02-01
Full Text Available The aim of this work was to validate a protocol for induction of subacute ruminal acidosis (SARA (Experiment 1 and test the efficiency of probiotic Saccharomyces cerevisiae or monensin to avoid pH ruminal drops in sheep (Experiment 2. In Experiment 1, six ewes were fasted for two days and then fed most with concentrate during four days. Ewes in this protocol had ruminal fluid pH below 6.0 and kept it for 75 consecutive hours. In Experiment 2, 18 sheep were distributed into three groups: Control (CG, n = 6, monensin (MG, n = 6 and probiotic group (PG, n = 6. SARA was induced according Experiment 1. PG had lower pH (5.7 ± 0.1 than CG (6.0 ± 0.1 (P = 0.05, while MG (5.7 ± 0.1 was similar to both during SARA induction. SARA induction reduced ruminal protozoa population (P < 0.05 and increased chloride concentrations in ruminal fluid (P < 0.01. In serum, SARA increased concentrations of phosphorus (P < 0.01, AST (P < 0.01 and GGT (P < 0.01, but reduced LDH (P < 0.01. In conclusion, the protocol used for SARA induction was able to maintain ruminal pH between 5.5-6.0 for more than 48 hours. However, monensin and probiotics supplementation was not effective in preventing changes in ruminal and serum parameters during SARA.
MIRAGENS E PRISMAS: O BARROCO DÁ MOVIMENTO ÀS IMAGENS HERMÉTICAS NA POESIA SUASSUNIANA
Directory of Open Access Journals (Sweden)
Paulo Caldas Neto
2009-03-01
Full Text Available RESUMO Este artigo visa a estudar a presença de uma vertente barroca na poesia contemporânea. Nada melhor que a lírica armorial de Ariano Suassuna para servir de investigação a nossas suspeitas. Sendo esse gênero da obra suassuniana tão pouco examinado, provavelmente não se conheça a sua importância para a construção do sentido de sua dramaturgia e de sua prosa de ficção (bem mais conhecidas. A relação desenhada entre a teoria da dobra barroca de Deleuze e os estudos sobre a estética dos Setecentos casou tranqüilamente com a finalidade de se descobrir a essência de todo o hermetismo. Ora o poema armorial é barroco, ora seu conjunto imagético pode até sugerir, fazendo com que o leitor pense que se trata de um esteticismo simbolista, a prova disso está no registro de substantivos concretos com suas letras iniciais maiúsculas. Daí, tem-se, em parte, o movimento da dobra, sempre mutante, oscilador. Na primeira seção, é feito um breve panorama da arte barroca, marcada por suas irregularidades. Na segunda seção, justifica-se o efeito que estas causam: as dobras. A partir delas, as correspondências entre as formas fixas do poema, a heráldica sertaneja e os problemas do Nordeste se completarão perfeitamente. PALAVRAS-CHAVE: Ariano Suassuna, poema, Barroco, dobra e hermetismo. ESPEJISMOS Y PRISMAS: EL BARROCO DA MOVIMIENTO A LAS IMAGÉNES HERMÉTICAS EN LA POESÍA SUASUNIANA RESUMEN Este artículo mira a estudiar la presencia de una vertiente barroca en la poesía contemporanea. Nada mejor que la lírica armonica de Ariano Suassuna para servir de investigación a nuestras sospechas. Siendo ese género de la obra suasuniana tan poco examinado, probablemente no se conozca su importancia para la construcción del sentido de su dramaturgia y de su prosa de ficción (bien más conocidas. La relación dibujada entre la teoría del doblez barroco de Deleuze y los estudios sobre la estética de los Setecientos cas
Ishaq, Suzanne L; AlZahal, Ousama; Walker, Nicola; McBride, Brian
2017-01-01
Sub-acute ruminal acidosis (SARA) is a gastrointestinal functional disorder in livestock characterized by low rumen pH, which reduces rumen function, microbial diversity, host performance, and host immune function. Dietary management is used to prevent SARA, often with yeast supplementation as a pH buffer. Almost nothing is known about the effect of SARA or yeast supplementation on ruminal protozoal and fungal diversity, despite their roles in fiber degradation. Dairy cows were switched from a high-fiber to high-grain diet abruptly to induce SARA, with and without active dry yeast (ADY, Saccharomyces cerevisiae ) supplementation, and sampled from the rumen fluid, solids, and epimural fractions to determine microbial diversity using the protozoal 18S rRNA and the fungal ITS1 genes via Illumina MiSeq sequencing. Diet-induced SARA dramatically increased the number and abundance of rare fungal taxa, even in fluid fractions where total reads were very low, and reduced protozoal diversity. SARA selected for more lactic-acid utilizing taxa, and fewer fiber-degrading taxa. ADY treatment increased fungal richness (OTUs) but not diversity (Inverse Simpson, Shannon), but increased protozoal richness and diversity in some fractions. ADY treatment itself significantly ( P PERMANOVA, P = 0.0001, P = 0.0452, P = 0.0068, Monte Carlo correction, respectively, and location was a significant factor ( P = 0.001, Monte Carlo correction) for protozoa. Diet-induced SARA shifts diversity of rumen fungi and protozoa and selects against fiber-degrading species. Supplementation with ADY mitigated this reduction in protozoa, presumptively by triggering microbial diversity shifts (as seen even in the high-fiber diet) that resulted in pH stabilization. ADY did not recover the initial community structure that was seen in pre-SARA conditions.
Directory of Open Access Journals (Sweden)
Μαρίνα ΚΟΥΜΑΝΟΥΔΗ
2012-03-01
Full Text Available Βιβλιοκρισία του: Martin da Canal, Les Estoires de Venise, αγγλική μετάφραση, εισαγωγή και σχόλια LAURA K. MORREALE [Archivio del Litorale Adriatico XII], Padova 2009, σσ. xxii + 175 [ΙSBN 978-88-8098-267-8].
Luiz Fernando Carvalho: An Auteur of Brazilian Television
CARTER, ELI LEE
2013-01-01
In this study I combine Pierre Bourdieu's theoretical model for cultural production with auteur theory in an analysis of the work of acclaimed film and television director Luiz Fernando Carvalho. Perhaps best-known in the U.S. for his brilliant feature Lavoura Arcaica (To the Left of the Father, 2001), based on the novel by Raduan Nassar, most of Carvalho's activity has been in television, where he has directed adaptations of works by Ariano Suassuna (A Pedra do Reino), E�a de Queiroz (Os M...
Epimural Indicator Phylotypes of Transiently-Induced Subacute Ruminal Acidosis in Dairy Cattle
Wetzels, Stefanie U.; Mann, Evelyne; Metzler-Zebeli, Barbara U.; Pourazad, Poulad; Qumar, Muhammad; Klevenhusen, Fenja; Pinior, Beate; Wagner, Martin; Zebeli, Qendrim; Schmitz-Esser, Stephan
2016-01-01
The impact of a long-term subacute rumen acidosis (SARA) on the bovine epimural bacterial microbiome (BEBM) and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a 1-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA...
HIV/AIDS misconceptions may be associated with condom use ...
African Journals Online (AJOL)
HIV/AIDS misconceptions may be associated with condom use among black South Africans: an exploratory analysis. Laura M Bogart, Donald Skinner, Lance S Weinhardt, Laura Glasman, Cheryl Sitzler, Yoesrie Toefy, Seth C Kalichman ...
DEFF Research Database (Denmark)
Tarby, Sara; Cermak, Daniel
2016-01-01
Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016.......Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016....
PÖFFil esilinastub animafilm "Kärbeste veski" / Eva Samolberg
Samolberg, Eva
2011-01-01
PÖFFi raames toimuval 15. animafilmide festivalil Animated Dreams esilinastub Eesti Kunstiakadeemia animatsiooniosakonna magistrandi Anu-Laura Tuttelbergi lõputöö - animafilm "Kärbeste veski". Tallinna Ülikooli Akadeemilises raamatukogus on avatud Anu-Laura Tuttelbergi esilinastuva nukufilmi dekoratsioonide ja nukkude näitus
DEFF Research Database (Denmark)
svendsen, erik
2010-01-01
refleksioner over filmteoretiske tekster af Benjamin, John Ellis, , Todd McGowan, Barbara Klinger, Laura Mulvej og Slavoj Zizek Udgivelsesdato: 09-06-10......refleksioner over filmteoretiske tekster af Benjamin, John Ellis, , Todd McGowan, Barbara Klinger, Laura Mulvej og Slavoj Zizek Udgivelsesdato: 09-06-10...
Directory of Open Access Journals (Sweden)
Suzanne L. Ishaq
2017-10-01
Full Text Available Sub-acute ruminal acidosis (SARA is a gastrointestinal functional disorder in livestock characterized by low rumen pH, which reduces rumen function, microbial diversity, host performance, and host immune function. Dietary management is used to prevent SARA, often with yeast supplementation as a pH buffer. Almost nothing is known about the effect of SARA or yeast supplementation on ruminal protozoal and fungal diversity, despite their roles in fiber degradation. Dairy cows were switched from a high-fiber to high-grain diet abruptly to induce SARA, with and without active dry yeast (ADY, Saccharomyces cerevisiae supplementation, and sampled from the rumen fluid, solids, and epimural fractions to determine microbial diversity using the protozoal 18S rRNA and the fungal ITS1 genes via Illumina MiSeq sequencing. Diet-induced SARA dramatically increased the number and abundance of rare fungal taxa, even in fluid fractions where total reads were very low, and reduced protozoal diversity. SARA selected for more lactic-acid utilizing taxa, and fewer fiber-degrading taxa. ADY treatment increased fungal richness (OTUs but not diversity (Inverse Simpson, Shannon, but increased protozoal richness and diversity in some fractions. ADY treatment itself significantly (P < 0.05 affected the abundance of numerous fungal genera as seen in the high-fiber diet: Lewia, Neocallimastix, and Phoma were increased, while Alternaria, Candida Orpinomyces, and Piromyces spp. were decreased. Likewise, for protozoa, ADY itself increased Isotricha intestinalis but decreased Entodinium furca spp. Multivariate analyses showed diet type was most significant in driving diversity, followed by yeast treatment, for AMOVA, ANOSIM, and weighted UniFrac. Diet, ADY, and location were all significant factors for fungi (PERMANOVA, P = 0.0001, P = 0.0452, P = 0.0068, Monte Carlo correction, respectively, and location was a significant factor (P = 0.001, Monte Carlo correction for protozoa
DEFF Research Database (Denmark)
Haarder, Jon Helt
2008-01-01
Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner......Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner...
Research Biologist with the EPA. Her current work involves linking natural and built infrastructure to human health and well-being at multiple spatial scales, in order to develop interpretive maps and analytical tools for an interactive, web-based Atlas.
Economic Analysis of National Nuclear Security Administration (NNSA) Modernization Alternatives
2007-11-01
S. Helwig Rob Mahoney Joshua A. Minix David J. Nicholls Paul H. Richanbach Robert W. Thomas Laura M. Williams Approved for public release...Helwig Rob Mahoney Joshua A. Minix David J. Nicholls Paul H. Richanbach Robert W. Thomas Laura M. Williams iii PREFACE The Institute for Defense
African Journal of AIDS Research - Vol 10, No 2 (2011)
African Journals Online (AJOL)
HIV/AIDS misconceptions may be associated with condom use among black South Africans: an exploratory analysis · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Laura M Bogart, Donald Skinner, Lance S Weinhardt, Laura Glasman, Cheryl Sitzler, Yoesrie Toefy, Seth C ...
2012-04-04
...: Direct all written comments to Laura Bloodgood, Project Leader, U.S. International Trade Commission, 500... leader Laura Bloodgood ( [email protected] or 202-708-4726) or deputy project leader Andrea Boron..., volume, and value of, and foreign markets of significance for, exports of used electronic products from...
2012-03-01
authorities. METHODS FOR CLEANING UP: Contain spillage and then collect with non-combustible absorbent material, (e.g. sand, soil , diatomaceous earth...SARA 311/312 Hazards: Fire Hazard, Acute Health Hazard, and Chronic Health Hazard CERCLA SECTION 103 and SARA SECTION 304 (RELEASE TO THE ENVIROMENT
Substorm associated radar auroral surges: a statistical study and possible generation model
Directory of Open Access Journals (Sweden)
B. A. Shand
Full Text Available Substorm-associated radar auroral surges (SARAS are a short lived (15–90 minutes and spatially localised (~5° of latitude perturbation of the plasma convection pattern observed within the auroral E-region. The understanding of such phenomena has important ramifications for the investigation of the larger scale plasma convection and ultimately the coupling of the solar wind, magnetosphere and ionosphere system. A statistical investigation is undertaken of SARAS, observed by the Sweden And Britain Radar Experiment (SABRE, in order to provide a more extensive examination of the local time occurrence and propagation characteristics of the events. The statistical analysis has determined a local time occurrence of observations between 1420 MLT and 2200 MLT with a maximum occurrence centred around 1700 MLT. The propagation velocity of the SARAS feature through the SABRE field of view was found to be predominately L-shell aligned with a velocity centred around 1750 m s–1 and within the range 500 m s–1 and 3500 m s–1. This comprehensive examination of the SARAS provides the opportunity to discuss, qualitatively, a possible generation mechanism for SARAS based on a proposed model for the production of a similar phenomenon referred to as sub-auroral ion drifts (SAIDs. The results of the comparison suggests that SARAS may result from a similar geophysical mechanism to that which produces SAID events, but probably occurs at a different time in the evolution of the event.
Key words. Substorms · Auroral surges · Plasma con-vection · Sub-auroral ion drifts
RNA structure alignment by a unit-vector approach.
Capriotti, Emidio; Marti-Renom, Marc A
2008-08-15
The recent discovery of tiny RNA molecules such as microRNAs and small interfering RNA are transforming the view of RNA as a simple information transfer molecule. Similar to proteins, the native three-dimensional structure of RNA determines its biological activity. Therefore, classifying the current structural space is paramount for functionally annotating RNA molecules. The increasing numbers of RNA structures deposited in the PDB requires more accurate, automatic and benchmarked methods for RNA structure comparison. In this article, we introduce a new algorithm for RNA structure alignment based on a unit-vector approach. The algorithm has been implemented in the SARA program, which results in RNA structure pairwise alignments and their statistical significance. The SARA program has been implemented to be of general applicability even when no secondary structure can be calculated from the RNA structures. A benchmark against the ARTS program using a set of 1275 non-redundant pairwise structure alignments results in inverted approximately 6% extra alignments with at least 50% structurally superposed nucleotides and base pairs. A first attempt to perform RNA automatic functional annotation based on structure alignments indicates that SARA can correctly assign the deepest SCOR classification to >60% of the query structures. The SARA program is freely available through a World Wide Web server http://sgu.bioinfo.cipf.es/services/SARA/. Supplementary data are available at Bioinformatics online.
International Nuclear Information System (INIS)
Kleinman, L.E.; Maloberti, A.L.; Gayone, M.R.; Kaufmann, C.; Sruoga, P.
2013-01-01
Radiometric surveys are a rapid tool to measure uranium (U), thorium (Th) and potassium (K) concentrations in rocks and are very useful in the exploration for radioactive minerals. The distribution of uranium in Jurassic volcanic rocks of the province of Santa Cruz is evaluated in this work using ground gamma-ray spectrometry and rock geochemistry in order to assess its potential to form uranium deposits. Five areas were selected, which had some previous data of high radiometric values and detailed geological information. Measurements were carried out with a portable gamma-ray spectrometer (Exploranium-GR 320®) in andesites, ignimbrites, rhyolites, silicified areas, ash-fall tuffs and lacustrine sediments corresponding to the Bahía Laura and to El Quemado complexes. The results were similar in the five surveyed areas: radiometric concentrations show good positive correlations with chemical composition of the studied rocks for both K and Th, and a relatively poorer correlation for U. Different processes such as magmatic differentiation, vapor phase crystallization, hydrothermal alteration and supergene alteration are reflected in the distribution of these elements. U concentrations increase in the more glassy rocks, in areas with hydrothermal silicification, and in fracture zones, features that should be considered in future surveys. The calkalkaline composition and arc-signatures of the Jurassic magmatism are not the most favorable for uranium enrichment and for concentration of significant mineralizations. However, the extensional tectonic setting; the occurrence of calderas with facies slightly enriched in U and Th, in addition to hydrothermal activity are positive factors for U exploration. (authors) [es
Perlindungan Hukum Kelompok Teisme dalam Sistem Negara Hukum Pancasila
Directory of Open Access Journals (Sweden)
Tomy Michael
2017-05-01
Full Text Available Di era global saat ini, suatu bangsa dituntut mampu bersaing dengan negara lain. Agar tidak terlepas dari unsur khas Indonesia maka penguatan Pancasila sebagai ideologi adalah keharusan. Pancasila yang melingkupi keragaman suku, agama, ras dan antar golongan (SARA kurang tercermin dalam UU Nomor 23 Tahun 2006. Permasalahan yang timbul yaitu hilangnya unsur khas Indonesia yaitu kepercayaan atau agama tradisional karena adanya diskriminasi dengan pengosongan kolom agama dalam Kartu Kelurga (KK dan Kartu Tanda Penduduk (KTP (Pasal 61 dan Pasal 64 UU No. 23-2006. Penelitian ini bertujuan untuk menganalisis korelasi hukum UU No. 23 tahun 2016 dengan keberadaan Pancasila dan SARA di Indonesia. Metode penelitian yang digunakan adalah penelitian hukum normatif. Hasil penelitian ini menunjukkan bahwa UU No. 23 Tahun 2006 tidak selaras dengan semangat Pancasila yang mengakui keragaman SARA dan bertentang dengan asas keadilan dalam UU No. 12Tahun 2011. In the global era, a nation supposedly able to compete with other countries. In order not to be separated from the typical elements of Indonesia, the strengthening of Pancasila as an ideology is a must. Pancasila surrounding ethnic, religious, racial and sectarian (SARA less diversity reflected in Law No. 23 of 2006. The problems that arise, namely the loss of the typical elements of Indonesia namely traditional religious beliefs or because of their discrimination by emptying the religion column in Family Card (KK and Identity Card (KTP (Article 61 and Article 64 of Law No. 23-2006. This study aims to analyze the correlation on Law No. 23of 2016 with the existence of Pancasila and SARA in Indonesia. The method used is a normative legal research. The result of this study reveals that the Law No. 23 of 2006 not in line with the spirit of Pancasila that recognizes the diversity of SARA and incompatible with the principles of justice on Law No. 12 of 2011.
Journal of Food Technology in Africa - Vol 7, No 3 (2002)
African Journals Online (AJOL)
Identification of Lactic Acid Bacteria isolated from Opaque beer (Chibuku) for potential use as a starter culture. Chamunorwa A Togo, Sara B Sara B. Feresu, Anthony Mutukumira. http://dx.doi.org/10.4314/jfta.v7i3.19239 · Performance of different strains of Pleurotus species under Ghanaian conditions. K Vowotor, M Obodai.
Book Review: Commemoration as Conflict: Space, Memory and Identity in Peace Processes
DEFF Research Database (Denmark)
McQuaid, Sara Dybris
2016-01-01
Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7......Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7...
Directory of Open Access Journals (Sweden)
Renee M Petri
Full Text Available Subacute rumen acidotic (SARA conditions are a consequence of high grain feeding. Recent work has shown that the pattern of grain feeding can significantly impact the rumen epimural microbiota. In a continuation of these works, the objective of this study was to determine the role of grain feeding patterns on the colonization and associated changes in predicted functional properties of the fiber-adherent microbial community over a 48 h period. Eight rumen-cannulated Holstein cows were randomly assigned to interrupted or continuous 60%-grain challenge model (n = 4 per model to induce SARA conditions. Cows in the continuous model were challenged for 4 weeks, whereas cows of interrupted model had a 1-wk break in between challenges. To determine dynamics of rumen fiber-adherent microbial community we incubated the same hay from the diet samples for 24 and 48 h in situ during the baseline (no grain fed, week 1 and 4 of the continuous grain feeding model as well as during the week 1 following the break in the interrupted model. Microbial DNA was extracted and 16SrRNA amplicon (V3-V5 region sequencing was done with the Illumina MiSeq platform. A significant decrease (P 0.1% relative abundance in the rumen, 18 of which were significantly impacted by the feeding challenge model. Correlation analysis of the significant OTUs to rumen pH as an indicator of SARA showed genus Succiniclasticum had a positive correlation to SARA conditions regardless of treatment. Predictive analysis of functional microbial properties suggested that the glyoxylate/dicarboxylate pathway was increased in response to SARA conditions, decreased between 24h to 48h of incubation, negatively correlated with propanoate metabolism and positively correlated to members of the Veillonellaceae family including Succiniclasticum spp. This may indicate an adaptive response in bacterial metabolism under SARA conditions. This research clearly indicates that changes to the colonizing fiber
Geice Peres Nunes
2010-01-01
A presente dissertação de mestrado intitulada As ressonâncias da literatura popular do nordeste no Romance dA Pedra do Reino e o príncipe do sangue do vai-e-volta foi elaborada por Geice Peres Nunes sob a orientação do Prof. Dr. Lawrence Flores Pereira, da Universidade Federal de Santa Maria. Nesse estudo, debruçamo-nos na influência da Literatura popular do nordeste e da poesia oral no Romance dA Pedra do Reino e o Príncipe do sangue do vai-e-volta, de Ariano Suassuna. Para tanto, lançamos m...
Leedu kunst on integratsioonivõimeline / Eha Komissarov
Komissarov, Eha, 1947-
2004-01-01
Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones (Evaldas Jansas, Egle Rakauskaite) ja Rotermanni soolalaos (Loreta Bilinskaite-Burke, Laura Barbshtiene & Arturas Bumshteinas (G-Lab), Jonas Gasiunas, Arunas Gudaitis, Linas Jablonskis, Dainius Lishkevicius, Mindaugas Lukoshaitis, Gintaras Makarevicius, Deimantas Narkevicius, Egle Ridikaite, Irma Stanaityte, Laura Stasiulyte, Mindaugas Shimkus, Arturas Valiauga, Rimaldas Vikshraitis, Darius Zhiura). Kuraator Anders Kreuger leedu kunstniku kuvandiloomest
Lood toimivad ajas / Laura Kuusk
Kuusk, Laura, 1982-
2006-01-01
Andres Härmi kureeritud näitusesari "Story" Tallinna Linnagaleriis: 14. IX-1. X "Story I: Katse ja eksitus. Monument massidele. Janna Holmstedt & Po Hagström"; 5.-22. X "Story II: 9. detsember 2005: minu märkmik. Tõnis Saadoja"; 26. X-12. XI "Story III: Aja sund. Minna Hint ja Jane Remm" ja 7.-31. XII "Story IV: Cinemagic Tour. Elsebeth Jorgensen"
Xue, Fuguang; Pan, Xiaohua; Jiang, Linshu; Guo, Yuming; Xiong, Benhai
2018-01-01
Thiamine is known to attenuate high-concentrate diet induced subacute ruminal acidosis (SARA) in dairy cows, however, the underlying mechanisms remain unclear. The major objective of this study was to investigate the metabolic mechanisms of thiamine supplementation on high-concentrate diet induced SARA. Six multiparous, rumen-fistulated Holstein cows were used in a replicated 3 × 3 Latin square design. The treatments included a control diet (CON; 20% starch, dry matter basis), a SARA-inducing diet (SAID; 33.2% starch, dry matter basis) and SARA-inducing diet supplemented with 180 mg of thiamine/kg of dry matter intake (SAID + T). On d21 of each period, ruminal fluid samples were collected at 3 h post feeding, and GC/MS was used to analyze rumen fluid samples. PCA and OPLS-DA analysis demonstrated that the ruminal metabolite profile were different in three treatments. Compared with CON treatment, SAID feeding significantly decreased rumen pH, acetate, succinic acid, increased propionate, pyruvate, lactate, glycine and biogenic amines including spermidine and putrescine. Thiamine supplementation significantly decreased rumen content of propionate, pyruvate, lactate, glycine and spermidine; increase rumen pH, acetate and some medium-chain fatty acids. The enrichment analysis of different metabolites indicated that thiamine supplementation mainly affected carbohydrates, amino acids, pyruvate and thiamine metabolism compared with SAID treatment. These findings revealed that thiamine supplementation could attenuate high-concentrate diet induced SARA by increasing pyruvate formate-lyase activity to promote pyruvate to generate acetyl-CoA and inhibit lactate generation. Besides, thiamine reduced biogenic amines to alleviate ruminal epithelial inflammatory response.
Caudron, Corentin; White, Robert S.; Green, Robert G.; Woods, Jennifer; Ágústsdóttir, Thorbjörg; Donaldson, Clare; Greenfield, Tim; Rivalta, Eleonora; Brandsdóttir, Bryndís.
2018-01-01
Magma is transported in brittle rock through dikes and sills. This movement may be accompanied by the release of seismic energy that can be tracked from the Earth's surface. Locating dikes and deciphering their dynamics is therefore of prime importance in understanding and potentially forecasting volcanic eruptions. The Seismic Amplitude Ratio Analysis (SARA) method aims to track melt propagation using the amplitudes recorded across a seismic network without picking the arrival times of individual earthquake phases. This study validates this methodology by comparing SARA locations (filtered between 2 and 16 Hz) with the earthquake locations (same frequency band) recorded during the 2014-2015 Bár∂arbunga-Holuhraun dike intrusion and eruption in Iceland. Integrating both approaches also provides the opportunity to investigate the spatiotemporal characteristics of magma migration during the dike intrusion and ensuing eruption. During the intrusion SARA locations correspond remarkably well to the locations of earthquakes. Several exceptions are, however, observed. (1) A low-frequency signal was possibly associated with a subglacial eruption on 23 August. (2) A systematic retreat of the seismicity was also observed to the back of each active segment during stalled phases and was associated with a larger spatial extent of the seismic energy source. This behavior may be controlled by the dike's shape and/or by dike inflation. (3) During the eruption SARA locations consistently focused at the eruptive site. (4) Tremor-rich signal close to ice cauldrons occurred on 3 September. This study demonstrates the power of the SARA methodology, provided robust site amplification; Quality Factors and seismic velocities are available.
ACT-R/E: An Embodied Cognitive Architecture for Human-Robot Interaction
2013-01-01
Threaded Cognition: An Integrated Theory of Concurrent Multitasking . Psychological Review, 115(1), 101–130, http://dx.doi.org/10.1037/0033-295X...Trafton, Naval Research Laboratory, Washington, DC, USA Email : greg.trafton@nrl.navy.mil Laura Hiatt, Naval Research Laboratory, Washington, DC, USA Email ...laura.hiatt@nrl.navy.mil Anthony Harrison, Naval Research Laboratory, Washington, DC, USA Email : anthony.harrison@nrl.navy.mil Frank Tamborello, Naval
Overcoming Endocrine Resistance by Targeting ER/FoxA1/IL 8 Axis
2016-10-01
Nardone, Carmine De Angelis, Laura M. Heiser , Pavana Anur, Nicholas Wang, Catherine S. Grasso, Paul Spellman, Obi L. Griffith, Anna Tsimelzon...presentations Publications Fu X, Jeselsohn R, Pereira R, Hollingsworth EF, Creighton CJ, Li F, Shea M, Nardone A, Angelis CD, Heiser LM, Anur P, Wang N...performed the bioinformatics analysis of RNA-Seq and ChIP-Seq data. Name: Laura Heiser Project Role: Collaborator Nearest person month worked: 1
Anemia prevalence and treatment practice in patients with non-myeloid tumors receiving chemotherapy
Merlini,; Cartenì,; Iacobelli,; Stelitano,; Airoldi,Mairoldi; Balcke,Peter; Keil,Felix; Haslbauer,Ferdinand; Belton,Laura; Pujol,
2013-01-01
Laura Merlini,1 Giacomo Cartenì,2 Stefano Iacobelli,3 Caterina Stelitano,4 Mario Airoldi,5 Peter Balcke,6 Felix Keil,7 Ferdinand Haslbauer,8 Laura Belton,9 Beatriz Pujol10 1Department of Medical Oncology, Ospedale Civile S, Bortolo, Vicenza, 2Department of OncoHematology, Azienda Ospedaliera di Rilievo Nazionale "Antonio Cardarelli", Napoli, 3Department of Medical Oncology, Ospedale Clinicizzato SS Annunziata, Chieti, 4Department of Hematology, Azienda Ospedali...
Usaha La Sangkuru Patau Dalam Mengembangkan Agama Islam Di Kerajaan Wajo
Directory of Open Access Journals (Sweden)
Nasruddin Nasruddin
2014-12-01
Full Text Available La Sangkuru Patau is one of the Arung Matoa Wajo has substantial powers. His remarks could be a law and society Wajo stick to what he says. So when La Sangkuru Patau said that he had converted to Islam, the community participated Wajo also embraced Islam. Arung Matoa Wajo La Sangkuru with doing business in developing Islam in Wajo that bring Datu Sulaiman to provide Islamic religious instruction in public Wajo, then set up a sara officers' special charge of handling issues such royal Friday prayers, warnings Islamic holidays , then hold the officer cadre sara 'that will be placed outside the capital of the kingdom (Tosora, sara officers' given the facilities, such as free of taxes, as well as the parallel position to the position of indigenous stakeholders.
Druce, Courtney Danielle
2012-01-01
Commercially exploited threatened or endangered marine fish are consistently declined for listing under Canada’s Species at Risk Act (SARA), largely due to predicted socio-economic impacts associated with SARA’s prohibitions. However, commercial exploitation can be exempted from SARA’s general prohibitions. If exemptions were utilized, commercially exploited species could benefit from other aspects of SARA listing, and support continued economic opportunities for fishers. I conducted a litera...
International Nuclear Information System (INIS)
Blanc, R.; Bouriant, M.; Richaud, J.P.
1997-01-01
The target preparation group supplied a large number of samples to nuclear physicists for experiments using SARA and also other accelerators throughout the world. Particular preparation and projects include: 208 Pb, 116 Cd, 6 LiF, 123 Sb, In and Ta targets, strippers for SARA and GANIL, optical silicone disks for POLDER and GRAAL experiments, active participations for the AMS project and finally filament preparation for the GENEPI project. (authors)
Armstrong-Hough, Mari; Kishore, Sandeep P; Byakika, Sarah; Mutungi, Gerald; Nunez-Smith, Marcella; Schwartz, Jeremy I
2018-01-01
Although the WHO-developed Service Availability and Readiness Assessment (SARA) tool is a comprehensive and widely applied survey of health facility preparedness, SARA data have not previously been used to model predictors of readiness. We sought to demonstrate that SARA data can be used to model availability of essential medicines for treating non-communicable diseases (EM-NCD). We fit a Poisson regression model using 2013 SARA data from 196 Ugandan health facilities. The outcome was total number of different EM-NCD available. Basic amenities, equipment, region, health facility type, managing authority, NCD diagnostic capacity, and range of HIV services were tested as predictor variables. In multivariate models, we found significant associations between EM-NCD availability and region, managing authority, facility type, and range of HIV services. For-profit facilities' EM-NCD counts were 98% higher than public facilities (p < .001). General hospitals and referral health centers had 98% (p = .004) and 105% (p = .002) higher counts compared to primary health centers. Facilities in the North and East had significantly lower counts than those in the capital region (p = 0.015; p = 0.003). Offering HIV care was associated with 35% lower EM-NCD counts (p = 0.006). Offering HIV counseling and testing was associated with 57% higher counts (p = 0.048). We identified multiple within-country disparities in availability of EM-NCD in Uganda. Our findings can be used to identify gaps and guide distribution of limited resources. While the primary purpose of SARA is to assess and monitor health services readiness, we show that it can also be an important resource for answering complex research and policy questions requiring multivariate analysis.
Systems analysis programs for hands-on integrated reliability evaluations (SAPHIRE) version 5.0
International Nuclear Information System (INIS)
Russell, K.D.; Kvarfordt, K.J.; Skinner, N.L.; Wood, S.T.
1994-07-01
The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs), primarily for nuclear power plants. This volume is the reference manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA database contains PRA data primarily for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility databases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs that may be printed for reports. A preliminary version of the SARA program was completed in August 1985 and has undergone several updates in response to user suggestions and to maintain compatibility with the other SAPHIRE programs. Version 5.0 of SARA provides the same capability as earlier versions and adds the ability to process unlimited cut sets; display fire, flood, and seismic data; and perform more powerful cut set editing
Meissner, H.H.; Henning, P.H.; Horn, C.H.; Leeuw, K-J.; Hagg, F.M.; Fouché, G.
2010-01-01
Ruminal acidosis is discussed with reference to causes and economic and health implications. Distinction is made between the acute form which with proper adaptation to high energy diets is seldom encountered and the more problematic chronic or sub-acute form, commonly referred to as sub-acute ruminal acidosis (SARA). Apart from stepwise transition from roughage to concentrates, methods adopted to reduce SARA include grain treatment to reduce starch degradation, feed additives such as buffers ...
The Carolina Autism Transition Study (CATS)
2017-07-01
AWARD NUMBER: W81XWH-15-1-0093 TITLE: The Carolina Autism Transition Study (CATS) PRINCIPAL INVESTIGATOR: Laura Carpenter, MD RECIPIENT...Carolina Autism Transition Study (CATS) 5b. GRANT NUMBER W81XWH-15-1-0093 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER Laura Carpenter...provides a description of the Year 2 progress made and plans for Year 3 for the project entitled “The Carolina Autism Transition Study (CATS).” The goal of
Data to DecisionsTerminate, Tolerate, Transfer, or Treat
2016-07-25
and resources. Degradation of current capability continues. Transfer – Opportunities and Consequences: Requires a surgical knowledge of what...I N S T I T U T E F O R D E F E N S E A N A L Y S E S Data to Decisions—Terminate, Tolerate, Transfer , or Treat Laura A...Data to Decisions—Terminate, Tolerate, Transfer , or Treat For more information Laura Odell(lodell@ida.org, 703-845-2009 The Department
Sharing AIS Related Anomalies (SARA)
2016-03-01
78 6.3.7 SQL Versus NoSQL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 6.4 Data Processing...43 6.1 Overview of SQL and NoSQL differences, from [56]. . . . . . . . . . . . . . . . . . 82 A.1 Description of the ship anomaly upload use...constraints must be considered. These requirements, however, can only be defined when lower level implementation decisions, such as SQL versus NoSQL
Severe accident recriticality analyses (SARA)
DEFF Research Database (Denmark)
Frid, W.; Højerup, C.F.; Lindholm, I.
2001-01-01
with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality-both super-prompt power bursts and quasi steady-state power......Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies......, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g(-1), was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s(-1). In most cases, however, the predicted energy deposition was smaller, below...
Looking outside the (voice)box.
Gartrell, Nanette; Rothblum, Esther
2014-01-01
Laura S. Brown, PhD, is a clinical and forensic psychologist in independent practice in Seattle, Washington. The bulk of her scholarly work has been in the fields of feminist therapy theory, trauma treatment, lesbian and gay issues, assessment and diagnosis, ethics and standards of care in psychotherapy, and cultural competence. She has authored or edited ten professional books, including the award-winning Subversive Dialogues: Theory in Feminist Therapy, as well as more than 140 other professional publications. She has also recently published her first book for general audiences, Your turn for care: Surviving the aging and death of the adults who harmed you. Laura has been featured in five psychotherapy training videos produced by the American Psychological Association. She was President of American Psychological Association Divisions 35 (Society for the Psychology of Women), 44 (Society for the Psychological Study of Lesbian, Gay and Bisexual Issues), and 56 (Trauma Psychology). Laura was also President of the Washington State Psychological Association. She is the founder and Director of the Fremont Community Therapy Project, a low-fee psychotherapy training clinic in Seattle. In the fall of 2000, she was the on-site psychologist for the reality show Survivor: The Australian Outback. In 1987, Laura lost her voice and was diagnosed with spasmodic dysphonia. In 1988, she found her voice again.
Altered TGF-β endocytic trafficking contributes to the increased signaling in Marfan syndrome.
Siegert, Anna-Maria; Serra-Peinado, Carla; Gutiérrez-Martínez, Enric; Rodríguez-Pascual, Fernando; Fabregat, Isabel; Egea, Gustavo
2018-02-01
The main cardiovascular alteration in Marfan syndrome (MFS) is the formation of aortic aneurysms in which augmented TGF-β signaling is reported. However, the primary role of TGF-β signaling as a molecular link between the genetic mutation of fibrillin-1 and disease onset is controversial. The compartmentalization of TGF-β endocytic trafficking has been shown to determine a signaling response in which clathrin-dependent internalization leads to TGF-β signal propagation, and caveolin-1 (CAV-1) associated internalization leads to signal abrogation. We here studied the contribution of endocytic trafficking compartmentalization to increased TGF-β signaling in vascular smooth muscle cells (VSMC) from MFS patients. We examined molecular components involved in clathrin- (SARA, SMAD2) and caveolin-1- (SMAD7, SMURF2) dependent endocytosis. Marfan VSMC showed higher recruitment of SARA and SMAD2 to membranes and their increased interaction with TGF-β receptor II, as well as higher colocalization of SARA with the early endosome marker EEA1. We assessed TGF-β internalization using a biotinylated ligand (b-TGF-β), which colocalized equally with either EEA1 or CAV-1 in VSMC from Marfan patients and controls. However, in Marfan cells, colocalization of b-TGF-β with SARA and EEA1 was increased and accompanied by decreased colocalization with CAV-1 at EEA1-positive endosomes. Moreover, Marfan VSMC showed higher transcriptional levels and membrane enrichment of RAB5. Our results indicate that increased RAB5-associated SARA localization to early endosomes facilitates its TGF-β receptor binding and phosphorylation of signaling mediator SMAD2 in Marfan VSMC. This is accompanied by a reduction of TGF-β sorting into multifunctional vesicles containing cargo from both internalization pathways. Copyright © 2017 Elsevier B.V. All rights reserved.
Feminist film studies 40 years after ‘Visual Pleasure and Narrative Cinema’, a triologue
Laura Mulvey; Anna Backman Rogers; Annie van den Oever
2015-01-01
Forty years after the publication of her seminal essay ‘Visual Pleasure and Narrative Cinema’ in Screen, Laura Mulvey, together with Anna Backman Rogers, has edited Feminisms: Diversity, Difference, and Multiplicity in Contemporary Film Cultures, which is the latest instalment of The Key Debates series. NECSUS invited Laura Mulvey and Anna Backman Rogers to join Annie van den Oever, editor of NECSUS and series editor of The Key Debates, in a ‘triologue’, which in part reflects and re-empha...
Peranan Raja La Maddaremmeng Dalam Penyebaran Islam Di Bone
Directory of Open Access Journals (Sweden)
Nasruddin Nasruddin
2014-06-01
Full Text Available King Bone to Lamaddaremmeng XIII has a very large role and has the effect of early-early development of Islam in southern Sulawesi. He Maddaremeng is committed to enforce Sharia Law. His efforts were Eliminating slavery, Addition parewa Sara, to revamp the governance structure by adding positions previously unknown structure that positions parewa sara, eradication of idols, eliminating the arbitrary actions on others, Equal rights. Other efforts are trying to eliminate the differences in the degree of the community.
Management of Sub-acute Ruminal Acidosis in Dairy Cattle for Improved Production: A Review
Kafil Hussain; Amjad Ul Islam; Surinder Kumar Gupta
2011-01-01
Sub-acute ruminal acidosis (SARA) is a well-recognized digestive disorder that is an increasing health problem in most dairy herds. Feeding diets high in grain and other highly fermentable carbohydrates to dairy cows increases milk production, but also increases the risk of SARA. Sub-acute ruminal acidosis is defined as periods of moderately depressed ruminal pH, from about 5.5 to 5.0. Sub-acute ruminal acidosis may be associated with laminitis and other health problems resulting in decreased...
PREFACE: XIV Conference on Theoretical Nuclear Physics in Italy
Bombaci, I.; Covello, A.; Marcucci, L. E.; Rosati, S.
2014-07-01
This volume contains the invited and contributed papers presented at the 14th Conference on Theoretical Nuclear Physics in Italy held in Cortona, Italy, from 29-31 October, 2013. The meeting was held at the Palazzone, an elegant Renaissance Villa, commissioned by the Cardinal Silvio Passerini (1469-1529), Bishop of Cortona, and presently owned by the Scuola Normale Superiore di Pisa. The aim of this biennial Conference is to bring together Italian theorists working in various fields of nuclear physics to discuss their latest results and confront their points of view in a lively and informal way. This offers the opportunity to stimulate new ideas and promote collaborations between different research groups. The Conference was attended by 46 participants, coming from 13 Italian Universities and 11 Laboratories and Sezioni of the Istituto Nazionale di Fisica Nucleare - INFN. The program of the conference, prepared by the Organizing Committee (Ignazio Bombaci, Aldo Covello, Laura Elisa Marcucci and Sergio Rosati) focused on the following main topics: Few-Nucleon Systems Nuclear Structure Nuclear Matter and Nuclear Dynamics Relativistic Heavy Ion Collisions and Quark-Gluon Plasma Nuclear Astrophysics Nuclear Physics with Electroweak Probes Structure of Hadrons and Hadronic Matter. In the last session of the Conference there were two invited review talks related to experimental activities of great current interest. Giacomo De Angelis from the Laboratori Nazionali di Legnaro spoke about the INFN SPES radioactive ion beam project. Sara Pirrone, INFN Sezione di Catania, gave a talk on the symmetry energy and isospin physics with the CHIMERA detector. Finally, Mauro Taiuti (Università di Genova), National Coordinator of the INFN-CSN3 (Nuclear Physics Experiments), reported on the present status and future challenges of experimental nuclear physics in Italy. We gratefully acknowledge the financial support of INFN who helped make the conference possible. I Bombaci, A Covello
[Variation im heutigen Deutsch...] / Laura Tidrike
Tidrike, Laura
2008-01-01
Arvustus: Variation im heutigen Deutsch : Perspektiven für den Sprachunterricht / hrsg. v. Eva Neuland. Frankfurt am Main : Lang, 2006. (Sprache - Kommunikation - Kultur. Soziolinguistische Beiträge ; Vol. 4)
Wrox SharePoint 2010 SharePoint911 three-pack
Klindt, Todd; Mason, Jennifer; Rogers, Laura; Drisgill, Randy; Ross, John; Riemann, Larry; Perran, Amanda; Perran, Shane; Sanford, Jacob J; Stubbs, Paul; Caravajal, Steve
2012-01-01
The Wrox SharePoint 2010 SharePoint911 Three-Pack combines the contents of three full e-books written by the experts from SharePoint911. That's over 1800 pages of hands-on advice from Todd Klindt, Shane Young, Laura Rogers, Randy Drisgill, Jennifer Mason, John Ross, and Larry Riemann, among others. In Beginning SharePoint 2010: Building Business Solutions with SharePoint (ISBN 978-0-470-61789-2) by Amanda Perran, Shane Perran, Jennifer Mason, and Laura Rogers, readers learn the core concepts, terminology, and features of SharePoint 2010. In Professiona
Feminist film studies 40 years after ‘Visual Pleasure and Narrative Cinema’, a triologue
Directory of Open Access Journals (Sweden)
Laura Mulvey
2015-04-01
Full Text Available Forty years after the publication of her seminal essay ‘Visual Pleasure and Narrative Cinema’ in Screen, Laura Mulvey, together with Anna Backman Rogers, has edited Feminisms: Diversity, Difference, and Multiplicity in Contemporary Film Cultures, which is the latest instalment of The Key Debates series. NECSUS invited Laura Mulvey and Anna Backman Rogers to join Annie van den Oever, editor of NECSUS and series editor of The Key Debates, in a ‘triologue’, which in part reflects and re-emphasises the topics publicly discussed during the Feminisms symposia.
Edquist, Karl T.
2006-01-01
Comparisons are made between the LAURA Navier-Stokes code and Viking Lander Capsule hypersonic aerodynamics data from ground and flight measurements. Wind tunnel data are available for a 3.48 percent scale model at Mach 6 and a 2.75 percent scale model at Mach 10.35, both under perfect gas air conditions. Viking Lander 1 aerodynamics flight data also exist from on-board instrumentation for velocities between 2900 and 4400 m/sec (Mach 14 to 23.3). LAURA flowfield solutions are obtained for the geometry as tested or flown, including sting effects at tunnel conditions and finite-rate chemistry effects in flight. Using the flight vehicle center-of-gravity location (trim angle approx. equals -11.1 deg), the computed trim angle at tunnel conditions is within 0.31 degrees of the angle derived from Mach 6 data and 0.13 degrees from the Mach 10.35 trim angle. LAURA Mach 6 trim lift and drag force coefficients are within 2 percent of measured data, and computed trim lift-to-drag ratio is within 4 percent of the data. Computed trim lift and drag force coefficients at Mach 10.35 are within 5 percent and 3 percent, respectively, of wind tunnel data. Computed trim lift-to-drag ratio is within 2 percent of the Mach 10.35 data. Using the nominal density profile and center-of-gravity location, LAURA trim angle at flight conditions is within 0.5 degrees of the total angle measured from on-board instrumentation. LAURA trim lift and drag force coefficients at flight conditions are within 7 and 5 percent, respectively, of the flight data. Computed trim lift-to-drag ratio is within 4 percent of the data. Computed aerodynamics sensitivities to center-of-gravity location, atmospheric density, and grid refinement are generally small. The results will enable a better estimate of aerodynamics uncertainties for future Mars entry vehicles where non-zero angle-of-attack is required.
International Nuclear Information System (INIS)
Bratberg, D.; Hocker, S.
1994-01-01
The Superfund Act made anyone buying contaminated real estate liable for cleanup costs whether they know about the contamination or contributed to the contamination. In 1986, SARA amended the Superfund Act to include a provision known as the ''Innocent Landowner Defense.'' This provision created a defense for purchasers of contaminated property who did not contribute to the contamination and had no reason to believe that the property was contaminated at the time of the real estate transfer. SARA allows the purchasers and lenders to perform an environmental assessment using ''due diligence'' to identify contamination problems existing at a site. Since the passing of SARA, the environmental site assessment (ESA) process has become commonplace during the transfer of commercial real estate. Since the introduction of SARA, many professional associations, governmental agencies, and proposed federal legislation have struggled to produce a standard for conducting Phase 1 ESAs. Only recently has a standard been produced. Until recently, the domestic oil and gas industry has been relatively unconcerned about the Superfund liability issues. This approach was created by Congress's decision in 1980 to temporarily exempt the majority of oil and gas exploration and production wastes from federal hazardous waste rulings. However, new stringent rules governing oil and gas waste management practices are being considered by federal and state regulatory agencies. Based upon this knowledge and the awakening of public awareness, the use of ESAs for oil and gas transactions is increasing
The concentration principle applied to spaceborne solar arrays. AGORA mission: Studies synthesis
Laget, R.
1986-01-01
Studies that led to selection of the distributed 25 kW SARA LOUVRE concept for the solar cell generator to be flown on the AGORA asteroid mission, and the major characteristics of such a spaceborne solar array are summarized. In the SARA LOUVRE concept, a parabolic cross section reflector concentrates incident light over the rear face of the identical, preceding reflector dish. The whole set of reflectors is pivotally commanded, thus compensating the effects of depointing. Geometric concentration factor is 10. End of life power level at 2.5 AU is 4.5 kW.
Directory of Open Access Journals (Sweden)
Balamurugan eP
2015-08-01
Full Text Available Urinary Tract Infection (UTI is a globally widespread human infection caused by an infestation of uropathogens. Eventhough, Escherichia coli is often quoted as being the chief among them, Staphylococcus aureus involvement in UTI especially in gestational UTI is often understated. Staphylococcal accessory regulator A (SarA is a quorum regulator of S. aureus that controls the expression of various virulence and biofilm phenotypes. Since SarA had been a focussed target for antibiofilm agent development, the study aims to develop a potential drug molecule targeting the SarA of S. aureus to combat biofilm associated infections in which it is involved. In our previous studies, we have reported the antibiofilm activity of SarA based biofilm inhibitor, (SarABI with a 50% minimum biofilm inhibitory concentration (MBIC50 value of 200 µg/mL against S. aureus associated with vascular graft infections and also the antibiofilm activity of the root ethanolic extracts of Melia dubia against uropathogenic E. coli. In the present study, in silico design of a hybrid molecule composed of a molecule screened from M. dubia root ethanolic extracts and a modified SarA based inhibitor (SarABIM was undertaken. SarABIM is a modified form of SarABI where the fluorine groups are absent in SarABIM. Chemical synthesis of the hybrid molecule, 4-(Benzylaminocyclohexyl 2-hydroxycinnamate (henceforth referred to as UTI Quorum-Quencher, UTIQQ was then performed, followed by in vitro and in vivo validation. The MBIC¬50 and MBIC90 of UTIQQ were found to be 15 µg/mL and 65 µg/mL respectively. Confocal laser scanning microscopy (CLSM images witnessed biofilm reduction and bacterial killing in either UTIQQ or in combined use of antibiotic gentamicin and UTIQQ. Similar results were observed with in vivo studies of experimental UTI in rat model. So, we propose that the drug UTIQQ would be a promising candidate when used alone or, in combination with an antibiotic for staphylococcal
Properties of solar generators with reflectors and radiators
Ebeling, W. D.; Rex, D.; Bierfischer, U.
1980-06-01
Radiation cooled concentrator systems using silicon and GaAs cells were studied. The principle of radiation cooling by the reflector surfaces is discussed for cylindrical parabolic reflectors (SARA), truncated hexagonal pyramids, and a small trough configuration. Beam paths, collection properties for imperfect orientation, and thermal optimization parameters were analyzed. The three concentrating systems with radiation cooling offer advantages over the plane panel and over the large trough. With silicon solar cells they exhibit considerably lower solar cell consumption per Kw and also lower mass per kW. With GaAs cells the SARA system reduces the number of solar cells needed per kW to less than 10%. Also in all other cases SARA offers the best values for alpha and F sub sol, as long as narrow angular tolerances of the panel orientation can be met. Analysis of the energy collecting properties for imperfect orientation shows the superiority of the hexagonal concentrator. This device can produce power for even large angles between the sun and the panel normal.
1980 Annual status report: super-SARA
International Nuclear Information System (INIS)
1981-01-01
The essential tasks of the JRC for the SUPERSARA project during 1980 were therefore twofold: 1. Actuation of an international Task Force with which to: a. discuss in depth the test objectives and the relationships between the SSTP and the world mosaic of activities in the field of LWR fuel behaviour; b. establish a consensus test matrix; c. identify and discuss the major technological problems affecting the feasibility of attaining the consensus test objectives, especially for the boil-down SFD tests. A Task Force with these objectives was necessary in order to provide the elements for a Council decision on phase II. 2. Conservation of the rythm of the main contractor (UKAEA-Harwell) and subcontractors for the timely fabrication of loop components and the timely design of those new aspects of the plant necessary for the boil-down SFD tests
Gene : CBRC-SARA-01-0604 [SEVENS
Lifescience Database Archive (English)
Full Text Available and polyadenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82107.1| cleavage and poly...adenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82108.1| cleavage and polyadenylat...ion specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] 3e-16 77% MSTVPTVSCTS...TDRWGLVGTGRCYGSGRGGSMLASCGELSQAIALPKPVLSGHQAGSDPAGSSLYLVLPEGRCLPSVPAHVCPGTAEPAQHSQTPLQRELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVCPWAGVPRAGRPGPQAQPALSFRCMQWPPAPIRHAPASHA ...
Marcelo Moreno; Ricardo Castelão; Susana Orrico Peres; Suzana Margareth Lobo
2007-01-01
JUSTIFICATIVA E OBJETIVOS: A varicela é uma doença exantemática causada pela infecção primária do vírus varicela zoster (VVZ). A pneumonia pelo VVZ complicada com a síndrome da angústia respiratória aguda (SARA) é rara e associa-se a altas taxas de morbimortalidade. O objetivo deste estudo foi apresentar dois casos de pneumonia por varicela que evoluíram com SARA e outras disfunções orgânicas. RELATO DOS CASOS: Paciente de 15 anos, imunocomprometido com a síndrome da imunodeficiência adquirid...
Energy Technology Data Exchange (ETDEWEB)
Simoes, V.
2004-07-01
Investigating the Enigmatic Tower of Centum Celas, in it, the Precepts of the Doric Order of the Greek Architecture: the Pentagram, of the Divine Proportion, (the golden number: ? = 1,618); the Thermic Comfort of the Veranda Porch;. Near Centum Celas I discovered a primitive Greek Temple of same period (C. VI cent, B. C.), in the Lusitanian Gold and Tin Route Archetypes of the Patrimony of Human Childhood. In my opinion, our historians and archiologists have paid little attention to the migrations of what I call the Si(self) Arian of the Euro-Asian steppes, to the Neolithic's Communities of the Middle East and which was by them baptised Iberia. However the Si (self) Ariano turns European, with a man mutation, with the Greek thalassocracy, from Asian Troya to Occident Troia, where the Tagus flows into the sea. (Author)
Talendid, kes tulid tagasi koju / Laura Mallene
Mallene, Laura
2010-01-01
IsePankuri asutajast Pärtel Tombergist, start-up firmaga Cutefund tegelevast Enn Metsarist, riigikantselei EL-i sekretariaadi konsultandist Katrin Juhandist, Küberkaitse Kompetentsikeskuse töötajast Anna-Maria Talihärmist, LHV Turunduse töötajast Ellen Murulast, Elioni finantsanalüütikust Artur Elmest
Directory of Open Access Journals (Sweden)
Díaz, Liliana
2014-10-01
Full Text Available TORRE, Claudia, El otro desierto de la nación argentina. Antología de narrativa expedicionaria, Bernal, Argentina, Editorial Universidad de Quilmes, 2011, 387 pp. MAURO, Diego y LICHTMAJER, Leandro (compiladores, Los costos de la política. Del Centenario al primer peronismo, Imago Mundi, Buenos Aires, 2014, 130 pp. DE MARCO; Miguel Ángel (h. Ciudad Puerto, Universidad y Desarrollo Regional, Rosario, 1919-1968. CEHDRE, Rosario, 2013, 542 pp. GUARDIA, Sara Beatriz. Primer Congreso Internacional. Las mujeres en los procesos de Independencia de América Latina. Lima, Perú. Sara Beatriz Guardia Edición, CEMHAL, UNESCO, USMP, 2014. 495 pp
International Nuclear Information System (INIS)
Siegel, M.R.
1990-01-01
The Superfund Amendments and Reauthorization Act (SARA) of 1986 greatly expanded the health authority of the Comprehensive Environmental Response, Compensation, and Liability Act. One of the federal agencies most affected by SARA is the Agency for Toxic Substances and Disease Registry (ATSDR) of the U.S. Public Health Service. Among other responsibilities, ATSDR was mandated to conduct health assessments within strict time frames for each site on or proposed for the U.S. Environmental Protection Agency's National Priorities List. The author will review ATSDR's efforts to address this new statutory mandate, especially for federal facilities, and will focus on different conceptual frameworks for implementing the health assessment program
A survey of formal methods for determining functional joint axes.
Ehrig, Rainald M; Taylor, William R; Duda, Georg N; Heller, Markus O
2007-01-01
Axes of rotation e.g. at the knee, are often generated from clinical gait analysis data to be used in the assessment of kinematic abnormalities, the diagnosis of disease, or the ongoing monitoring of a patient's condition. They are additionally used in musculoskeletal models to aid in the description of joint and segment kinematics for patient specific analyses. Currently available methods to describe joint axes from segment marker positions share the problem that when one segment is transformed into the coordinate system of another, artefacts associated with motion of the markers relative to the bone can become magnified. In an attempt to address this problem, a symmetrical axis of rotation approach (SARA) is presented here to determine a unique axis of rotation that can consider the movement of two dynamic body segments simultaneously, and then compared its performance in a survey against a number of previously proposed techniques. Using a generated virtual joint, with superimposed marker error conditions to represent skin movement artefacts, fitting methods (geometric axis fit, cylinder axis fit, algebraic axis fit) and transformation techniques (axis transformation technique, mean helical axis, Schwartz approach) were classified and compared with the SARA. Nearly all approaches were able to estimate the axis of rotation to within an RMS error of 0.1cm at large ranges of motion (90 degrees ). Although the geometric axis fit produced the least RMS error of approximately 1.2 cm at lower ranges of motion (5 degrees ) with a stationary axis, the SARA and Axis Transformation Technique outperformed all other approaches under the most demanding marker artefact conditions for all ranges of motion. The cylinder and algebraic axis fit approaches were unable to compute competitive AoR estimates. Whilst these initial results using the SARA are promising and are fast enough to be determined "on-line", the technique must now be proven in a clinical environment.
Meie igapäevane paanika / Ott Karulin
Karulin, Ott, 1980-
2007-01-01
Kahest Vanemuise teatri lavastusest Tartus - Saksa Kultuuri Instituudis etendunud Ingvar Ambjornseni-Axel Hellsteniuse "Elling" Ain Mäeotsa lavastuses ja Laura Cunninghami "Beautiful Bodies" Vanemuises, lavastaja Jüri Lumiste
Iga maastik on hingeseisund = Every landscape is a condition of the spirit / Piret Karro
Karro, Piret, 1991-
2016-01-01
Laura Põllu isiknäitus "Sada ulma keset merd" Tartu Kunstimuuseumis (Tartmusis). Ruumiinstallatsioonis on kombineeritud maali-, video-, skulptuuri- ja tekstilahendusi. Helikujunduse autor on Juhan Vihterpal, kuraator Peeter Talvistu
Noortenäidend kulgeb teismeliste tempos / Sandra Sillaots
Sillaots, Sandra
2009-01-01
Pärnu Endla teatris etendunud lavastusest "Oma elu superstaarid". Autorid Triinu ja Laura-Marie Ojalo, lavastaja Enn Keerd, kunstnik Tuulikki Ojalo. Ka peategelase Eliis Vaiksaare (Lenna) osatäitmisest
Cavicchi, Elizabeth Mary
Physics is conventionally taught as a fixed curriculum which students must master. This thesis changes that: curriculum emerges from what learners try and question in experiments they invent. The thesis narrates: three adult students exploring wires, batteries and bulbs with me as teacher; nineteenth century investigations of electromagnetism; my laboratory work replicating historic instruments. In each case, learning arose through activity with materials. Evidences of this are analyzed within narratives and reflections. I used teaching-research, a method developed by Duckworth from Piaget's clinical interviewing, to research and simultaneously extend students' evolving understandings. What I learned through questioning students informed my next interactions; what they learned extended their experimenting. Similarly, I researched historical accounts interactively: improvising experiments to develop my understandings. Studying my own learning deepened my interpretations of students' learning. My students Laura, David and Jamie experimented by: soldering bulbs to wires, making series and parallel circuits, inserting resistive wire that dimmed bulbs, conducting electricity through salt water They noticed bulb brightness and battery heat, compared electricity's paths, questioned how voltage and current relate. They inferred electricity's effects manifest magnitudes of material properties. They found their experiences while learning were inseparable from what they learned. I researched investigations connected with Cavendish's leather fish, Galvani's frogs, Schweigger's wire spiraled around a compass needle, Henry's electromagnets, Faraday's induction ring, induction devices of Page, Callan, Hearder. Experimentally, I made galvanometers, electromagnets, induction rings, induction coil. I observed effects of electromagnetism, internal resistance, induced sparking. Across these investigations, learning developed with instrumental innovations; confusions were productive
Veterinary and human medicine: learning from each other.
Honey, Laura
2016-03-26
A well-attended session at this year's joint SPVS/VPMA congress considered what lessons the medical and veterinary professions might learn from one another. Laura Honey reports. British Veterinary Association.
Charting Transnational Native American Studies
Directory of Open Access Journals (Sweden)
Hsinya Huang
2012-06-01
Full Text Available Introduction to the Special Forum entitled "Charting Transnational Native American Studies: Aesthetics, Politics, Identity," edited by Hsinya Huang, Philip J. Deloria, Laura M. Furlan, and John Gamber
Ülemaaline ilulugejate 15. võistulausumine
2008-01-01
Vabariiklikust etlejate konkursist. 4.-6. klasside arvestuses võitis Grand Prix'i Markkus Pulk, laureaatideks tulid Maria Pihlak, Kenneth Norden ja Laura Elisabeth Konsand. Eripreemiad said Laura Oolup, Maria Zaitseva, žürii aitähi said Sander Aavik ja Liisa Lutter. 7.-9. klasside arvestuses võitis Grand Prix' Anna Talvi, laureaatideks tulid Liisa Saaremäel, Karmen Kozma, Riko Osila. Eripreemiad said Indrek Jõe, Eliise Seedre, žürii aitähi sai Kirke Algma. 10.-12. klasside arvestuses võitis Grand Prix' Doris Tääker, laureaatideks tulid Jörgen Liik, Virgo Ernits ja Ilja Massalov. eripreemiad said Marian Heinat ja Kadri Toomsalu. Kuressaare Gümnaasiumi õpilasžürii preemiad läksid Kenneth Nordenile, Riko Osilale ja Doris Tääkerile
Violence, Oppression, and Double Standards in Three Colombian Films
Directory of Open Access Journals (Sweden)
Melissa R. Meade
2011-08-01
Full Text Available This article compares three Colombian films that tell distinct stories of violence, personal and political oppression, and double standards. The films Confesión a Laura (Confessing to Laura, Jaime Osorio, 1991, La Primera Noche (The First Night, Luis Alberto Restrepo, 2003 and El Rey (The King, José Antonio Dorado, 2004 each highlight the characters’ struggles in the Colombian socio-political landscape. Each film’s content and themes do not merely offer representations of national culture, but also provide a way in which to discuss the political and social struggles of Colombia. The directors explore these stories of violence and socio-political struggle through the use of mis-en-scène, cinematography, sound, and editing.
the capacity of megasphaera elsdenii strain ncimb 41125 to control ...
African Journals Online (AJOL)
David
SARA include grain treatment to reduce starch degradation, feed additives such as ... Keywords: Megasphaera elsdenii, ruminal acidosis, dairy cattle, beef cattle, sheep, ...... Mastitis. Retained foetal membranes. Metritis/endometritis. Ketosis.
2001-01-01
Kuraator Rael Artel. Väljas on Laura Kallasvee "I love labels", Maiu Kurvitsa kontseptuaalne projekt "Odav jutt", Peeter Lauritsa "Paabeli torn" (1991), tundmatu kunstniku tekstiilist käsitöötoode.
2011-03-02
... Collins, Sara Jane, University of Oklahoma, Cherokee Nation, Oklahoma Cook, David D., Rocky Vista... University, Oglala Sioux Tribe of the Pine Ridge Reservation, South Dakota Jim, Leroy, The Fielding Institute...
Südames on armastuse kodu / Lembit Peterson, Marius Peterson
Peterson, Lembit, 1953-
2006-01-01
Theatrumis tuleb lavale Karol Wojtyla (Paavst Johannes Paulus II) kirjutatud näidend "Juveliiri poe ees". Lavastuses osaleb pea kogu perekond Petersonid. Laura, Marius, Mare, Maria ja Lembit Peterson endast ja peresidemetest
PENi kirjandusauhinnad selgunud : [sõnum
2002-01-01
Nabokovi-preemia Mario Vargas Llosale; Laura Pelsi auhind Tony Kushnerile ja Maria Irene Fornesile; uudsena noortele kirjanike määratava Robert Binghami auhinna saavad Carolyn Cooke, Matthew Klam ja Manil Suri
Tartust pärit eurolauljate võiduvõimalused vähenesid / Karin Palo
Palo, Karin
2005-01-01
Tänavusest Eesti Eurovisiooni finaalist, lauljast Laura Põldverest lauludega "Moonwalk ja "Let's Get Loud" (viimane ansambli Suntribe koosseisus)" ja Julia Bomani esitatud laulu "Nevermore Island" väljajätmisest finaalvõistlusest
Kaila, Jan
2013-01-01
Paul Kuimeti ja Mika Rikala ühisnäitusest "Clouds and Waves" Hobusepea galeriis. Aliina Astrova kuraatoriettekanne Paul Kuimeti ja Laura Tootsi ühisnäitusel "Not Necessarily So" Temnikova & Kasela galeriis
Energy Technology Data Exchange (ETDEWEB)
Falla Sotelo, F.; Araujo Pantoja, P.; Lopez-Gejo, J.; Le Roux, G.A.C.; Nascimento, C.A.O. [Universidade de Sao Paulo (USP), SP (Brazil). Dept. de Engenharia Quimica. Lab. de Simulacao e Controle de Processos; Quina, F.H. [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Quimica. Centro de Capacitacao e Pesquisa em Meio Ambiente (CEPEMA)
2008-07-01
The objective of the present work is to evaluate the performance of two spectroscopic techniques employed in the crude oil characterization: NIR spectroscopy and fluorescence spectroscopy (Synchronous fluorescence - SF and Time Resolved Fluorescence - TRF) for the development of correlation models between spectral profiles of crude oil samples and both physical properties (viscosity and API density) and physico-chemical properties (SARA analysis: Saturated, Aromatic, Resins and Asphaltenes). The better results for viscosity and density were obtained using NIR whose prediction capacity was good (1.5 cP and 0.5 deg API, respectively). For SARA analysis, fluorescence spectroscopy revealed its potential in the model calibration showing good results (R2 coefficients greater than 0.85). TRF spectroscopy had better performance than SF spectroscopy. (author)
Bacteriophage-antibiotic synergism to control planktonic and biofilm ...
African Journals Online (AJOL)
Bacteriophage-antibiotic synergism to control planktonic and biofilm producing clinical isolates of Pseudomonas aeruginosa. Amina Amal Mahmoud Nouraldin, Manal Mohammad Baddour, Reem Abdel Hameed Harfoush, Sara AbdelAziz Mohamed Essa ...
The Rethorics of Gaze in Luhrmann's "Postmodern Great Gatsby"
Directory of Open Access Journals (Sweden)
Paola Fallerini
2014-05-01
Adopting the perspective suggested by the rhetoric of the gaze (Laura Mulvey it is highlighted the metalinguistic and metatextual reflection through which this movie contributes to the critical interpretation of Fitzgerald’s novel.
Avestik, Rait, 1974-
2007-01-01
Vastukaja "Eesti Ekspressi" kultuurilisas "Areen" ilmunud Liina Jürgeni kirjutisele, kus autor veebipäeviku vormis kajastas Vanemuises etendunud ameerika kirjaniku Laura Cunninghami tragikomöödiat "Beautiful Bodies", lavastaja Jüri Lumiste
Directory of Open Access Journals (Sweden)
О С Чеснокова
2008-03-01
Full Text Available The article focuses on the comparison of the translations of the novel «Como agua para chocolate» (1989 by Laura Esquivel into Russian and English and their semiotic manifestations.
75 FR 48880 - Approval and Promulgation of Gila River Indian Community's Tribal Implementation Plan
2010-08-12
... in August 1995 by then-Governor Mary Thomas. Beginning in 1998, the GRIC DEQ, with assistance from.... See Letter dated June 22, 2009, from Margaret Cook, Executive Director, GRIC DEQ, to Laura Yoshii...
Directory of Open Access Journals (Sweden)
Siti Hajariah
2017-08-01
Full Text Available Abstrak. Action telah memantapkan dirinya sebagai salah satu genre terkemuka yang telah hadirdi industri film untuk waktu yang lama. Meskipun film aksi sering kali diidentifikasi dengan filmproduksi Hollywood, dan disebut sebagai state-of-the-art dari film aksi, film Jmaes Bond,bagaimanapun, adalah pertama dan terutama adalah produk Inggris. Bergenre action, film iniditandai sebagai film berorientasi laki-laki (Tasker 2004: 8 sementara itu melalui esainya VisualPleasure and Narrative Cinema” oleh Laura Mulvey (1975 mengingatkan kita pada bagianpenting yang dimainkan oleh isu gender dan kritik film yang feminis, dalam analisis film aksi.Makalah ini membahas perkembangan film laga atau aksi dalam proses untuk membangunkarakter heroik perempuan, yang menunjukkan gagasan perempuan 'maskulinitas', istilah yangdiciptakan oleh Tasker (1993. Penguatan kode biner gender telah diteliti pada film-film aksiyang mengarah ke argumen pada identifikasi pemberdayaan atau eksploitasi dalam aksi yangdipilih teks filmis dari 2010 dan 2011. Perempuan Berdasarkan teori Laura Mulvey padapandangan laki-laki, analisis skrining tubuh di film action berkisar pada aspek narasi, dansinematografi film yang dipilih: Salt (Phillip Noyce, 2010.Abstrak. Action telah memantapkan dirinya sebagai salah satu genre terkemuka yang telah hadirdi industri film untuk waktu yang lama. Meskipun film aksi sering kali diidentifikasi dengan filmproduksi Hollywood, dan disebut sebagai state-of-the-art dari film aksi, film Jmaes Bond,bagaimanapun, adalah pertama dan terutama adalah produk Inggris. Bergenre action, film iniditandai sebagai film berorientasi laki-laki (Tasker 2004: 8 sementara itu melalui esainya VisualPleasure and Narrative Cinema” oleh Laura Mulvey (1975 mengingatkan kita pada bagianpenting yang dimainkan oleh isu gender dan kritik film yang feminis, dalam analisis film aksi.Makalah ini membahas perkembangan film laga atau aksi dalam proses untuk membangunkarakter heroik
Kahu, Tõnis, 1962-
2008-01-01
Heliplaatidest: Get Cape. Wear Cape. Fly "Searching For The Hows And Whys", The Black Crowes "Warpaint", Jonny Greenwood "There Will Be Blood", Tegan & Sara "The Con", Teräsbetoni "Myrskyntuoja", REM "Accelerate"
Hella hingega karmid naised / Krista Kaer
Kaer, Krista
1996-01-01
Tänapäeva kriminaalromaani inglise ja ameerika autoritest (Dame Phyllis Dorothy James, Joan Smith, Lynda La Plante (inglise); Sara Paretsky, Sue Grafton, Patricia Cornwell (ameerika) ja nende poolt loodud naisdetektiivi kujudest
Policy challenges in modern health care
National Research Council Canada - National Science Library
Mechanic, David
2005-01-01
... for the Obesity Epidemic KENNETH E. WARNER 99 8 Patterns and Causes of Disparities in Health DAVID R. WILLIAMS 115 9 Addressing Racial Inequality in Health Care SARA ROSENBAUM AND JOEL TEITELBAU...
Toomas Kalve : Kontakt-impressioonid = Contact-impressions / Laura Kuusk
Kuusk, Laura, 1982-
2007-01-01
1990-ndatel hakkas fotograafia omandama täisväärtusliku kunstiliigi rolli. Kunstnikuna tegeleb Toomas Kalve mustvalge fotoga ning tema tööde puhul on oluline roll kasutataval autoritehnoloogial. Ta pildistab plaatkaameraga, mille vanimad negatiivid on aastast 1939 ja Pariisis käsitsi lihvitud objektiiv kannab aasta numbrit 1872. Näitusele jõuavad negatiividest tehtud kontaktkoopiad. Fotografeerimine on tema jaoks rituaal, tema tehika ja töömeetodid on olnud kasutusel fotograafia leiutamisest alates ja samasugune staatilisus õhkub ka tema pruunitoonilistest piltidest. Tema tööd on läbimõeldud, ülimalt komponeeritud, lavastuslikud ning mängulised, hetk ei ole tema jaoks kahanev väärtus, vaid lõpmatu konstant
Walter Benjamin i l'aura de l'autobiografia
Martí Monterde, Antoni, 1968-
2006-01-01
És la biblioteca una forma d'autobiografia? Només caldria un sol escrit que ho demostrés de manera plena per a afirmar que sí, i aquest text el va escriure Walter Benjamin, qui el 17 de juliol de 1931 va publicar, a Die literarische Welt, 'un discurs sobre el col·leccionisme' sota el títol 'Tot desembolicant la meua biblioteca'.
Kohastumus eluks vee ääres / Laura Kuusk
Kuusk, Laura, 1982-
2007-01-01
4. "Ars Baltica" fototriennaal Kumu Kunstimuuseumis kuni 30. IX. Tellervo Kalleineni ja Oliver Kochta-Kalleineni, Alexander Vaindorfi, Coloneli (Thierry Geoffroy) ja Khaled D. Ramadani, Kaspars Goba, Tanja Nellemann Poulseni, Katrin Teesi, Anu Pennaneni, Petra Baueri, Talleiv Taro Manumi (sünd. 1968 Jaapanis, elab Norras), Olga Tshernõsheva, Kristina Inciuraite, Julita Wojciki, Sven Johne, Anna Baumgarti, Arturas Valiauga ja duo J&K (Janne Schäfer, Kristine Agergaard) töödest
Pedro Meyer vastutab oma piltide eest / Laura Kuusk
Kuusk, Laura, 1982-
2007-01-01
Mehhiko fotograafi Pedro Meyeri tutvustus. P. Meyeri ettekande tekst "Kui dokumentaalne teile meeldis, siis digitaalset hakkate armastama", esitatud Soomes Jyväskyläs 2006. a. oktoobris toimunud fotograafiakonverentsil
People, art and the human environment / Laura Kuusk
Kuusk, Laura, 1982-
2009-01-01
Tutvustatakse Eestis toimunud kunstiprojekte, mis on seotud kunstipraktika, igapäevase elu, inimsuhete ja avaliku ruumiga. Sirja-Liisa Vahtra ja Otto von Buschi kunstiprojektist (2004), Martin Pääsukese plakatitest "Vabadus" linnaruumis (2008), Ave Teeääre ja Kertu Ehala projektist "Painting Club" Ravila hooldekodus (2007), rühmituse Johnson&Johnson "Paldiski projektist" (2006-2008), Riin Kranna-Rõõsi ja Eve Arpo projektist "Päev ilma mobiilita". Kunstnikest, kes on dokumenteerinud Tallinnas toimunud aktsioone. Kunsti ja sotsiaalset praktikat ühendavatest institutsioonidest (kultuuritehas Polymer, Kultuurikatel, Linnalabor jt.)
Notes on Paul Kuimet / Pille Epner
Epner, Pille
2011-01-01
Fotograaf Paul Kuimetist, tema loomingust, Tallinnas Hobusepea galeriis toimunud isikunäitusest "In Vicinity" (2010), mis uuris valglinnastumist, kohaspetsiifilisest installatsioonist "Untitled" (2010) ja näitusest "Not Necessarily So" (koos Laura Tootsiga, 2010) Linzis
Ernesto Preatoni soovis end 100 miljoni eest vabaks osta / Risto Berendson
Berendson, Risto, 1975-
2004-01-01
Prokurör Laura Vaik põhjendab, miks ta loobus tema enda ja Itaalia ärimehe Ernesto Preatoni advokaatide vahel sõlmitud esialgsest kokkuleppest, mille kohaselt oleks Preatoni maksnud riigile kokku 100 mln krooni
Kurjade bakterite kõrvalmõju / Villu Zirnask
Zirnask, Villu, 1966-
2012-01-01
Alessandra Fogli Minnesota ülikoolist ning Laura Veldkamp Sterni ärikoolist kirjeldasid oma uuringus "Germs, social networks and growth" inimkontakti kaudu levivate haiguste esinemissageduse abil ühiskonna sotsiaalset struktuuri ning selle seost tehnoloogiate levimisega
Living with Crohn's Disease | NIH MedlinePlus the Magazine
... courtesy of Laura King Benjamin King, star of Disney Channel's hit TV series Liv and Maddie , helps ... root in so many homes that watch the Disney Channel and have children—especially considering the number ...
Asano, Masanari; Basieva, Irina; Khrennikov, Andrei; Ohya, Masanori; Tanaka, Yoshiharu; Yamato, Ichiro
2015-10-01
We discuss foundational issues of quantum information biology (QIB)—one of the most successful applications of the quantum formalism outside of physics. QIB provides a multi-scale model of information processing in bio-systems: from proteins and cells to cognitive and social systems. This theory has to be sharply distinguished from "traditional quantum biophysics". The latter is about quantum bio-physical processes, e.g., in cells or brains. QIB models the dynamics of information states of bio-systems. We argue that the information interpretation of quantum mechanics (its various forms were elaborated by Zeilinger and Brukner, Fuchs and Mermin, and D' Ariano) is the most natural interpretation of QIB. Biologically QIB is based on two principles: (a) adaptivity; (b) openness (bio-systems are fundamentally open). These principles are mathematically represented in the framework of a novel formalism— quantum adaptive dynamics which, in particular, contains the standard theory of open quantum systems.
Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...
Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...
Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...
Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Kayvan Etebari1 Leila Matindoost2. Department of Sericulture, Faculty of Natural Resources, University of Guilan, Somehe Sara, Iran; Department of Entomology, Faculty of Agriculture, University of Guilan, Rasht, Iran ...
Comentario bibliográfico de La revisión judicial de las políticas sociales. Estudio de Caso
Directory of Open Access Journals (Sweden)
Bulit Goñi, Magdalena
2011-12-01
Full Text Available Comentario bibliográfico de ABRAMOVICH, Víctor y PAUTASSI, Laura (comp.: La revisión judicial de las políticas sociales. Estudio de casos, Editores del Puerto, Buenos Aires, 2009.
Subacute ruminal acidosis reduces sperm quality in beef bulls.
Callaghan, M J; McAuliffe, P; Rodgers, R J; Hernandez-Medrano, J; Perry, V E A
2016-08-01
Breeding bulls are commonly fed high-energy diets, which may induce subacute ruminal acidosis (SARA). In this experiment, 8 Santa Gertrudis bulls (age 20 ± 6 mo) were used to evaluate the extent and duration of effects of SARA on semen quality and the associated changes in circulating hormones and metabolites. The bulls were relocated and fed in yards with unrestricted access to hay and daily individual concentrate feeding for 125 d before SARA challenge. Semen was collected and assessed at 14-d intervals before the challenge to ensure acclimatization and the attainment of a stable spermiogram. The challenge treatments consisted of either a single oral dose of oligofructose (OFF; 6.5 g/kg BW) or an equivalent sham dose of water (Control). Locomotion, behavior, respiratory rate, and cardiovascular and gastrointestinal function were intensively monitored during the 24-h challenge period. Rumen fluid samples were retained for VFA, ammonia, and lactate analysis. After the challenge, semen was then collected every third day for a period of 7 wk and then once weekly until 12 wk, with associated blood collection for FSH, testosterone, inhibin, and cortisol assay. Percent normal sperm decreased in bulls dosed with OFF after the challenge period ( < 0.05) and continued to remain lower on completion of the study at 88 d after challenge. There was a corresponding increase in sperm defects commencing from 16 d after challenge. These included proximal cytoplasmic droplets ( < 0.001), distal reflex midpieces ( = 0.01), and vacuole and teratoid heads ( < 0.001). Changes in semen quality after challenge were associated with lower serum testosterone ( < 0.001) and FSH ( < 0.05). Serum cortisol in OFF bulls tended to be greater ( = 0.07) at 7 d after challenge. This study shows that SARA challenge causes a reduction in sperm quality sufficient to preclude bulls from sale as single sire breeding animals 3 mo after the event occurred.
Directory of Open Access Journals (Sweden)
Marcelo Moreno
2007-03-01
Full Text Available JUSTIFICATIVA E OBJETIVOS: A varicela é uma doença exantemática causada pela infecção primária do vírus varicela zoster (VVZ. A pneumonia pelo VVZ complicada com a síndrome da angústia respiratória aguda (SARA é rara e associa-se a altas taxas de morbimortalidade. O objetivo deste estudo foi apresentar dois casos de pneumonia por varicela que evoluíram com SARA e outras disfunções orgânicas. RELATO DOS CASOS: Paciente de 15 anos, imunocomprometido com a síndrome da imunodeficiência adquirida (SIDA e uma paciente do sexo feminino imunocompetente, foram admitidos na UTI com quadro clínico de varicela, SARA, trombocitopenia e acidose graves. Além disso, disfunção cardiovascular e falência renal ocorreram no primeiro e segundo casos, respectivamente. Foram tratados com aciclovir além de ventilação mecânica protetora. CONCLUSÕES: Os dois casos de pneumonia por varicela, que apresentaram SARA e disfunções de múltiplos órgãos, obtiveram boa evolução clínica.BACKGROUNG AND OBJECTIVES: Varicella is an exantematic disease caused by varicella-zoster virus. Varicella pneumonia complicated with acute respiratory distress syndrome (ARDS is very rare in adults and is associated with high morbimortality. We report two cases of ARDS secondary to varicella-zoster virus pneumonia. CASES REPORT: We report two cases of ARDS and multiple organ dysfunction syndrome (MODS secondary to varicella-zoster virus pneumonia. A 15-year-old man with human immunodeficiency virus (HIV infection and a 29-year-old immunocompetent female were admitted in the ICU with primary varicella infection and pneumonia. Both cases progressed towards ARDS, severe thrombocytopenia and acidosis. In addition cardiovascular and renal failure occurred in the first and second patients, respectively. Treatment consisted of immediate administration of intravenous acyclovir and a lung-protective ventilation strategy. CONCLUSIONS: Both cases of varicella
Sigma Factor SigB Is Crucial to Mediate Staphylococcus aureus Adaptation during Chronic Infections.
Directory of Open Access Journals (Sweden)
Lorena Tuchscherr
2015-04-01
Full Text Available Staphylococcus aureus is a major human pathogen that causes a range of infections from acute invasive to chronic and difficult-to-treat. Infection strategies associated with persisting S. aureus infections are bacterial host cell invasion and the bacterial ability to dynamically change phenotypes from the aggressive wild-type to small colony variants (SCVs, which are adapted for intracellular long-term persistence. The underlying mechanisms of the bacterial switching and adaptation mechanisms appear to be very dynamic, but are largely unknown. Here, we analyzed the role and the crosstalk of the global S. aureus regulators agr, sarA and SigB by generating single, double and triple mutants, and testing them with proteome analysis and in different in vitro and in vivo infection models. We were able to demonstrate that SigB is the crucial factor for adaptation in chronic infections. During acute infection, the bacteria require the simultaneous action of the agr and sarA loci to defend against invading immune cells by causing inflammation and cytotoxicity and to escape from phagosomes in their host cells that enable them to settle an infection at high bacterial density. To persist intracellularly the bacteria subsequently need to silence agr and sarA. Indeed agr and sarA deletion mutants expressed a much lower number of virulence factors and could persist at high numbers intracellularly. SigB plays a crucial function to promote bacterial intracellular persistence. In fact, ΔsigB-mutants did not generate SCVs and were completely cleared by the host cells within a few days. In this study we identified SigB as an essential factor that enables the bacteria to switch from the highly aggressive phenotype that settles an acute infection to a silent SCV-phenotype that allows for long-term intracellular persistence. Consequently, the SigB-operon represents a possible target to develop preventive and therapeutic strategies against chronic and therapy
Sigma Factor SigB Is Crucial to Mediate Staphylococcus aureus Adaptation during Chronic Infections.
Tuchscherr, Lorena; Bischoff, Markus; Lattar, Santiago M; Noto Llana, Mariangeles; Pförtner, Henrike; Niemann, Silke; Geraci, Jennifer; Van de Vyver, Hélène; Fraunholz, Martin J; Cheung, Ambrose L; Herrmann, Mathias; Völker, Uwe; Sordelli, Daniel O; Peters, Georg; Löffler, Bettina
2015-04-01
Staphylococcus aureus is a major human pathogen that causes a range of infections from acute invasive to chronic and difficult-to-treat. Infection strategies associated with persisting S. aureus infections are bacterial host cell invasion and the bacterial ability to dynamically change phenotypes from the aggressive wild-type to small colony variants (SCVs), which are adapted for intracellular long-term persistence. The underlying mechanisms of the bacterial switching and adaptation mechanisms appear to be very dynamic, but are largely unknown. Here, we analyzed the role and the crosstalk of the global S. aureus regulators agr, sarA and SigB by generating single, double and triple mutants, and testing them with proteome analysis and in different in vitro and in vivo infection models. We were able to demonstrate that SigB is the crucial factor for adaptation in chronic infections. During acute infection, the bacteria require the simultaneous action of the agr and sarA loci to defend against invading immune cells by causing inflammation and cytotoxicity and to escape from phagosomes in their host cells that enable them to settle an infection at high bacterial density. To persist intracellularly the bacteria subsequently need to silence agr and sarA. Indeed agr and sarA deletion mutants expressed a much lower number of virulence factors and could persist at high numbers intracellularly. SigB plays a crucial function to promote bacterial intracellular persistence. In fact, ΔsigB-mutants did not generate SCVs and were completely cleared by the host cells within a few days. In this study we identified SigB as an essential factor that enables the bacteria to switch from the highly aggressive phenotype that settles an acute infection to a silent SCV-phenotype that allows for long-term intracellular persistence. Consequently, the SigB-operon represents a possible target to develop preventive and therapeutic strategies against chronic and therapy-refractory infections.
Investigating Asphaltenes Composition in Crude Oil Samples using ...
African Journals Online (AJOL)
MBI
2015-12-22
Dec 22, 2015 ... composition of asphaltenes by Iatroscan TLC-FID method was compared with the weight% of asphaltenes precipitated. ... SARA in the crude oil samples were determined in this work ..... Fractionation and characterization of.
Mind Over Matter: Methamphetamine
... Teaching Guide and Series / Methamphetamine Mind Over Matter: Methamphetamine (Meth) Print Order Free Publication in: English Spanish ... paranoia, aggressiveness, and hallucinations. The Brain's Response to Methamphetamine Hi, my name's Sara Bellum. Welcome to my ...
SHORTER MENSTRUAL CYCLES ASSOCIATED WITH CHLORINATION BY-PRODUCTS IN DRINKING WATER
Shorter Menstrual Cycles Associated with Chlorination by-Products in Drinking Water. Gayle Windham, Kirsten Waller, Meredith Anderson, Laura Fenster, Pauline Mendola, Shanna Swan. California Department of Health Services.In previous studies of tap water consumption we...
Entre el activismo y la intervención: El trabajo de organizaciones de ...
International Development Research Centre (IDRC) Digital Library (Canada)
2017-05-31
May 31, 2017 ... This book brings together the experiences and lessons learned from five civil ... Laura Georgina Freyermuth Joffre graduated in political science from the Universidad Nacional Autónoma de México. ... Project description ...
Smart power flows at the island edge
DEFF Research Database (Denmark)
Watts, Laura
2016-01-01
Ethnographer of Futures and Associate Professor at IT University of Copenhagen, Laura Watts, talks about her response to the UK National Infrastructure Commission’s vision for the future of the electricity grid in her guest blog....
Determination of chilling temperature effects on nutrient elements ...
African Journals Online (AJOL)
PRECIOUS
2009-12-01
Dec 1, 2009 ... (Brassica oleracea L. Cv. Acephala) using the WDXRF spectroscopic ... considerably yield reductions in the cultivation areas at higher latitudes (Laura et al., ..... help us change usual plant fertilization regimes resis- tance of ...
Bridging the gap between farmers and supermarkets in Nicaragua ...
International Development Research Centre (IDRC) Digital Library (Canada)
2014-07-03
Jul 3, 2014 ... Elder chose to study smallholder farmers after working in Kenya as an ... Combining this data will help her gain expertise in qualitative and quantitative work. ... Sara Elder interviews smallholder farmers in Nicaragua.
Depression among Congestive Heart Failure Patients: Results of a Survey from Central China
Directory of Open Access Journals (Sweden)
JPMS
2011-10-01
Full Text Available Tabish Hussain, Li Yu Shu, Xiang Cheng, Tumenjavkhlan Sosorburam, A.Seid Adji, Sara Tajammul, Aamra Sartaj (Union Hospital, Tongji Medical College, Huazhong University of Sciences and Technology, Wuhan, China (pages 38-42
IDRC hosts the Science Writers and Communicators of Canada ...
International Development Research Centre (IDRC) Digital Library (Canada)
2017-09-20
Sep 20, 2017 ... Marie Lambert-Chan, editor-in-chief of Québec Science, Scott Hannant, former ... Although Canada's Periodical Fund provides financial assistance to ... During the IDRC World Café, IDRC Program Management Officer Laura ...
Full Text Available ... Laura Butler of Parkersburg, W.Va., had "extreme pain in both eyes," she said. "Because I had ... with a corneal abrasion. "I was in severe pain and on medication for four weeks, and couldn' ...
Kõik on nii nagu enne, aga miski pole enam endine / Martin Rünk
Rünk, Martin
2010-01-01
Anders Härmi kuraatoriprojekt "Next to Nothing" ("Eimillestki edasi") Eesti Kaasaegse Kunsti Muuseumis 22. augustini 2010. Pikemalt Martin Creedi (Suurbritannia), Laura Tootsi, Triin Tamme, Dénes Farkasi, Neeme Külma ja Kaido Ole töödest
Translational selection in human: More pronounced in housekeeping genes
Ma, Lina; Cui, Peng; Zhu, Jiang; Zhang, Zhihua; Zhang, Zhang
2014-01-01
by Yuan Yuan, Baylor College of Medicine; Han Liang, University of Texas MD Anderson Cancer Center (nominated by Dr Laura Landweber) Eugene Koonin, NCBI, NLM, NIH, United States of America Sandor Pongor, International Centre for Genetic Engineering
Indian Academy of Sciences (India)
Polysulphone composite membranes modified with two types of carbon additives as a potential material for bone tissue regeneration · ALICJA WEDEL-GRZENDA ANETA FRACZEK-SZCZYPTA MAURICIO TERRONES ANA LAURA ELÍAS MALGORZATA LEKKA ELZBIETA MENASZEK STANISLAW BLAZEWICZ.
Dragotsennaja osen / Tatjana Barmakova
Barmakova, Tatjana
2004-01-01
Moefirmade Dior, Yves Saint Laurent (jumestuskunstnik Linda Cantello), Guerlain (kunstnik Olivier Echaudemaison), Shiseido (kunstnik Tom Pecheux) meigikollektsioonidest. Diori, Kenzo ja Thierry Mugleri uutest parfüümidest. "Kenzoairi" parfüümipudeli disainis klaasikunstnik Laura de Santillana
Are You Shopping Smart for Prescription Drugs?
... work well for them through the CR Best Buy Drugs program. Photo courtesy of Sara Jorde Photography A ... National Library of Medicine, the Consumer Reports Best Buy Drugs program helps consumers discuss drug choices with their ...
Annual report of the Grenoble Institute of nuclear science
International Nuclear Information System (INIS)
Vignon, B.
1988-01-01
Research in theoretical nuclear physics; peripheral reactions and intermediate energy physics; characteristics of reaction mechanisms in heavy ion collisions; nuclear structure; fundamental interactions; interdisciplinary studies; experimental methods and instrumentation; and the SARA accelerator is presented [fr
Full Text Available ... Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical Therapy-Lokomat T. George Hornby, PhD, PT Empowering ... Rogers, SW Marguerite David, MSW Kathy Hulse, MSW Physical Therapy after Spinal Cord Injury Laura Wehrli, PT ...
Full Text Available ... Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical Therapy-Lokomat T. George Hornby, PhD, PT Empowering ... Rogers, SW Marguerite David, MSW Kathy Hulse, MSW Physical Therapy after Spinal Cord Injury Laura Wehrli, PT ...
Full Text Available ... Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical Therapy-Lokomat T. George Hornby, PhD, PT Empowering ... Rogers, SW Marguerite David, MSW Kathy Hulse, MSW Physical Therapy after Spinal Cord Injury Laura Wehrli, PT ...
Full Text Available ... Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical Therapy-Lokomat T. George Hornby, PhD, PT Empowering ... Rogers, SW Marguerite David, MSW Kathy Hulse, MSW Physical Therapy after Spinal Cord Injury Laura Wehrli, PT ...
2011-06-24
... to the U.S. Department of the Treasury, Financial Management Service, Financial Accounting and...: June 16, 2011. Laura Carrico, Director, Financial Accounting and Services Division, Financial...; Termination; Clearwater Insurance Company AGENCY: Financial Management Service, Fiscal Service, Department of...
77 FR 553 - Surety Companies Acceptable on Federal Bonds: Termination; Western Bonding Company
2012-01-05
.... Department of the Treasury, Financial Management Service, Financial Accounting and Services Division, Surety..., 2011. Laura Carrico, Director, Financial Accounting and Services Division, Financial Management Service...: Termination; Western Bonding Company AGENCY: Financial Management Service, Fiscal Service, Department of the...
Kaitstud magistri- ja doktoritööd 2014
2015-01-01
Magistritööd kaitsesid: Ekaterina Ermolaeva, Helena Haller, Kadri Kallast, Ville-Matti Aleksi Kataja, Laura Kiiroja, Alina-Ruxanda Mircea, Tatjana Pilipoveca, Liina Sieberk, Katsiaryna Suryna, Fatemeh Tavakoli, Ele Viskus; doktoritööd kaitses Vadim Verenitš
Fermi and the Art of Estimation
Indian Academy of Sciences (India)
IAS Admin
The balance wheel will now shed some ... work best when used by someone with the ... [1] Laura Fermi, Atoms in the Family: My Life with Enrico Fermi, The. University of Chicago ... Geneva, European Organization for Nuclear Research, 1969.
HPV Prevention (A Cup of Health with CDC)
Centers for Disease Control (CDC) Podcasts
Human papillomavirus, or HPV, is a virus that can cause certain cancers and is the most commonly sexually transmitted infection in the U.S. In this podcast, Dr. Laura Viens discusses the importance of getting vaccinated against HPV.
Nutrition from aquaculture and home gardens in Cambodia
International Development Research Centre (IDRC) Digital Library (Canada)
is about 76% carbohydrate, only 10% protein, and only 14% fat. Foods from animal sources ... to increase and diversify food production and provide low- ... Senior Program Specialist, Ottawa, Canada (awesley@idrc.ca) or. Sara Ahmed, Senior ...
2010-12-21
... DEPARTMENT OF AGRICULTURE Agricultural Marketing Service [Doc. No. AMS-PY-10-0098] Poultry... David Bowden, Jr., Chief, Standards, Promotion, & Technology Branch; Poultry Programs, AMS, U.S.... FOR FURTHER INFORMATION CONTACT: Sara Lutton, Standards, Promotion, & Technology Branch; Poultry...
Full Text Available ... Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family ... play_arrow How is the delivery of a child affected by the mother's spinal cord injury? play_ ...
Technical Guidance for Hazardous Analysis, Emergency Planning for Extremely Hazardous Substances
This current guide supplements NRT-1 by providing technical assistance to LEPCs to assess the lethal hazards related to potential airborne releases of extremely hazardous substances (EHSs) as designated under Section 302 of Title Ill of SARA.
2012-07-27
... JACINTA YEUNG CHEONG CHANG MICHAEL YIO-HOW CHENG NICOLAS VINCENT CHI TELLY TAI HSUAN CHINOY SAMIR MUSTAPHA... TONJA YVONNE SU JIN CHIN SU XIAOBO SARA SHAO SUEN SAMSON C. L. SY KEVIN NEIL TAN LAI HING THARALDSEN...
Fine5 tantsuteater võitis Vitebskis teise preemia
2006-01-01
22. - 26. XI Valgevenes toimunud kaasaegse koreograafia konkursil "International Festival of Modern Choreography" võitsid Laura Kvelstein ja Dmitri Kruus lühiteostega "1 spot, 2 shadows" teise preemia. Konkursi raames toimunud meistriklasse juhendas Fine5 koreograaf Tiina Ollesk
76 FR 37891 - Surety Companies Acceptable on Federal Bonds; Termination; Western Insurance Company
2011-06-28
... the U.S. Department of the Treasury, Financial Management Service, Financial Accounting and Services.... Laura Carrico, Director, Financial Accounting and Services Division, Financial Management Service. [FR...; Termination; Western Insurance Company AGENCY: Financial Management Service, Fiscal Service, Department of the...
Kristiina Uslar Londoni klaasivõistluse finaalis
2006-01-01
Londonis avati rahvusvahelise klaasikonkursi "The Bombay Sapphire Prize" 2006. aasta finalistide näitus. Eestit esindab Kristiina Uslar tööga "Data Turbine". Konkursi peaauhinna võitis hispaania kunstnik Jaune Plensa, parima uustulnuka auhinna inglise klaasikunstnik Laura Birdsall
2012-04-26
... the EIS could be completed, the funding reality is such that the project could not be designed or... and Construction (A, B). Authority: 23 U.S.C. 315; 49 CFR 1.48. Issued on: April 16, 2012. Laura S...
2016-02-10
R, Virginia Commonwealth University Dr. Chris Giza, Professor of Pediatric Neurology and Neurosurgery, UCLA Brain Injury Research Center October...Sara Higgins , MPH Analyst, Grant Thornton LLP Kendal Brown, MBA Management Analyst, Information Innovators, Inc. Margaret Welsh Management
AFSC/REFM: Alaska Stock Assessment Results Archive (SARA)
National Oceanic and Atmospheric Administration, Department of Commerce — Each year over 50 Alaskan groundfish stock assessments report the condition of Alaskan fisheries resources in the U.S. Exclusive Economic Zone. Stock assessment...
INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA
Directory of Open Access Journals (Sweden)
Mihael Černetič
2015-02-01
Full Text Available The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is analysed from the perspective of mindfulness. Within the course of therapy, parallels were observed between the client's increased mindfulness, improved internal and external contact, strengthened Adult ego state, mastery of introjections, as well as diminished feelings of guilt, improved mood, self care and ability to engage in appropriate separation and individuation. These gains support the conclusion that Integrative Psychotherapy and mindfulness are inherently related and that explicit incorporation of mindfulness may enhance the therapeutic process of Integrative Psychotherapy.
INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA
Mihael Černetič
2015-01-01
The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is ana...
Fruit and vegetable phytochemicals: chemistry, nutritional value, and stability
National Research Council Canada - National Science Library
González-Aguilar, Gustavo A; Rosa, Laura A. de la; Alvarez-Parrilla, Emilio
2010-01-01
... and Their Relation to Human Health Alma E. Robles-Sardin, Adriana Ver´ o nica Bola˜ n os-Villar, Gustavo A. Gonz´ a lez-Aguilar, and Laura A. de la Rosa 155 Chapter 7. Chemistry, Stability, and Biological Actions ...
2012-03-28
... directed to the U.S. Department of the Treasury, Financial Management Service, Financial Accounting and...: March 18, 2012. Laura Carrico, Director, Financial Accounting and Services Division, Financial...: Financial Management Service, Fiscal Service, Department of the Treasury. ACTION: Notice. SUMMARY: This is...
2011-06-30
... directed to the U.S. Department of the Treasury, Financial Management Service, Financial Accounting and...: June 22, 2011. Laura Carrico, Director, Financial Accounting and Services Division, Financial...: Financial Management Service, Fiscal Service, Department of the Treasury. ACTION: Notice. SUMMARY: This is...
2007-01-01
Sisu: Kuked ja kanad / Laura Trull ; "Ma igatsen õnne..." / Kattre Adramees ; Usk / Riinu Ansperi ; Talveüllatus / Aile Eldemeel ; Vastutus / Riinu Ansperi ; Pisike peni / Indrek Kuka ; Tere, talv! / Villi Brandt ; Minu kool / Kaisa Tamm ; Selle teeraja mälestuseks / Anni Vanin
Cannes südames / Mirkka Maikola
Maikola, Mirkka
2011-01-01
Nicolas Winding Refni filmist "Drive" (USA 2011). Lisaks tegid oma pingerea Cannes´is nähtud filmidest Eesti filmikriitikud ja -tegijad Jaan Ruus, Jaak Lõhmus, Tristan Priimägi, Jaak Kilmi, Andris Feldmanis, Maria Ulfsak-Šeripova ja Laura Talvet
"Puhastuse" esimesed osatäitjad teada / Kaarel Kressa
Kressa, Kaarel, 1983-
2011-01-01
Eesti-Soome koostöös valmiva Antti Jokise filmis "Puhastus" mängib vana Aliidet Liisi Tandefelt, Aliidet nooruspäevil Laura Birn, Hansu Peter Franzén, Martinit Tommi Korpela, Aliide vanemaid Anne Reemann ja Elmo Nüganen
Time-To-Complete Prediction for Data Transfers
Toler, Wesley
2016-01-01
Currently, there is no prediction provided to users for the amount of time a particular data transfer from one site in the Worldwide LHC Computing Grid to another will take to complete. To develop a time-to-complete prediction, network performance data and per-file information is gathered from two separate databases and fused, and the resulting cleaned data is fitted using random forest regression. Results are shown for two separate links: the link from CERN Data Centre to Brookhaven National Laboratory’s ATLAS data center, and the link from CERN Data Centre to SARA-MATRIX in Amsterdam. A total RMS error of 25.93 minutes between predicted and test data is found for the CERN-PROD -> BNL-ATLAS link, while the CERN-PROD -> SARA-MATRIX link yields a total RMS error of 3.00 minutes.
Risk management at hazardous waste sites
International Nuclear Information System (INIS)
Travis, C.C.; Doty, C.B.
1990-01-01
The Superfund Amendments and Reauthorization Act of 1986 (SARA) provided the Environmental Protection Agency (EPA) with additional resources and direction for the identification, evaluation, and remediation of hazardous waste sites in the United States. SARA established more stringent requirements for the Superfund program, both in terms of the pace of the program and the types of remedial alternatives selected. The central requirement is that remedial alternatives be ''protective of public health and the environment'' and ''significantly and permanently'' reduce the toxicity, mobility, or volume of contaminants. The mandate also requires that potential risk be considered in the decision-making process. This document discusses risk management at hazardous waste sites. Topics include selection of sites for placement on the National Priority List, risk assessment and the decision process, risk reduction and remedial alternative selection, and aquifer restoration. 10 refs., 2 figs
Research Article Special Issue
African Journals Online (AJOL)
pc
2018-03-07
Mar 7, 2018 ... ation with the pump units of various types operating in the optimal and correct mode. ... In the existing irrigation systems of the Sara- ... Journal of Fundamental and Applied Sciences is licensed under a Creative Commons ...
Bulletin of Materials Science | News
Indian Academy of Sciences (India)
Enhanced antibacterial performance of Fe 3 O 4 –Ag and MnFe 2 O 4 –Ag ... Department of Chemistry, Fatih University, 34500 Buyukcekmece-Istanbul, Turkey ... Chemicals and Chemical Industry Trade Company, Saraçlar Industrial Zone, No.
Reforming the American Military Officer Personnel System
2015-12-02
Lamping Lewis, Henry Leonard, Julia Pollak, Christopher Guo and Bernard Rostker, Tour Lengths, Permanent Changes of Station, and Alternatives for...Raymond E. Conley, Stephanie Young, William A. Williams, Jeffrey Engstrom, Barbara Bicksler, Sara Beth Elson, Joseph Jenkins , Lianne Kennedy
Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...
Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...
Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...
Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...
Associations between cardiovascular risk factors, hyper- and hypocoagulability
Rafi, S.
2011-01-01
Sara Rafi beschrijft verbanden tussen risicofactoren voor hart- en vaatziekten (HVZ) en bloedstolling. Uit calciumneerslag op de aortaboog blijkt dat patiënten met veneuze trombose een verhoogde kans hebben op HVZ. Ook schildklieraandoeningen en het gebruik van ontstekingsremmers en
ClassBeacons: designing distributed visualization of teachers’ physical proximity in the classroom.
An, P.; Bakker, S.; Ordanovski, S.; Taconis, R.; Eggen, J.H.
2018-01-01
Pengcheng An, Saskia Bakker, Sara Ordanovski, Ruurd Taconis, Berry Eggen. 2018 (accepted at Oct 2017). ClassBeacons: designing distributed visualization of teachers’ physical proximity in the classroom. In Proceedings of Tangible and Embodied Interaction, TEI 2018, Mar 18-21, 2018,
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Low energy neutral atom imaging on the Moon with the SARA instrument ... that will be flown on the first Indian lunar mission Chandrayaan-1. ... Currently at NASA Goddard Space Flight Center, Mail Code 612.2, Greenbelt, MD 20771, USA.
Banana nectar as a medium for testing pollen viability and ...
African Journals Online (AJOL)
Administrator
2007-05-16
May 16, 2007 ... The accession TMB2x 8075 - 7 showed no significant pollen germination in nectar and sucrose. Eleven genotypes (55%) showed significant increase in pollen ..... SAS (1999) SAS Institute Inc. Cary, USA. Sara CC, José OF, ...
Kanuti gildi saalis toimub kuni 24. XI festival "Continental Breakfast Tallinn"
2005-01-01
Korraldajad: Anders Härm, Priit Raud. 4. XI Tellervo Kalleineni (Soome) performance "Lase mind/Let me". 5. XI Saralundeni (Sara Lunden, Rootsi) muusikaline performance "Sweet Beat Tour". 8. ja 9. XI esineb babaLAN (Vlado Gotvan Repnik, Sloveenia) multimeedia-performance'iga
Eczema (Atopic Dermatitis)Treatment
... Lubricate or moisturize the skin two to three times a day using ointments such as petroleum jelly. Moisturizers should be ... Freeman Peter Hubbard Sara Jones Tony Lee Lara R. ... Kinyoun Lecture Series 2016 Kinyoun Lecture 2015 Kinyoun Lecture 2014 Kinyoun ...
Feminist Film Theory and Criticism.
Mayne, Judith
1985-01-01
Discusses Laura Mulvey's 1975 essay, "Visual Pleasure and Narrative Cinema," and the ideas about feminist film theory and psychoanalysis as a critical tool which it raises. Suggests contradiction is the central issue in feminist film theory. Explores definitions of women's cinema. (SA)
TRIHALOMETHANE LEVELS IN HOME TAP WATER AND SEMEN QUALITY
Trihalomethane Levels in Home Tap Water and Semen QualityLaura Fenster, 1 Kirsten Waller, 2 Gayle Windham, 1 Tanya Henneman, 2 Meredith Anderson, 2 Pauline Mendola, 3 James W. Overstreet, 4 Shanna H. Swan51California Department of Health Services, Division of Environm...
2016-03-01
As noted in the report, we found that different stakeholders within the Navy used the guaranty to accomplish differing and, at times, contradictory...staff members made key contributions to this report: Diana Moldafsky, Assistant Director; Laurier Fish; Joseph Franzwa; Ronald Freeman ; Laura
Full Text Available ... PhD Sigmund Hough, PhD Laura Tuck, PsyD Terrie Price, PhD Heather Taylor, PhD Michelle Meade, PhD Jonathon ... the most important thing for families to know right away? play_arrow What are the main concerns ...
Full Text Available ... PhD Sigmund Hough, PhD Laura Tuck, PsyD Terrie Price, PhD Heather Taylor, PhD Michelle Meade, PhD Jonathon ... arrow Why are high-dose steroids often used right after an injury? play_arrow What is meant ...
"Never Enough": Bridging the Chasm between College Women's Achievements and Their Anguish
Choate, Laura A.
2017-01-01
Laura H. Choate demonstrates a disconnect between what female undergraduates are achieving and how they actually feel about themselves and their accomplishments; she suggests a variety of interventions to counterbalance the cultural pressures that undermine college women's overall self-esteem and mental health.
2012-07-10
.... obligations under applicable international trade law, including the World Trade Organization (WTO) Agreement... CONTACT: Laura Cimo, Trade and Marine Stewardship Division, Office of International Affairs, NMFS, at (301... organizations calling for international restrictions on the fishing activities or practices described in the...
Reval, Kreete
2003-01-01
Heliplaatidest: Lõkõrig "Süä kisk", Laura Pausini "From The Inside", Gary Moore "Back To The Blues", Ayako Lister "The Japanese Koto", Massive Attack "100th Window", ERSO & Arvo Volmer "Eduard Tubin: 2. ja 5. sümfooniad", Claire's Birthday "Future Is Now!"
Reval, Kreete
2003-01-01
Heliplaatidest: Laura Pausini "From The Inside", Gary Moore "Back To The Blues", Ayako Lister "The Japanese Koto", Massive Attack "100th Window", Erso & Arvo Volmer "Eduard Tubin: 2. ja 5. sümfooniad", Claire's Birthday "Future Is Now!", Lõkõriq "Süa kisk"
Postimehe fotograaf võitis konkursi "Eesti foto 2004" / Neeme Korv
Korv, Neeme, 1974-
2004-01-01
Pärnu Uue Kunsti Muuseumi ja fotoajakirja "Cheese" fotokonkursil osales 67 fotograafi. Grand prix' võitis Ove Maidla broomõlitehnikas fotodega, millel kujutatakse maastikke, aega ja inimesi. Järgnesid Kristo Rihm, Anu Vahtra ja Märten Kross. Parim noor fotograaf oli Laura Nõmmik
Kampen om Kinas medier: Fri presse eller socialistisk propaganda
DEFF Research Database (Denmark)
Dombernowsky, Laura Møller
2012-01-01
Mens unge kinesere sætter deres lid til, at kommercielle medier vil øge den journalistiske frihed, råber kritikere vagt i gevær. De frygter, at de socialistiske idealer ryger i svinget. ANALYSE af Laura Dombernowsky, Beijing, Kina...
Our Immune System A story for children with primary immunodeficiency diseases Written by Sara LeBien IMMUNE DEFICIENCY FOUNDATION A note ... who are immune deficient to better understand their immune system. What is a “ B-cell, ” a “ T-cell, ” ...
Towards a sustainable coffee market: paradoxes faced by a multinational company
Kolk, A.
2012-01-01
This paper examines the case of sustainable coffee as faced by Sara Lee's International Coffee and Tea Division (SL), asking which strategic direction the company should take considering its regulatory, competitive, and societal contexts. More than a decade after sustainable coffee became a
Arenguabistajad süüdistavad Eestit jalalohistamises / Evelyn Kaldoja
Kaldoja, Evelyn, 1980-
2008-01-01
Ilmunud ka: Postimees : na russkom jazõke 1. juuli 2008, lk. 10. Valitsusväliseid ühendusi koondavas raportis kritiseeritakse Eestit väheste summade eraldamises rahvusvahelisele arenguabile. Lisa: Baltimaade arenguabi aastal 2007; Vt. samas raporti koostamisel osalenud ActionAidi esindaja Laura Sullivani kommentaari
Mälestusmärk iseendale / Rein Veidemann
Veidemann, Rein, 1946-
2009-01-01
Lembit Petersonist ja tema lavastusest "Maarja kuulutamine", mille eest ta pälvis aastapreemia ja osatäitmiste eest samas lavastuses said aasta naisnäitlejapreemiad tema tütred Maria ja Laura Peterson. Poeg Marius Peterson sai preemia osatäitmise eest lavastuses "Linn"
Naised leedu kunstnike pilgu läbi
2002-01-01
Hansapanga galeriis leedu kaasaegse kunsti näitus "Õppides ja lauldes". Kuraator Kestutis Kuizinas. Osalevad Laura Stasiulyte, Gediminas ja Nomeda Urbonas, Vita Zaman. Videod ja slaidiprogrammid näitavad tõelisi või lavastatud episoode naiste elust tänapäeva Leedus
Saaremaa noored said hakkama eduka filmiga! / Minni Saapar
Saapar, Minni
2006-01-01
Saaremaa Ühisgümnaasiumi abituriendid Laura Tõhk ja Marili Pärtel said oma filmiga "Fallen Angel" 11. ja 12. novembrini Rakvere Teatrikinos toimunud "Noorte filmipäevadel Rakveres 2006" parima dokumentaalfilmi auhinna. Konkursi 21 filmi seast said viis filmi auhinna ja kolm eriauhinna.
Omas mahlas / Raineras Vilumaa
Vilumaa, Raineras
2004-01-01
Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones kuni 11. VII ja Rotermanni soolalaos kuni 8. VIII. Kuraatorid Anders Härm, Eha Komissarov ja Hanno Soans. 26. VI esitlesid kunstnikud Arturas Bumshteinas, Laura Garbshtiene (G-Lab) ja helilooja Antanas Jasenka oma heliinstallatsioone
75 FR 35815 - Ocean Transportation Intermediary License Applicants
2010-06-23
..., TX 76011. Officers: Omar Kolaghassi, Manager (Qualifying Individual), Laura Alicia, Manager. Application Type: New OFF & NVO License. CALS Logistics USA, Inc. (OFF & NVO), 755 North Route 83, Suite 215.... Premium Star Logistics LLC dba O.P. Premium Star Logistics (OFF & NVO), 4200 Lightning Court, Bakersfield...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Lotfali Saghatforoush1 Laura Valencia Matarranz2 Firoozeh Chalabian3 Shahriare Ghammamy4 Fatemeh Katouzian5. Department of Chemistry, Payame Noor University, 19395-4697, Tehran, I.R. of Iran; Departamento de Quimica Inorganica, Facultad de Quimica, Universidade de Vigo, 36310 Vigo Pontevedra, Spain ...
African Journal of AIDS Research - Vol 5, No 2 (2006)
African Journals Online (AJOL)
Talking about sex in Botswana: social desirability bias and possible implications for HIV-prevention research · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Kata Chillag, Greg Guest, Arwen Bunce, Laura Johnson, Peter H Kilmarx, Dawn K Smith, 123-131.
Klaasis on pinget / Reet Varblane ; kommenteerinud Kati Kerstna, Kairi Orgusaar
Varblane, Reet, 1952-
2009-01-01
Klaasi kui (kunsti)materjali kasutamisest, mitmete erialade sümbioosist. Laura Mattioli Rossi, Rosa Barovier Mentasti ja Adriano Berengo kureeritud näitusest "Glass Stress" ("Klaasipinge") tänavusel Veneetsia biennaalil. Eesti klaasikunstist, Kai Koppeli eestvedamisel toimunud Haapsalu klaasipäevadest "Kasuta päeva"
Gombrowicz tra esilio e straduzione
Directory of Open Access Journals (Sweden)
Vera Horn
2006-12-01
Full Text Available L'esilio argentino dello scrittore polacco Witold Gombrowicz raccontato da Laura Pariani nel romanzo La straduzione; il tentativo di tradursi; il tentativo di tradurre il Ferdyduke in spagnolo e conquistare pubblico; critica e traduzione nel mondo argentino; la straduzione come fallimento.
Moonutatult ja vahendatult nüüdiskunstist / Laura Kuusk
Kuusk, Laura, 1982-
2016-01-01
Liikumisest kujuteldava ja füüsilise ruumi vahel. Kristina Õlleki magistritööst "Kunstiteos, selle fotodokumentatsioon ja representatsioon digiajastul. When you have the object itself in front of your eyes protsess ja analüüs". Magistritöös uuritakse näitluse vaatamisel tekkivate kujutluspiltide teemat
Soil treatment technologies combined
International Nuclear Information System (INIS)
Davis, K.J.; Russell, D.J.
1993-01-01
The Superfund Amendments and Reauthorization Act (SARA) presents a legislative mandate to select effective and long-term remediation options. SARA has spurred the development of innovative technologies and other remedial alternatives that can be applied to the diverse contaminated media at hazardous waste sites. Even though many treatment technologies have been investigated for use at hazardous waste sites, only a few have been used successfully. Soil vapor extraction and soil composting have achieved cleanup goals at sites with soils contaminated with solvents, aromatic hydrocarbons and petroleum derivatives. With the increased use of innovative on-site technologies, the integration of multiple technologies to remediate sites with complex contaminants becomes a viable and cost-effective remedial alternative. Soil vapor extraction and composting have been applied successfully as individual technologies at hazardous waste sites. An integration of these two technologies also has been used to remediate a complex contaminated site
Application of the luminescence single-aliquot technique for dose estimation in the Marmara Sea
International Nuclear Information System (INIS)
Tanir, Guenes; Sencan, Emine; Boeluekdemir, M. Hicabi; Tuerkoez, M. Burak; Tel, Eyuep
2005-01-01
The aim of this study is to obtain the equivalent dose, which is the important quantity for all the studies related to the use of luminescence in dating sediments. Recent advances in luminescence dating have led to increasing application of the technique to sediment from the depositional environmental samples. The sample used in this study is the active main fault sample that was collected from the Sea of Marmara in NW Turkey. Equivalent dose was measured using both the multiple-aliquots and the single-aliquot techniques. In this study single aliquot regeneration on additive dose (SARA) procedure was also used. The result obtained was not in agreement with the results evaluated from the multiple-aliquots procedure. So a simple modification was suggested for SARA procedure. In our modified procedure the calculated dose (D) values were obtained by using the additive dose protocol instead of regeneration protocol
International Nuclear Information System (INIS)
Russell, K.D.; Skinner, N.L.
1994-07-01
The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs), primarily for nuclear power plants. The primary function of MAR-D is to create a data repository for completed PRAs and Individual Plant Examinations (IPEs) by providing input, conversion, and output capabilities for data used by IRRAS, SARA, SETS, and FRANTIC software. As probabilistic risk assessments and individual plant examinations are submitted to the NRC for review, MAR-D can be used to convert the models and results from the study for use with IRRAS and SARA. Then, these data can be easily accessed by future studies and will be in a form that will enhance the analysis process. This reference manual provides an overview of the functions available within MAR-D and step-by-step operating instructions
Directory of Open Access Journals (Sweden)
Emanuele Monegato
2014-11-01
Full Text Available Antonietta Buonauro, Trauma, cinema e media. Immaginari catastrofici e cultura visuale del nuovo millennio, Roma, Bulzoni, 2014, 190 pp. ISBN 978-88-7870-921-8 Barbara Greco y Laura Pache Caballo, eds., Sobrenatural, fantástico y metarreal. La perspectiva de América Latina, Madrid, Biblioteca Nueva, 2014, 334 pp. ISBN 978-84-16095-64-3 Chiara Bolognese, Piste di un naufragio. Cartografia di Roberto Bolaño, Salerno, Arcoiris, 2014, 322 pp. ISBN 978-88-96583-59-3 Cinzia Scarpino, US Waste. Rifiuti e sprechi d’America. Una storia dal basso, Milano, Il Saggiatore, 2011, 325 pp. ISBN 9788865760871 Cinzia Schiavini, Sulle strade d’America. L’autobiografia di viaggio statunitense contemporanea, Milano, Shake, 2011, pp. 238, ISBN 978-88-97109-06-8 Gibson John, Fiction and the Weave of Life, Oxford & NY, OUP, 2007, 201 pp. ISBN 9780199299522 Gloria Staffieri, L’opera italiana. Dalle origini alle riforme del secolo dei Lumi (1590-1790, Roma, Carocci, 2014, 447 pp. ISBN 978-88-430-7108-1 Horacio Quiroga, I perseguitati, Salerno, Arcoiris, 2014, 64 pp. ISBN 978-88-96583-63-0 Lee Edelman, No Future: Queer Theory and the Death Drive, Durham, Duke University Press, 2004, 208 pp. ISBN 978-0822333692 Marco Canani and Sara Sullam, eds., Parallaxes. Virginia Woolf Meets James Joyce, Newcastle upon Tyne, Cambridge Scholars Publishing, 2014, 206 pp. ISBN 978-1-4438-5623-2 Miklos David, eds., Estática doméstica. Tres generaciones de cuentistas peruanos (1951-1981, México, UNAM, 2005, 353 pp. ISBN 970-32-2525-X Óscar de Borbolla, Le vocali maledette, Salerno, Arcoiris, 2014, 78 pp. ISBN 978-88-96583-43-2 Roald Dahl, The Hitch-Hiker, Impara l’inglese con Roald Dahl, note e glossario a cura di Marta Cai, Milano, Vallardi, 2014, 77 pp. ISBN 978-88-6731-451-5 Roberto Arlt, Un viaggio terribile, Salerno, Arcoiris, 2014, 95 pp. ISBN 978-88-96583-57-9 Ziauddin Sardar and Borin Van Loon, Introducing Cultural Studies, Cambridge, Icon Books, 1998, 175
Kropec, Andrea; Maira-Litran, Tomas; Jefferson, Kimberly K; Grout, Martha; Cramton, Sarah E; Götz, Friedrich; Goldmann, Donald A; Pier, Gerald B
2005-10-01
The contribution of the Staphylococcus aureus surface polysaccharide poly-N-acetylglucosamine (PNAG) to virulence was evaluated in three mouse models of systemic infection: bacteremia, renal abscess formation, and lethality following high-dose intraperitoneal (i.p.) infection. Deletion of the intercellular adhesin (ica) locus that encodes the biosynthetic enzymes for PNAG production in S. aureus strains Mn8, Newman, and NCTC 10833 resulted in mutant strains with significantly reduced abilities to maintain bacterial levels in blood following intravenous or i.p. injection, to spread systemically to the kidneys following i.p. injection, or to induce a moribund/lethal state following i.p. infection. In the bacteremia model, neither growth phase nor growth medium used to prepare the S. aureus inoculum affected the conclusion that PNAG production was needed for full virulence. As the SarA regulatory protein has been shown to affect ica transcription, PNAG synthesis, and biofilm formation, we also evaluated S. aureus strains Mn8 and 10833 deleted for the sarA gene in the renal infection model. A decrease in PNAG production was seen in sarA mutants using immunoblots of cell surface extracts but was insufficient to reduce the virulence of sarA-deleted strains in this model. S. aureus strains deleted for the ica genes were much more susceptible to antibody-independent opsonic killing involving human peripheral blood leukocytes and rabbit complement. Thus, PNAG confers on S. aureus resistance to killing mediated by these innate host immune mediators. Overall, PNAG production by S. aureus appears to be a critical virulence factor as assessed in murine models of systemic infection.
A short impossibility proof of quantum bit commitment
International Nuclear Information System (INIS)
Chiribella, Giulio; D'Ariano, Giacomo Mauro; Perinotti, Paolo; Schlingemann, Dirk; Werner, Reinhard
2013-01-01
Bit commitment protocols, whose security is based on the laws of quantum mechanics alone, are generally held to be impossible on the basis of a concealment–bindingness tradeoff (Lo and Chau, 1997 [1], Mayers, 1997 [2]). A strengthened and explicit impossibility proof has been given in D'Ariano et al. (2007) [3] in the Heisenberg picture and in a C ⁎ -algebraic framework, considering all conceivable protocols in which both classical and quantum information is exchanged. In the present Letter we provide a new impossibility proof in the Schrödinger picture, greatly simplifying the classification of protocols and strategies using the mathematical formulation in terms of quantum combs (Chiribella et al., 2008 [4]), with each single-party strategy represented by a conditioned comb. We prove that assuming a stronger notion of concealment—for each classical communication history, not in average—allows Alice's cheat to pass also the worst-case Bob's test. The present approach allows us to restate the concealment–bindingness tradeoff in terms of the continuity of dilations of probabilistic quantum combs with the metric given by the comb discriminability-distance.
Enteógenos e Inteligência Existencial: Plantas Mestres como Instrumentos Cognitivos
Directory of Open Access Journals (Sweden)
Kenneth Tupper
2012-09-01
Full Text Available DOI: 10.12957/periferia.2011.3946 A partir de recentes mudanças nas legislações em relação às drogasem diferentes países, investiguei o potencial dos enteógenos (i.e.,plantas psicoativas usadas como sacramentos espirituais comoinstrumentos para favorecer a inteligência existencial. PlantasMestres das Américas como a ayahuasca, os cogumelos depsilocibina, o peiote e o soma indo-ariano da Eurásia, são alguns dosexemplos de enteógenos que foram e continuam a ser utilizados, nopassado e no presente. Todas estas plantas foram reverenciadas porpessoas e culturas diferentes como instrumentos cognitivos quepromovem um mais rico entendimento cosmológico do mundo. Utilizoa teoria das múltiplas inteligências revisada por Gardner (1999 e suaformulação de uma inteligência “existencial” como uma lente teóricaatravés da qual se deve considerar as possibilidades cognitivas dosenteógenos e explorar potenciais caminhos na Educação.
O cinema a serviço da cultura política nazista
Directory of Open Access Journals (Sweden)
Bruna Krieck Farche
2017-12-01
Full Text Available O presente artigo analisa a influência do cinema na consolidação do nacional-socialismo alemão, a partir de breve resgate histórico do nazismo e de estudo dos filmes O Triunfo da Vontade (1935, dirigido por Leni Riefenstahl e Jud Süss (1940, dirigido por Veit Harlan. Ambos os filmes tiveram o apoio do governo de Hitler em sua produção e apresentam itens fundamentais da ideologia do Terceiro Reich, como o culto ao “líder salvador” (notável em O Trinfo da Vontade e o sentimento de identidade nacional baseado no inimigo comum do povo ariano (que é promovido de maneira sutil em Jud Süss. Filmes como esses ilustram o importante papel que o uso do cinema e da propaganda tiveram na manipulação das massas, ajudando a consolidar o nazismo como a cultura política hegemônica na Alemanha do contexto estudado, uma cultura que levou a uma das maiores atrocidades já vistas pela humanidade: o Holocausto.
Ecology and Conservation of Acacia senegal in the Rangelands ...
African Journals Online (AJOL)
Ecology and Conservation of Acacia senegal in the Rangelands ofLuwero and Nakasongola Districts. Jacob Godfrey Agea, Joseph Obua, Sara Namirembe, Mukadasi Buyinza, Daniel Waiswa. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL ...
Agroforestry potential of Acacia senegal in the rangelands of luwero ...
African Journals Online (AJOL)
Agroforestry potential of Acacia senegal in the rangelands of luwero and Nakasongola districts. Jacob Godfrey Agea, Joseph Obua, Sara Namirembe, Mukadasi Buyinza, Daniel Waiswa. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.
Early Support of Intracranial Perfusion
2009-10-01
outcomes after traumatic brain injury: A multicenter analysis. Archives of Physical Medicine and Rehabilitation, 84(10), 1441- 1448. Cremer , O. L...Kolesnik Research Assistant 67.5 Sean Jordan Research Assistant 44.5 Sara Wade Research Assistant 90 David Prakash Research Assistant 63.6 Scott Berry
African Journals Online (AJOL)
... hemorrhage mimicking a pneumopathy: a rare complication of dual antiplatelet therapy for ST elevation myocardial infarction, Abstract PDF. Sara Oualim, Charafeddine Ait Elharda, Dounia Benzeroual, Mustapha El Hattaoui. Vol 12, No 1 (2012), Pulmonary epidermoid carcinoma in a patient with acromegaly: a rare entity ...
2002-01-01
Valie Export Society (Kadi Estland, Killu Sukmit, Marko Laimre, Meelis Salujärv) osales 9.-11. V Riias toimunud rahvusvahelisel üritusel "6th element" remake-aktsiooniga. Performance'itega esinesid Sara Lunden Rootsist, Kate Pendry Norrast, Jenia Svetlova Venemaalt, Solomia Savtshuk ja Natalia Golibroda Ukrainast
Harvard Education Letter. Volume 26, Number 5, September-October 2010
Walser, Nancy, Ed.
2010-01-01
"Harvard Education Letter" is published bimonthly at the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) Scenes from the School Turnaround Movement: Passion, Frustration, Mid-Course Corrections Mark Rapid Reforms (Laura Pappano); (2) The Media Savvy Educator:…
Hillary Clinton, and Mrs. Laura Bush on stage at the Sewall-Belmont House. Mrs. Bush was joined by Secretary of the Interior Dirk Kempthorne and Senators Hillary Clinton (NY) and Pete Domenici (NM), who Save America's Treasures established by the Clinton Administration. Secretary Dirk Kempthorne, Senator
Reasoning about Independence in Probabilistic Models of Relational Data (Author’s Manuscript)
2014-01-06
computer vision and information retrieval. Näıvely specifying a joint distribution by hand requires an exponential number of states; however, Bayesian...Journal of the Royal Statistical Society. Series B (Methodological), pages 267–288, 1996. Ioannis Tsamardinos, Laura E. Brown, and Constantin F. Aliferis
Um diálogo entre Ocidente e Oriente
Directory of Open Access Journals (Sweden)
Marco Catalão
2011-10-01
Full Text Available Entrevista realizada em agosto de 2011 com a professora Laura Cerrato, em que se debatem alguns elementos da poética do escritor argentino Roberto Juarroz (1925-1995, especialmente sua relação com o Budismo e a tradição oriental.
2013-09-09
... site. The URL for this survey site will also be advertised separately through media and social media... information on the proposed project, contact: Laura M. Koehly, Ph.D., Senior Investigator, Social and... in health conditions and associated risk factors; The role of friends, family, media, and health...
Directory of Open Access Journals (Sweden)
Jhon Rozo Mila
2015-12-01
Full Text Available Los superhéroes, el deber moral y la obligación; El caso de Spider-Man y los X-Men. Laura Victoria Bolaño Pérez; Universidad del Rosario, colección Ópera Prima, Bogotá, 2012, 309 págs.
Russell, Michele, Ed.
Papers on aspects of college admission, records, and institutional research functions are: "How To Improve Office Morale" (Victor Swenson); "Staff Meetings: How To Save Hours per Month and Develop Your Staff" (LuAnn Harris, Shelley Olsen); "Selling SPEED/ExPRESS" (Laura Patterson, Thomas Scott); "Advisement and…
Women Warriors: Why the Robotics Revolution Changes the Combat Equation
2016-03-01
Secretary Leon Panetta and General Martin Dempsey, U.S. Department of Defense, “Elimination of the 1994 Direct Ground Combat Definition and Assignment... Feminism and International Relations, eds. J. Ann Tickner and Laura Sjoberg, (London: Routledge, 2011): 146 and 162. Photos Page 100. Photo by IDF
2007-01-01
USAs Bostoni Berklee muusikakolledzhis tudeeriv Laura Põldvere annab Eestis kolm heliplaadi "Muusa" esitluskontserti (26. okt. Pärnu klubis Mirage). 28. nov. Tallinna linnahallis esinevast Rootsi popbändist Ace Of Base. Wembley staadionil hümne laulnud Hannahi heliplaat "Everything is Changing" sai Inglismaal kriitika osaliseks
Inimene kronesteetilise kaameraga / Andreas W
Andreas W, pseud., 1969-
2011-01-01
Fotofilmifestival 14. oktoobril kinos Sõprus. Fotofilmist. Rahvusvahelisest fotofilmi konkursist "Ajatu lugu". Grand prix' pälvis Anu-Laura Tuttelberg, 2. koha Andri Allas ja Krõõt Tarkmeel, 3. koha Gerald Assouline (Prantsusmaa). Lühidalt festivalil näidatud Gusztáv Hámosi fotofilmidest (Saksamaa)
Ultrasonic recording and display techniques for the inspection of nuclear power plant
International Nuclear Information System (INIS)
Ely, R.W.; Hall, G.D.; Johnson, A.; Pascoe, P.T.
1985-01-01
This paper describes four systems: MDU, PURDIE, LAURA and DRUID, under development as ultrasonic recording and display techniques for the inspection of nuclear power plant. The MDU system plots either plan or sectional views of the component under test onto a bistable storage screen. PURDIE is a system based around a video cassette recorder which has been modified to record ultrasonic A-scan waveforms and probe positional information. MDU and PURDIE are portable systems, for use under difficult site conditions. They may be manufactured in quantity to satisfy the demanding inspection programmes of nuclear power stations. LAURA is a desk top replay system for the video cassette tapes produced on site by PURDIE. DRUID is a digital desk top replay/display system incorporating a high resolution colour graphics terminal and therefore offering more flexibility and improved display formats. The systems are compatible with each other and some component units are directly interchangeable between the various systems
Public Lecture Collide@CERN Pro Helvetia | 23 July | Main Auditorium
2015-01-01
You are very warmly invited to the opening presentation of Fragment.In’s residency at CERN. Fragment.In: Simon de Diesbach, Laura Perrenoud and Marc Dubois. 23 July 2015 - 7 p.m. Main Auditorium The lecture will be followed by a drinks reception at 8.30 p.m. Doors open at 6.30 p.m. Opening address by Rolf Heuer, CERN Director-General, Michel Vust, project leader at the Swiss Arts Council Pro Helvetia, and Monica Bello, Head of Arts@CERN. Fragment.In are the winners of Collide@CERN Pro Helvetia, formed by Laura Perrenoud, Simon de Diesbach, and Marc Dubois. They will present their artistic work along with their CERN scientific inspiration partner, who will present his/her scientific work. In their proposal, Fragment.In took a unique, original and creative approach to data visualization. We look forward to having them at CERN. Fragment.In Collide@CERN is the three month residency programme providing artists with time and...
2013-08-05
..., Sacramento, CA 95825 Documents pertinent to this proposal may be examined at the BLM California State Office, 2800 Cottage Way, Sacramento, CA 95825. FOR FURTHER INFORMATION CONTACT: Sara Acridge, Natural Resources Specialist, telephone 916-978-4557; address 2800 Cottage Way, Rm. W- 1623, Sacramento, CA 95825...
Some geological processes in the Macro-tidal regime of Gulf of Kachchh, Northwest coast of India
Digital Repository Service at National Institute of Oceanography (India)
Vora, K.H.; Chauhan, O.S.; Rao, B.R
of about 150-350 m in the Kandla Creek The Sara, Sanu and Phang creeks exhibit uneven to rugged topography with about 4 to 12 m deep V-shaped channels The seismic profiles across these creeks show 10-15 m thick clays The channels are cutting across...
DEFF Research Database (Denmark)
Petersen, Michael Nebeling
2013-01-01
Med udgangspunkt i Lee Edelmans polemiske argumentation imod reproduktiv futurisme og Sara Ahmeds fokus på queer attachments analyserer og diskuterer artiklen queer slægtskab, som det fremstilles i den amerikanske spillefilm The Kids Are All Right. Der argumenteres for, at børnenes heteronormative...
Numerical analysis of a one-dimensional multicomponent model of the in-situ combustion process
DEFF Research Database (Denmark)
Nesterov, Igor; Shapiro, Alexander; Stenby, Erling Halfdan
2013-01-01
, the model is based on SARA representation of a petroleum mixture (saturates–aromatics–resins–asphaltenes), which may react differently with oxygen and produce other components (for example, light oils and coke). In total, the model contains 14 components, which may undergo 15 chemical reactions. The set...
Richardson, Linda B., Comp.; And Others
This collection includes four handouts: (1) "Selection Critria Considerations for Computer-Based Resources" (Linda B. Richardson); (2) "Software Collection Policies in Academic Libraries" (a 24-item bibliography, Jane W. Johnson); (3) "Circulation and Security of Software" (a 19-item bibliography, Sara Elizabeth Williams); and (4) "Bibliography of…
Kolk, A.
2005-01-01
Since the collapse of the international coffee agreement in 1989, attention has increasingly focused on the role of multinational corporations in this sector. As the main actors in the international coffee chain, companies such as Sara Lee/Douwe Egberts, Nestlé and Kraft have been pressurised to
Runoff Characterization and Variations at McMurdo Station, Antarctica
2014-05-13
Boulevard Arlington, VA 22230 Laura Elliot and Corey Chan Antarctic Support Contract 7400 S. Tucson Way Centennial , CO 08112 Michael Diamond...then along the road and down Hut Point Road. Sub-basin 2 has the largest area and encompasses the majority of the snowfield and the depression above
Keddie, Amanda
2009-01-01
This paper presents the philosophies and practices of "Laura", a young English community liaison worker and former religious studies teacher who has recently converted to Islam. Drawing on data generated from a qualitative and predominantly interview-based research project that investigated issues of pedagogy and social justice in…
Journal of Endocrinology, Metabolism and Diabetes of South Africa ...
African Journals Online (AJOL)
Sleep: a serious contender for the prevention of obesity and non-communicable diseases · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Dale E. Rae, Irshaad Ebrahim, Laura C. Roden, 48-49. http://dx.doi.org/10.1080/16089677.2016.1150574 ...
Vastutada lustides ja vastupidi / interv. Eva-Liisa Linder
2006-01-01
Lavakunstikooli XXII lend räägib kooliajast, õpetajatest ja õppetööst. Kõnelevad Mihkel Kabel, Martin Kõiv, Risto Kübar, Lauri Lagle, Tõnn Lamp, Mari-Liis Lill, Markus Luik, Ragne Pekarev, Laura Peterson, Ursula Ratasepp, Inga Salurand, Veiko Tubin, Nero Urke, Britta Vahur ja Sergo Vares
2011-09-01
NIOC Sugar Grove LT Stephen Gray , NATO Training Mission Afghanistan CTTC Andrew Hodyl, NIOC Colorado IT3 Adam Kissinger, SUSLA Korea LCDR Sven...Gauthier, NCTS Naples CTR1 Laura Geigel, NIOC Maryland IT3 Stephen Gerrald, NIOC Norfolk CTTC Derrick Gillespie, NIOC Texas CTR1 Eileen Girardy NIOC
Food for rumination : developing novel feeding strategies to improve the welfare of veal calves
Webb, L.E.
2014-01-01
Summary of thesis entitled: “Food for Rumination – Developing novel feeding strategies to improve the welfare of veal calves”, Laura Webb
Veal calves are typically fed high levels of milk replacer supplemented with solid feed, which tends to contain a relatively small roughage component.
Maalimine lubatud! 2014 A.D. = Painting allowed! 2014 A.D. / Jaan Elken
Elken, Jaan, 1954-
2014-01-01
Kaasaegsest maalikunstist Eestis. Vaadeldakse eredamaid hetki 2014. a. maalinäitustelt: Merike Estna isiknäitus Kumus, Eesti Kunstnike Liidu "Kevadnäitus", näitus "Sund" ja noorte maalikunstnike näitus "Cant go on, must go on" Tallinna Kunstihoones, Laura Põllu isiknäitus Hobusepea galeriis
77 FR 25510 - GPS Funds I, et al.; Notice of Application
2012-04-30
...] GPS Funds I, et al.; Notice of Application April 24, 2012. AGENCY: Securities and Exchange Commission... the Act to invest in certain financial instruments. Applicants: GPS Funds I, GPS Funds II (each a.... FOR FURTHER INFORMATION CONTACT: Laura L. Solomon, Senior Counsel, at (202) 551-6915 or Daniele...
Marrah, Arleezah; Mills, Roxanne
2011-01-01
This article describes the Librarianship Upgrades for Children and Youth Services (LUCY), a multifaceted multicultural continuing education program for librarians developed by the Library and Information Science Program at Old Dominion University. The Institute of Museum and Library Services (IMLS) funds LUCY through the Laura Bush 21st century…
Fooling the feeling of doing: a goal perspective on illusions of agency
Dannenberg, L.A.
2012-01-01
Machtige en succesvolle mensen zijn ongevoelig voor de illusie van agency (sturend vermogen). Dit komt omdat mensen die hun doel hebben bereikt of weten hoe ze dat kunnen bereiken, zich minder op de uitkomst van hun handelen hoeven te focussen. Dit blijkt uit onderzoek van Laura Dannenberg. Als
2011-02-23
... UNESCO (IO/UNESCO). Form Number: DS-7646. Respondents: U.S. college and university students applying for... students at U.S. colleges and universities, will submit descriptions of self-designed proposals for brief... Collection: DS-7652, U.S. National Commission for UNESCO Laura W. Bush Traveling Fellowship ACTION: Notice of...
PV Module Reliability Workshop | Photovoltaic Research | NREL
Gok, Cara Fagerholm, David M. Burns, Timothy J. Peshek, Laura S. Bruckman, Roger H. French Backsheet Chen, C. H. Hsueh, W. J. Hsieh Accurately Measuring PV Power Loss Due to Soiling-Michael Gostein and Walters, Stephen Barkaszi Tracking PV Changes: Bridging Between Thin-Film Cells and Modules-Russell
INHIBITION OF TOBACCO SMOKE-INDUCED LUNG INFLAMMATION BY A CATALYTIC ANTIOXIDANT
AMathematical Model for the Kinetics of the Male Reproductive Endocrine SystemLaura K. Potter1,2, H.A. Barton2 and R.W. Setzer21Curriculum in Toxicology, UNC-Chapel Hill, NC; 2US EPA, ORD, NHEERL, ETD, RTP, NCIn this presentation a model for the hormonal regul...
Wangai et al., Afr. J. Infect. Dis. (2011) 5(1): 1 - 6 SENSITIVITY OF ...
African Journals Online (AJOL)
AJTCAM
Wangai et al., Afr. J. Infect. Dis. (2011) 5(1): 1 - 6. 1. SENSITIVITY OF MICROSCOPY COMPARED TO MOLECULAR DIAGNOSIS OF P. FALCIPARUM: IMPLICATIONS ON MALARIA TREATMENT IN EPIDEMIC AREAS IN. KENYA. Laura Nyawira Wangai 1,2, Muriira Geoffrey Karau 3, Paul Nthakanio Njiruh 4, Omar Sabah 5 ...
Weiner, Jennie Miles; Burton, Laura J.
2016-01-01
In this study of nine participants in a turnaround principal preparation program, Jennie Miles Weiner and Laura J. Burton explore how gender role identity shaped participants' views of effective principal leadership and their place within it. The authors find that although female and male participants initially framed effective leadership…
the Cecil John Adams Travelling Fellowship
African Journals Online (AJOL)
1994-09-14
Sep 14, 1994 ... 1886 it boasted a coffee-shop, two chemists and a branch of the Standard Bank. ... him a son in 1898 but the infant died at the age of 6 months. By 1900 Florence ... By this time, he had married Laura Green. She was carrying ...
Gerli Padar läheb Eurovisioonile. Eurolaulu valiti 1,3 miljoni miljoni eest
2007-01-01
3. veebr. toimunud laulukonkursi Eurolaul 2007 võitis . Gerli Padar lauluga "Partners in Crime" (helilooja Hendrik Sal-Saller, sõnad Berit Veiber), teisele kohale jäi "Romeo ja Julia" Hele Kõre ja Kristjan Kasearu esituses, kolmandale Laura looga "Sunflowers". Telefonihääletusest ETV saates Eurolaul 2007
Briefing paper -- Remedial Action Assessment System
International Nuclear Information System (INIS)
Buelt, J.L.
1990-04-01
Congress has mandated a more comprehensive management of hazardous wastes with the Resource Conservation and Recovery Act (RCRA), the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA or ''Superfund'') and the Superfund Amendment and Reauthorization Act (SARA). This mandate includes restoration of disposal sites contaminated through past disposal practices. This mandate applies to facilities operated for and by the Department of Energy (DOE), just as it does to industrial and other institutions. To help implement the CERCLA/SARA remedial investigation and feasibility study (RI/FS) process in a consistent, timely, and cost-effective manner, a methodology needs to be developed that will allow definition, sorting, and screening of remediation technologies for each operable unit (waste site). This need is stated specifically in Section 2.2.2.1 of the October 1989 Applied Research, Development, Demonstration, Testing, and Evaluation (RDDT ampersand E) Plan of the DOE. This Briefing Paper is prepared to respond to this need. 1 fig
KEKUASAAN SIMBOLIK DALAM WACANA POLITIK DI MEDIA CETAK
Directory of Open Access Journals (Sweden)
Lilik Wahyuni
2008-12-01
Full Text Available As a social practice, language is used to persuade, influence, argue, refuse, maintain, and to response one’s reaction. Using language, one may practically pro- duce and reproduce authority. This article deals with the symbolic fight and the mechanism of symbolic force within politics discourse in written media. The analy- sis technique used is critical discourse analysis, especially in the interaction be- tween language and social structure. The result shows that the symbolic fight in the written media represents the practice of continuing the doxa by the orthodoxa group and of attacking it by the heterodoxa group. The strategies of fighting the doxa are by showing the orthodoxa group’s weaknesses, arousing the enmity within the group, comparing the orthodoxa group to others, and by using SARA and com- munity issues. The mechanism of the symbolic force used by the ortodoxa is the use of euphemism and censor. Key words: kekuasaan simbolik, doxa, orthodoxa, SARA, dan wacana politik.
The technical status of the supersara project at its termination
International Nuclear Information System (INIS)
Markovina, A.; Randles, J.
1987-01-01
On March 10th 1983 the Council of Ministers of the European Community adopted the decision to abandon the SuperSARA project. In the frame of this decision, the Management of the SuperSARA project formulated the guidelines to close the project, which included the preparation of the present final report. This report presents the final status of the project, which means that it reflects the situation in March 1983, with a few updates introduced shortly afterwards in conformity with the safety requirements which were being revised at that time. The aim of this report is to give a general description of activities which were carried on to implement the experimental programme and to illustrate some important achievements reached in specific areas. In addition, it is also intended to provide the access key to the documentation which was produced in the past years, so as to make the most significant technical material easily available for any possible future use
And now, a word from our sponsor.
Peebles, M Ellen
2003-10-01
Bryant Pharmaceutical's flagship product, a popular arthritis medicine called Seflex, is selling well--but not well enough. With generic versions due on the shelves in a couple of years, the drug company is looking for a dramatic sales increase. No wonder marketing VP Laura Goldenberg feels the pressure. She knows she has to reach more consumers, but in an environment where people bombarded with advertising are using devices such as TiVo to skip ads, her job has suddenly taken on a new intensity. In search of a new, gangbuster campaign, Laura and her ad agency come up with the idea of product placement--not your typical integration of a product into a television or movie script, but a less traditional approach. Their idea is to hire a much-loved, elderly actress to extol the virtues of Seflex on a morning news program. The news segment would be about arthritis, and Seflex would be casually mentioned during the interview. The company would have to pay the actress $1 million, and there are risks: What if it gets out that Bryant is paying her? What if the actress errs and says something about Seflex's side effects? If something goes wrong, Bryant Pharmaceutical's reputation could suffer. Should the company green-light Laura's plan? This fictional case study looks at the pros and cons of traditional product placement and newer, more subtle alternatives to advertising. Commenting on the case are Bob Gamgort, president of Masterfoods USA; Michelle R. Nelson, an assistant professor of journalism and mass communications at the University of Wisconsin, Madison; FTC commissioner Mozelle W. Thompson; and Mike Sheehan, president and CEO of Hill, Holliday, Connors, Cosmopulos.
Zapata, Mara
In this case study of a female science teacher named Laura, numerous observations, field notes, researcher interpretations, and assertions were developed. As meanings were negotiated, intent of actions was defined using significant statements, clustered to produce invariant meaning units. Both the participant's intents and how she interpreted her experiences were central to the understandings sought in this study. Whenever Laura planned for teaching science, taught, or otherwise interacted with students, the following four themes seemed to frame her actions: (1) Responsibility to Nurture/Mother/Mentor (2) Connecting to and Relating (3) Meeting Gender-Specific Expectations (4) Promoting the Fighter/Survivor Within. Each theme is examined in relation to attitudes and beliefs about teaching and learning science, and conclusions and assertions are expressed. The findings of this study point to the tensions between Laura's attitudes and beliefs and her pedagogical practices, disconfirming these as they pertain to gender in relation to teaching and learning science. It was not evident as part of her daily practice that student experiences were used in an attempt to create connections between their lives and science, although Laura always emphasized that science is a way of life. The findings support questioning the role of intentionality and a teacher's perceived ability to adhere to intentions while practicing within the norms established by the social institution of schools operating within the larger structures of society. The major findings and implications are relevant to the manner teachers are prepared and encouraged to enact their practice by departments and boards of education, prepared by institutions of higher education and subsequent participation in professional development. Specifically, calling attention to how these educational frameworks emphasize or de-emphasize the role of teachers and promote cognizance in terms of the culture of schools, reflective
2015 Liquid Crystals Gordon Research Conference and Gordon Research Seminar
2015-10-20
Faculdade de Ciências e Tecnologia , Universidade Nova de Lisboa, Portugal) "Joule-Heating Effect: A New Route to PDLCs Memory Removal" 9:55 am - 10...Madison Poster Presenter Registered Carvalho, Sara F UNINOVA, Faculdade de Ciências e Tecnologia , Universidade Nova de Lisboa Speaker Registered Cha
Demonstration and Commercialization of the Sediment Ecosystem Assessment Protocol (SEAP)
2017-07-09
31 6.1.1 Performance Objective #1: Water Quality Maintenance...green represents where a thin- layer sand cap was installed in April 2014. .................................................................12 Figure...device(s) PSNS Puget Sound Naval Shipyard QA/QC Quality Assurance/ Quality Control SARA Superfund Amendments and Reauthorization Act SCCWRP
Avgang 2017: Sommerkonsert i Aulaen
2017-01-01
Avgangsstudenter fra MA2 opera og studenter fra MA1 holder konsert med sang fra operaer, lieder og fra operetter. MA2 sangere: Hanne Korsbrekke Askeland, Dagfinn Andersen, Sara Aasen. MA1 sangere: Eilert Egil Taugbøl Hasseldal, Marcela Randem, Nora Oleanne Sårheim, Tina Therese Tuven
2012-10-15
... two single names (The Hillshire Brands Company and DE US, Inc.). II. Self-Regulatory Organization's... the Sara Lee Corporation's successor companies, The Hillshire Brands Company and DE US, Inc. This... things, that the rules of a clearing agency be designed to promote the prompt and accurate clearance and...
An electronic health record for infertility clinics | Coetsee | South ...
African Journals Online (AJOL)
Objective. To design a user-friendly electronic health record system for infertility clinics (EHRIC) to capture quality data that will allow advanced audit and practice analysis, and to use the captured data for the South African Register of Assisted Reproductive Techniques (SARA) database and as a clinical research function.
State Authorization Reciprocity Agreement: Participation and Access to Higher Education
Onwuameze, Nkechi
2017-01-01
The State Authorization Reciprocity Agreement initiative was launched in 2014 to provide a uniform standard for the regulation of distance education across states in the United States. The system established by the National Council for State Authorization Reciprocity Agreement (NC-SARA) allows willing post-secondary institutions to participate…
Krieg, Lisa Jenny
2015-01-01
Based on an ethnographic field study in Cologne, this article discusses the connection between memory practices and emotion ideologies in Holocaust education, using Sara Ahmed's concept of affective economies. Moral goals, political demands, and educators' care for their students lead to tensions in the education process. Two case studies…
Student Pressure Subject of Debate
Gewertz, Catherine
2006-01-01
This article discusses student pressure as a subject of debate. The latest debate about schoolwork is being fueled by three recent books: "The Homework Myth" by Alfie Kohn, "The Case Against Homework" by Sara Bennett and Nancy Kalish, and "The Overachievers", by Alexandra Robbins, which depicts overextended high…
Spazio ASI, INFN e Nobel Ting a caccia di antimateria
Boz,
2003-01-01
"Una apparecchiatura per la ricerca dell' antimateria che nell'autunno del 2005 sara' installata sulla Stazione Spaziale e' al centro di un accordo di collaborazione tra l'Agenzia Spaziale Italiana e il Nobel Samuel Ting, del Mit e del Cern di Ginevra, firmato oggi a Roma (1 page).
Teater valib parimad :"Maarja kuulutamine" püüab viit auhinda
2009-01-01
Eesti teatriauhindade sõnalavastuste nominentide hulgas paistab silma Lembit Petersoni lavastus "Maarja kuulutamine" Theatrumis. See kandideerib nii parima lavastuse kui ka parima lavastaja tiitlile, samuti on parima naisnäitleja nominentidena välja toodud õed Laura ja Maria Peterson ning Lembit Peterson kandideerib ka parima meeskõrvalosa auhinnale samas lavastuses
Sleep: a serious contender for the prevention of obesity and non ...
African Journals Online (AJOL)
Sleep: a serious contender for the prevention of obesity and non-communicable diseases. Dale E. Rae, Irshaad Ebrahim, Laura C. Roden. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.1080/16089677.2016.
The First Reactor, 40th Anniversary (rev.)
Energy Technology Data Exchange (ETDEWEB)
Allardice, Corbin; Trapnell, Edward R; Fermi, Enrico; Fermi, Laura; Williams, Robert C
1982-12-01
This booklet, an updated version of the original booklet describing the first nuclear reactor, was written in honor of the 40th anniversary of the first reactor or "pile". It is based on firsthand accounts told to Corbin Allardice and Edward R. Trapnell, and includes recollections of Enrico and Laura Fermi.
Cultivating Inquiry-Driven Learners: A College Education for the Twenty-First Century
Conrad, Clifton; Dunek, Laura
2012-01-01
Inquiry-driven learners anticipate, embrace, and adapt to disruptive change. Clifton Conrad and Laura Dunek advance a transformative purpose of a college education. They invite stakeholders from across higher education to engage in vigorous dialogue about the aims of a college education--and how to realize those aims. Increasingly influenced by…
Working in the Virtual Stacks: The New Library and Information Science
Kane, Laura Townsend, Ed.
2011-01-01
Thanks in part to technology, the boundaries of library positions are dissolving. It is no longer practical to discuss the profession in terms of traditional library types, and in today's library, the relationship between librarians and technology is stronger than ever. In this informative volume, veteran author Laura Townsend Kane interviews…
77 FR 204 - Federal Acquisition Regulation; Technical Amendments
2012-01-03
... Parts 4, 8, 15, 19, 22, 23, 28, 42, and 52 Government procurement. Dated: December 21, 2011. Laura... paragraph (a)(2) ``http:// www.sba.gov/GC/pcr.html'' and adding ``http://www.sba.gov/content/ procurement-center-representatives'' in its place. PART 22--APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITIONS 22...
1993-09-01
AF89-071. Washington: GPO, 1989. 159 14. Diaz , SSgt Laura, 648 Med Sq/SGHL. Personal interview. Brooks AFB, San Antonio TX, 14 July 1993. 15. EA...Training Strateav of the Acauisition Management of Hazardous Materials Program. Draft Report. McLean VA, August 1991. 36. Moore, SSgt Alicia . AL/OEVP
Discovery of carbon nanotubes. Sara ni carbon nanotube e
Energy Technology Data Exchange (ETDEWEB)
Iijima, S
1994-01-20
This paper describes the following matters on carbon nanotubes (CNt): CNt is discovered in carbon deposits generated in the tip of a negative electrode during DC arc discharge between carbon electrodes. CNt has a construction in which cylinders made of normally several layers are superposed, based on cylindrical crystals in a single layer with six-member rings of carbon atoms laid out. Spiral arrangement of carbon six-member rings has been discovered in the single-layered crystals. Five-member rings exist in a location where the CNt tip is closed, and seven-member rings in a location where the CNt presents a saddle-like curve, without exceptions. It is introduced theoretically that the electronic structure of the single-layered CNt depends on the cylinder diameter and spiral pitch. Replacing part of the carbon negative electrode with iron, and vaporizing iron and carbon simultaneously through arc discharge can result in a single-layered CNt with a diameter of 1 nm. Heating the CNt deposited with metallic lead in an oxygen atmosphere can form CNt containing lead compounds. 19 refs., 9 figs.
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available 1| unnamed protein product [Mus musculus] gb|EAW65549.1| non imprinted in Prader-Willi/Angelman syndrome 1, ...isoform CRA_a [Homo sapiens] gb|EAW65551.1| non imprinted in Prader-Willi/Angelman syndrome 1, isoform CRA_a... [Homo sapiens] gb|ABM82178.1| non imprinted in Prader-Willi/Angelman syndrome 1 ...[synthetic construct] gb|ABM85364.1| non imprinted in Prader-Willi/Angelman syndrome 1 [synthetic construct] CAD97953.1 1e-113 81% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1549 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndent protein export [Herminiimonas arsenicoxydans] emb|CAL63167.1| twin-arginine translocase subunit, sec-i...ndependent protein export [Herminiimonas arsenicoxydans] YP_001101288.1 2.0 37% ...
Structure of Rot, a global regulator of virulence genes in Staphylococcus aureus.
Zhu, Yuwei; Fan, Xiaojiao; Zhang, Xu; Jiang, Xuguang; Niu, Liwen; Teng, Maikun; Li, Xu
2014-09-01
Staphylococcus aureus is a highly versatile pathogen that can infect human tissue by producing a large arsenal of virulence factors that are tightly regulated by a complex regulatory network. Rot, which shares sequence similarity with SarA homologues, is a global regulator that regulates numerous virulence genes. However, the recognition model of Rot for the promoter region of target genes and the putative regulation mechanism remain elusive. In this study, the 1.77 Å resolution X-ray crystal structure of Rot is reported. The structure reveals that two Rot molecules form a compact homodimer, each of which contains a typical helix-turn-helix module and a β-hairpin motif connected by a flexible loop. Fluorescence polarization results indicate that Rot preferentially recognizes AT-rich dsDNA with ~30-base-pair nucleotides and that the conserved positively charged residues on the winged-helix motif are vital for binding to the AT-rich dsDNA. It is proposed that the DNA-recognition model of Rot may be similar to that of SarA, SarR and SarS, in which the helix-turn-helix motifs of each monomer interact with the major grooves of target dsDNA and the winged motifs contact the minor grooves. Interestingly, the structure shows that Rot adopts a novel dimerization model that differs from that of other SarA homologues. As expected, perturbation of the dimer interface abolishes the dsDNA-binding ability of Rot, suggesting that Rot functions as a dimer. In addition, the results have been further confirmed in vivo by measuring the transcriptional regulation of α-toxin, a major virulence factor produced by most S. aureus strains.
Steele, Michael A; Croom, Jim; Kahler, Melissa; AlZahal, Ousama; Hook, Sarah E; Plaizier, Kees; McBride, Brian W
2011-06-01
Alterations in rumen epithelial structure and function during grain-induced subacute ruminal acidosis (SARA) are largely undescribed. In this study, four mature nonlactating dairy cattle were transitioned from a high-forage diet (HF; 0% grain) to a high-grain diet (HG; 65% grain). After feeding the HG diet for 3 wk, the cattle were transitioned back to the original HF diet, which was fed for an additional 3 wk. Continuous ruminal pH was measured on a weekly basis, and rumen papillae were biopsied during the baseline and at the first and final week of each diet. The mean, minimum, and maximum daily ruminal pH were depressed (P < 0.01) in the HG period compared with the HF period. During the HG period, SARA was diagnosed only during week 1, indicating ruminal adaptation to the HG diet. Microscopic examination of the papillae revealed a reduction (P < 0.01) in the stratum basale, spinosum, and granulosum layers, as well as total depth of the epithelium during the HG period. The highest (P < 0.05) papillae lesion scores were noted during week 1 when SARA occurred. Biopsied papillae exhibited a decline in cellular junctions, extensive sloughing of the stratum corneum, and the appearance of undifferentiated cells near the stratum corneum. Differential mRNA expression of candidate genes, including desmoglein 1 and IGF binding proteins 3, 5, and 6, was detected between diets using qRT-PCR. These results suggest that the structural integrity of the rumen epithelium is compromised during grain feeding and is associated with the differential expression of genes involved in epithelial growth and structure.
Directory of Open Access Journals (Sweden)
Tatiana Bremova-Ertl
2018-01-01
Full Text Available ObjectivesTo evaluate the function of the oculomotor and vestibular systems and to correlate these findings with the clinical status of patients with Gaucher disease type 3 (GD3. The goal of this cross-sectional and longitudinal study was to find oculomotor biomarkers for future clinical trials.MethodsTwenty-six patients with GD3 were assessed for eligibility and 21 were able to perform at least one task. Horizontal and vertical reflexive saccades, smooth pursuit, gaze-holding, optokinetic nystagmus, and horizontal vestibulo-ocular reflex (VOR were examined by video-oculography/video-head impulse test and compared concurrently with 33 healthy controls. The Scale for the Assessment and Rating of Ataxia (SARA, the modified Severity Scoring Tool (mSST, and Grooved Pegboard Test (GPT were administered to assess overall neurological function. Eleven patients were also re-assessed after 1 year.ResultsNine out of 17 patients exhibited gaze-holding deficits. One patient had upbeat nystagmus. Three patients presented with bilateral abducens palsy in combination with central oculomotor disorders, suggesting a bilateral involvement of the abducens nucleus. Horizontal angular VOR gain was reduced in all patients (0.66 ± 0.37 compared with controls (1.1 ± 0.11, p < 0.001. Most strongly correlated with clinical rating scales were peak velocity of downward saccades (SARA: ρ = −0.752, p < 0.0005; mSST: ρ = −0.611, p = 0.003; GPT: ρ = −0.649, p = 0.005 and duration of vertical saccades (SARA: ρ = 0.806, p < 0.001; mSST: ρ = 0.700, p < 0.0005; GPT: ρ = 0.558, p = 0.02 together with the VOR gain (SARA: ρ = −0.63, p = 0.016; mSST: ρ = −0.725, p = 0.003; GPT: ρ = −0.666, p = 0.004. Vertical smooth pursuit gain decreased significantly at follow-up.InterpretationThis study shows neuronal degeneration of the brainstem and cerebellum with combined involvement of
2011-10-31
... substitute other bakery or food products for sliced bread for these and other uses. Therefore, a hypothetical... BBU and Sara Lee branded sliced-bread products as their first and second choices in sliced-bread... would be profitable after the acquisition. The same profit motive would apply to an increase in the...
Renewing Head Start's Promise: Invest in What Works for Disadvantaged Preschoolers
Mead, Sara
2014-01-01
Since Head Start's last reauthorization in 2007, the Department of Health and Human Services, which oversees Head Start, has implemented significant reforms that are improving the program. In "Renewing Head Start's Promise: Invest in What Works for Disadvantaged Preschoolers," Sara Mead offers several recommendations to enable…
Leveraging Existing Laboratory Capacity towards Universal Health ...
African Journals Online (AJOL)
Adequately equipped clinical laboratories should provide early warning signals of health risks. The Assessment categorized the laboratories at three levels relating to the type of facility, these being hospital, health center and health post. This study used results from the SARA to determine the ability to make timely diagnosis ...
African Journal of Biotechnology - Vol 15, No 33 (2016)
African Journals Online (AJOL)
Micropropagation of caçari under different nutritive culture media, antioxidants, and levels of agar and pH · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Maria Da Conceicao Da Rocha Araujo, Edvan Alves Chagas, Maria Isabel Ribeiro Garcia, Sara Thiele Sobral ...
Harvard Education Letter. Volume 23, Number 2, March-April 2007
Chauncey, Caroline, Ed.
2007-01-01
"Harvard Education Letter" is published bimonthly at the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) More Than "Making Nice": Getting Teachers to (Truly) Collaborate (Laura Pappano); (2) "Doing the Critical Things First": An Aligned Approach to PreK and Early Elementary Math;…
HPV Prevention (A Cup of Health with CDC)
Centers for Disease Control (CDC) Podcasts
2016-07-07
Human papillomavirus, or HPV, is a virus that can cause certain cancers and is the most commonly sexually transmitted infection in the U.S. In this podcast, Dr. Laura Viens discusses the importance of getting vaccinated against HPV. Created: 7/7/2016 by MMWR. Date Released: 7/7/2016.
2010-04-01
Rubrics for the ASBMB Undergraduate Poster Competition 2007 Dr. David Usher (Dept. of Biological Sciences), Tyler Larsen and Laura Sloofman. A good site...did his research on a genetic disease called Spinal Muscular Atrophy, also known as SMA. "I did research up at the Children’s Hospital because this is a
Dzhässikavad toovad linna jõulurõõmu / Silja Joon
Joon, Silja, 1966-
2008-01-01
"Jazzkaare" kolm dzhässiõhtut Pärnus - 3. dets. Eliisabeti kirikus Raivo Tafenau, Ain Agan ja Laura Põldvere, 9. dets. Endla teatris Saksamaa vokaalansambel Berlin Voices (Esther Kaiser, Sarah Kaiser, Marc Secara, Kristofer Benn) ja 11. dets. Ammende villas norra laulja Gine Andressen. Berlin Voices soojendusansamblina esineb Pärnu noorte vokaalansambel Greip
Mesto vstretshi - Tallinn / Aleksandra Manukjan
Manukjan, Aleksandra
2003-01-01
22. juulil avatakse Rotermanni soolalaos rahvusvaheline Põhja- Euroopa kaasaegse kunsti näitus "Kohtumispaik". Eesti kuraator on Hanno Soans, nimetatud ka kuraatoreid teistest maadest. Osalejatest on esile toodud Laura Stasiulyte, Miklos Gaal ja Sandis Konrads, nimetatud veel 13 osaleja nimed. Projekti autor ja mänedžer on rootsi kunstnik Truls Olin
Controlling Mosquitoes Outside
Centers for Disease Control (CDC) Podcasts
Mosquitoes can carry viruses, like West Nile, Zika, dengue, and chikungunya. In this podcast, Mr. Hubbard will teach you and his neighbor, Laura, ways to help reduce the number of mosquitoes outside your home. Tips include eliminating areas of standing water where mosquitoes lay eggs and using larvicides to kill young mosquitoes.
"Butterfly under a Pin": An Emergent Teacher Image amid Mandated Curriculum Reform
Craig, Cheryl J.
2012-01-01
The author examines 1 experienced teacher's image of teaching and how it was purposely changed--through external intervention and against the individual's will--from the view of teacher as curriculum maker to the view of teacher as curriculum implementer. Laura's account of the "butterfly under a pin" image, a version of the…
DEFF Research Database (Denmark)
Sarauw, Laura Louise; Hessel, Niklas
2011-01-01
Laura Louise Sarauw har netop forsvaret sin ph.d.-afhandling i Pædagogik ved Københavns Universitet. Hun har undersøgt, hvordan det har påvirket ti humanistiske uddannelser, at deres studieordninger med universitetsreformen i 2003 blev skrevet om, så de fokuserede på de erhvervsmæssige kompetence...
Maakondliku Liivide etluskonkursi võitis gümnasist Marian Heinat / Ene Kallas
Kallas, Ene
2008-01-01
Maakondliku Juhan ja Jakob Liivi etluskonkursi žüriisse kuulusid Ott Aardam, Käthe Pihlak, Piret Rauk, Vaido Luks ja Marili Pärtel. Grand prix' võitis Marian Heimat, laureaatideks tulid Liisa Saaremäel, Maria Pihlak ja Laura Oolup. Eripreemiad said Marii Metsmaa, Ermo Loik, Sander Aavik, Kaimar Nuut ja Priidu Aardam
Rescuing the Soiled Dove: Pop Culture's Influence on a Historical Narrative of Prostitution
Voelkel, Micki; Henehan, Shelli
2018-01-01
American popular culture romanticises relationships between sex workers and their customers; novels, films and television depict prostitutes as innocents in need of rescue by a wealthy or powerful man. Miss Laura's Social Club, a restored Victorian brothel in Fort Smith, Arkansas, USA, functions both as an informal house museum and the visitor…
77 FR 45592 - Marine Mammals; File No. 17157
2012-08-01
..., Silver Spring, MD 20910; phone (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th... INFORMATION CONTACT: Laura Morse or Jennifer Skidmore, (301) 427-8401. SUPPLEMENTARY INFORMATION: On May 21... 1969 (42 U.S.C. 4321 et seq.), a final determination has been made that the activity proposed is...
Diversity in the Workplace [in HRD].
1995
These four papers are from a symposium that was facilitated by Laura Bierema at the 1995 conference of the Academy of Human Resource Development (HRD). "The Status of Valuing and Managing Diversity in Fortune 500 Manufacturing and Fortune 500 Service Organizations: Perceptions of Top Human Resource Professionals" (Sandra J. Johnson) reports a…
Vabadussamba parimad ideed tulid tudengitelt / Garel Püüa
Püüa, Garel
2007-01-01
Tallinna Vabadussamba ideekonkursil teise koha saavutanud töö "Meie inimesed" keskendus moodsa linnaruumi loomisele (autorid Marten Kaevats, Mihkel Kaevats, Ülo Kaevats, Peeter Vihma, Merit Kask ja Martin Sookael), kolmanda koha töö "Illusioon" oli abstraktsem (autorid Martin Tago, Tõnis Malkov, Kertu Tuberg ja Laura Kuusk). Kommenteerib Ülar Mark
Diálogo con Manuel Chiriboga sobre nueva ruralidad
Pérez E, Laura
2012-01-01
Introducción Lo que sigue es una conversación por correo electrónico que Laura Pérez E., de PERSPECTIVAS RURALES, mantuvo con Manuel Chiriboga, especialista en desarrollo rural, con amplia experiencia en toda América Latina y la problemática de su país, Ecuador…
The Relationships among Writing Skills, Writing Anxiety and Metacognitive Awareness
Balta, Elif Emine
2018-01-01
The purpose of this study was to investigate the relationships among students' argumentative text writing skills, writing anxiety, and metacognitive awareness. The participants were composed of 375 8th graders in six middle schools in Sivas. Metacognitive Awareness Inventory (B Form) which was adapted in to Turkish by Karakelle & Saraç (2007)…
Workplace Stress Relief (A Cup of Health with CDC)
Centers for Disease Control (CDC) Podcasts
2014-07-31
The stress of everyday life can lead to all kinds of health problems. Itâs particularly a problem at work. In this podcast, Dr. Sara Luckhaupt discusses the health impact of work-related stress. Created: 7/31/2014 by MMWR. Date Released: 7/31/2014.
75 FR 59983 - National Priorities List, Final Rule-Newtown Creek
2010-09-29
...? H. May EPA delete portions of sites from the NPL as they are cleaned up? I. What is the Construction...), added by SARA. The revised HRS evaluates four pathways: Ground water, surface water, soil exposure, and... the site are typically not known at the time of listing. Although a CERCLA ``facility'' is broadly...
78 FR 31417 - National Priorities List, Final Rule No. 56
2013-05-24
... would be time-consuming or costly. In other cases, data for scoring some pathways are available, but... NPL as they are cleaned up? I. What is the Construction Completion List (CCL)? J. What is the sitewide... partly in response to CERCLA section 105(c), added by SARA. The revised HRS evaluates four pathways...
75 FR 9790 - National Priorities List, Final Rule-Gowanus Canal
2010-03-04
... of Sites From the NPL as They Are Cleaned Up? I. What Is the Construction Completion List (CCL)? J...), added by SARA. The revised HRS evaluates four pathways: ground water, surface water, soil exposure, and... the site are typically not known at the time of listing. Although a CERCLA ``facility'' is broadly...
International Nuclear Information System (INIS)
1985-01-01
This progress report ISN 1984-1985 deals with the following subjects: nuclear physics theory, peripheral and intermediate energy physics, characteristics of reaction mechanisms in heavy ion collisions, nuclear structure, fundamental interactions, experimental methods and new instrumentation, some interdisciplinary research activities and technical activities, the SARA cyclotron and finally, technology transfer and valorisation [fr
The Workplace Literacy System Project (WLS). Final Performance Report.
Poulton, Bruce R.
The Workplace Literacy System Project (WLS) prepared interactive CD-ROM discs containing about 50 hours of instruction and drill in basic skills presented within the context of the textile/apparel manufacturing industry. The project was conducted at a Sara Lee knit products plant in North Carolina. During the project, literacy task analyses were…
Harvard Education Letter. Volume 23, Number 4, July-August 2007
Chauncey, Caroline, Ed.
2007-01-01
"Harvard Education Letter" is published bimonthly by the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) Meeting of the Minds: The Parent-Teacher Conference Is the Cornerstone of School-Home Relations. How Can It Work for All Families? (Laura Pappano); (2) In Search of That "Third…
Music Activities for "Mama", "Mama" and "Papa", "Papa"
Cardany, Audrey Berger
2011-01-01
Jean Marzollo creates two beautiful texts using a child's first words, "Mama, Mama" and "Papa, Papa" as a recurring theme. Wildlife artist, Laura Regan, illustrates Marzollo's poetry with loving images of parents and children in the animal kingdom. Poetry and illustrations highlight the tenderness and care of Mama and Papa as they bond with their…
Moskvalased näevad eesti nüüdiskunsti / Johannes Saar
Saar, Johannes, 1965-
2007-01-01
Moskvas nüüdiskunsti keskuses avatakse 19.09.2007 eesti kunstnike grupinäitus "Tagurpidi bluus". Anna Hints, Laura Kuusk, Neeme Külm, Kristina Norman, Jüri Ojaver, Jaan Paavle, Jaan Toomik ja Paul Rodgers pakuvad videos, fotos ja installatsioonides mõtlemisainet kultuurilise konsensuse üle. Näituse korraldaja on Kaasaegse Kunsti Eesti Keskus
2010-01-01
ReUse Republic disainilaadast Kristiine Keskuses Tallinnas 3.-7. veebruaril 2010. Ürituse raames loovad noored disainerid tuntud moebrändide laojääkidest originaalesemeid ning müüvad neid. Taaskasutust propageeriva konkursi Uus-ReUse parimate tööde tutvustus. Võidutööks osutus Laura Toomsalu kilekottidest valmistatud valgusti
"Why Do They Hate Us?": Leading amid Criticism, Crisis, and Disrespect
Karpinski, Carol F.
2012-01-01
Laura Dannon, an educator with experience as teacher, assistant principal, and principal, enjoys her profession. Faculty camaraderie and student/teacher busyness at her school have led her to think all is well. A sudden outburst by a new teacher causes her to reflect on what is really happening. What has changed? Have media criticism, movements…
Margus Laanet - erakust mässaja / Erle Selling
Selling, Erle
2001-01-01
Eesti päritolu kunstnikust Margus Laanetist (s. 16. juulil 1965 Väike-Maarjas), kes peab oma kodumaaks Hondurast, elab peamiselt Guatemalas, korraldab näitusi ka teistes Ladina-Ameerika maades. Tema üheksast isiknäitusest (1989-2000), retseptsioonist. Mehhiko kunstiteadlase Karen Reiman Cordero, argentiina kunstiteadlase Laura Malosetti-Costa ja M. Laaneti kommentaarid.
Interdistsiplinaarne, rahvusvaheline / Tiina Käesel
Käesel, Tiina, 1943-
2011-01-01
8. Kaunase tekstiilibiennaalist. Lähemalt Laima Oržekauskienė, Jolanta Šmidtienė, Máximo Laura (Peruu) töödest, Leedu projektist "Tagasikeritud ajalugu". Lühidalt Eesti kollektsioonist satelliitnäituste seas. Läti Kunstiakadeemia 90. aastapäevale ja tekstiilikateedri 50. aastapäevale pühendatud vaibakunsti näitusest Riias
Assessing 21st Century Skills: A Guide to Evaluating Mastery and Authentic Learning
Greenstein, Laura
2012-01-01
The Common Core State Standards clearly define the skills students need for success in college and the 21st century workplace. The question is, how can you measure student mastery of skills like creativity, problem solving, and use of technology? Laura Greenstein demonstrates how teachers can teach and assess 21st century skills using authentic…
Advice for Fund Raisers: Know Your Donors and Never Let Them See You Sweat
Masterson, Kathryn
2008-01-01
The psychology behind getting the big gift and making "the ask" for it was a major topic at Fund Raising Day in New York 2008, which drew representatives from across the nonprofit world, including charities, hospitals, colleges, and museums. Laura Fredricks, who was vice president for philanthropy at Pace University from 2002 until earlier this…
75 FR 50748 - Marine Mammals; File No. 14514
2010-08-17
..., Silver Spring, MD 20910; phone (301) 713-2289; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th... INFORMATION CONTACT: Amy Sloan or Laura Morse, (301) 713- 2289. SUPPLEMENTARY INFORMATION: On May 3, 2010... Policy Act of 1969 (42 U.S.C. 4321 et seq.), a final determination has been made that the activity...
Arin, Laura
2002-01-01
Memoria de tesis doctoral presentada por Laura Arin Carrau para obtener el título de Doctora en Biología por la Universitat Autònoma de Barcelona (UAB), realizada bajo la dirección de la Dra. Marta Estrada Miyares del Institut de Ciències del Mar (ICM-CSIC).-- 176 pages
Tsoon libiseb ajast ära nagu Kodaki slaididki / Laura Kuusk
Kuusk, Laura, 1982-
2006-01-01
Prantsuse kunstniku Dove Alluoche'i püüdest leida Arvo Iho abiga paigad, kus Andrei Tarkovski 28 aastat tagasi väntas filmi "Stalker", rekonstrueerides Sergei Didõki kaamera vahendusel Tarkovski vaatepunkte ja taastades "tsoonis" tolleaegset atmosfääri. Seeria "Tsoon" koosneb 13 fotost, mida eksponeeritakse Tallinnas, Pariisis, Bueonos Aireses ja mujal