Teratogenic effect of yogurt in mice fetus (Mus musculus

Directory of Open Access Journals (Sweden)

Dwisari Dillasamola

2018-04-01

Full Text Available Yogurt is one of the dairy products made from lactic acid fermentation by using Lactobacillus bulgaricus and Streptococcus thermophilus. A study on teratogenic effects of yogurt on the white female mice fetus (Mus musculus has been carried out. Pregnant mice used were 20 which divided into 4 groups : the control group, D1, D2, and D3. The treatments giveThe mice were Distidelled water (control, 0.52 yogurt (D1, 1.04  yogurt (D2, and 2.08 g yogurt (D3. Data were analyzed using one-way ANOVA followed by Duncan multiple range test. Results showed that administration of yogurt during pregnancy could affect mother body weight of mice (P 0,05. Observations with Alizarin solution did not show skeletal defects in comparison to the control group. Observations with Bouin’s solution showed defective visceral cleft palate in fetal mice yogurt group D3. This study conclude that yogurt is safe to consume in groups D1 and D2. Yogurt has the potential to cause fetal teratogenic in group D3

On the tear proteome of the house mouse (Mus musculus musculus in relation to chemical signalling

Directory of Open Access Journals (Sweden)

Romana Stopkova

2017-07-01

Full Text Available Mammalian tears are produced by lacrimal glands to protect eyes and may function in chemical communication and immunity. Recent studies on the house mouse chemical signalling revealed that major urinary proteins (MUPs are not individually unique in Mus musculus musculus. This fact stimulated us to look for other sexually dimorphic proteins that may—in combination with MUPs—contribute to a pool of chemical signals in tears. MUPs and other lipocalins including odorant binding proteins (OBPs have the capacity to selectively transport volatile organic compounds (VOCs in their eight-stranded beta barrel, thus we have generated the tear proteome of the house mouse to detect a wider pool of proteins that may be involved in chemical signalling. We have detected significant male-biased (7.8% and female-biased (7% proteins in tears. Those proteins that showed the most elevated sexual dimorphisms were highly expressed and belong to MUP, OBP, ESP (i.e., exocrine gland-secreted peptides, and SCGB/ABP (i.e., secretoglobin families. Thus, tears may have the potential to elicit sex-specific signals in combination by different proteins. Some tear lipocalins are not sexually dimorphic—with MUP20/darcin and OBP6 being good examples—and because all proteins may flow with tears through nasolacrimal ducts to nasal and oral cavities we suggest that their roles are wider than originally thought. Also, we have also detected several sexually dimorphic bactericidal proteins, thus further supporting an idea that males and females may have adopted alternative strategies in controlling microbiota thus yielding different VOC profiles.

Polymorphism in hybrid male sterility in wild-derived Mus musculus musculus strains on proximal chromosome 17.

Science.gov (United States)

Vyskocilová, Martina; Prazanová, Gabriela; Piálek, Jaroslav

2009-02-01

The hybrid sterility-1 (Hst1) locus at Chr 17 causes male sterility in crosses between the house mouse subspecies Mus musculus domesticus (Mmd) and M. m. musculus (Mmm). This locus has been defined by its polymorphic variants in two laboratory strains (Mmd genome) when mated to PWD/Ph mice (Mmm genome): C57BL/10 (carrying the sterile allele) and C3H (fertile allele). The occurrence of sterile and/or fertile (wild Mmm x C57BL)F1 males is evidence that polymorphism for this trait also exists in natural populations of Mmm; however, the nature of this polymorphism remains unclear. Therefore, we derived two wild-origin Mmm strains, STUS and STUF, that produce sterile and fertile males, respectively, in crosses with C57BL mice. To determine the genetic basis underlying male fertility, the (STUS x STUF)F1 females were mated to C57BL/10 J males. About one-third of resulting hybrid males (33.8%) had a significantly smaller epididymis and testes than parental animals and lacked spermatozoa due to meiotic arrest. A further one-fifth of males (20.3%) also had anomalous reproductive traits but produced some spermatozoa. The remaining fertile males (45.9%) displayed no deviation from values found in parental individuals. QTL analysis of the progeny revealed strong associations of male fitness components with the proximal end of Chr 17, and a significant effect of the central section of Chr X on testes mass. The data suggest that genetic incompatibilities associated with male sterility have evolved independently at the proximal end of Chr 17 and are polymorphic within both Mmd and Mmm genomes.

The Effect of Curry Leaves (Murayya Koenigii L. on Blood Glucose Levels In Alloxan Diabetic Mice (Mus Musculus

Directory of Open Access Journals (Sweden)

Fauziah Fauziah

2014-07-01

Full Text Available This study was conducted to determine the effect of ethanol extract of curry leaves (Murraya koenigii L. on blood glucose levels in alloxan diabetic mice (Mus musculus. The diabetic conditions were made by giving alloxan 75 mg/kg body weight (BW and the hypoglycemic effects of extract of curry leaves given with various doses.   This study used 24 male mice strain Balb/c in four groups of treatment with six replications, namely the negative control group, the ethanol extract of curry leaf tree 50% mL/10g body weight group, 70% mL/10g body weight group and 90% mL/10g body weight group. The treatment was given orally by using a gastric sonde for 14 days. Blood samples were taken through the sinus caudalis using a scissors. Blood glucose level was measured at 1st , the 8th and the 24th of treatment using blood glucose test strips and Nesco® Multicheck apparatus. Blood glucose data were analyzed by one way ANOVA (Analysis of Variants and followed by Tuckey test at significance level of 5%. The result showed that treatment of ethanol extract of curry leaves (Murraya koenigii at various doses significantly affected the decrease on blood glucose levels of mice (Mus musculus alloxan diabetic.

The uncharacterized gene 1700093K21Rik and flanking regions are correlated with reproductive isolation in the house mouse, Mus musculus.

Science.gov (United States)

Kass, David H; Janoušek, Václav; Wang, Liuyang; Tucker, Priscilla K

2014-06-01

Reproductive barriers exist between the house mouse subspecies, Mus musculus musculus and M. m. domesticus, members of the Mus musculus species complex, primarily as a result of hybrid male infertility, and a hybrid zone exists where their ranges intersect in Europe. Using single nucleotide polymorphisms (SNPs) diagnostic for the two taxa, the extent of introgression across the genome was previously compared in these hybrid populations. Sixty-nine of 1316 autosomal SNPs exhibited reduced introgression in two hybrid zone transects suggesting maladaptive interactions among certain loci. One of these markers is within a region on chromosome 11 that, in other studies, has been associated with hybrid male sterility of these subspecies. We assessed sequence variation in a 20 Mb region on chromosome 11 flanking this marker, and observed its inclusion within a roughly 150 kb stretch of DNA showing elevated sequence differentiation between the two subspecies. Four genes are associated with this genomic subregion, with two entirely encompassed. One of the two genes, the uncharacterized 1700093K21Rik gene, displays distinguishing features consistent with a potential role in reproductive isolation between these subspecies. Along with its expression specifically within spermatogenic cells, we present various sequence analyses that demonstrate a high rate of molecular evolution of this gene, as well as identify a subspecies amino acid variant resulting in a structural difference. Taken together, the data suggest a role for this gene in reproductive isolation.

The screening of parasites and viral pathogens of small mammals from a farm in southern Finland, and genetic identification of the Finnish house mouse, Mus musculus

Czech Academy of Sciences Publication Activity Database

Laakkonen, J.; Kallio-Kokko, M.; Vapalahti, O.; Vaheri, A.; Vyskočilová, M.; Munclinger, P.; Macholán, Miloš; Henttonen, H.

2007-01-01

Roč. 44, - (2007), s. 202-208 ISSN 0003-455X EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z50450515 Keywords : Mus musculus Subject RIV: EG - Zoology Impact factor: 1.537, year: 2007

Parâmetros morfofisiológicos testiculares de camundongos (Mus musculus suplementados com geleia real Morphophysiological parameters of mice (Mus musculus testicles supplemented with royal jelly

Directory of Open Access Journals (Sweden)

A.C.T. Morais

2009-02-01

Full Text Available Avaliaram-se os efeitos da geleia real sobre os parâmetros morfofisiológicos testiculares de camundongos (Mus musculus. Utilizaram-se 57 machos Swiss, com quatro meses de idade, distribuídos aleatoriamente em seis tratamentos: T1: solução fisiológica, via intraperitoneal; T2: 0,1mg de geleia real, via intraperitoneal; T3: 0,2mg de geleia real, via intraperitoneal; T4: água destilada, via oral; T5: 0,1mg de geleia real, via oral; e T6: 0,2mg de geleia real, via oral. Após 45 dias de suplementação com geleia real, os animais sacrificados e pesados tiveram seus testículos coletados, incluídos em parafina e corados com hematoxilina/eosina. Não houve diferença entre os tratamentos quanto aos: pesos corporal e testicular, índice gonadossomático, diâmetro tubular, altura do epitélio, comprimento total dos túbulos seminíferos, comprimento tubular por grama de testículo, índices tubulossomático e leydigossomático e valores de proporção volumétrica referentes à túnica própria, epitélio seminífero, vaso sanguíneo e vaso linfático. Foi encontrada diferença entre T1 e T3 em relação aos túbulos seminíferos e ao espaço intertubular.The effects of royal jelly on the morphophysiological parameters of mice (Mus musculus testicles were studied. Fifty-eight male Swiss mice were evaluated. They were four-month old and were randomly distributed in six treatments: T1: physiological solution, intraperitonial route; T2: 0.1mg of royal jelly, intraperitonial route; T3: 0.2mg of royal jelly, intraperitonial route; T4: distilled water, orally; T5: 0.1mg of royal jelly, orally; and T6: 0.2mg of royal jelly, orally. After 45 days of supplementation with royal jelly, the animals were weighted, slaughtered, and the testicles collected, included in paraffin, and stained with haematoxylin-eosin. No differences among treatments were observed for: body and testicular weights, gonadossomatic index, tubular diameter, epithelial height, total

Effect of Pasak Bumi (Eurycoma longifolia Jack) Root In Precopulation Stage to the Fertility of Female Mouse (Mus musculus L.)

OpenAIRE

Marlinza, Rosa

2012-01-01

Pasak Bumi (Eurycoma longifolia Jack) have potency to be used to increase bodyendurance, to cure malaria drug, and to act as afrodisiak. However, the effect of pasak bumi onwomen fertility, especially at pre-copulation stage was not widely known. This research seeks toreveal the effect pasak bumi extract treated at pre-copulation phase on fertility. This experimentemploy mice (Mus Musculus L.) and was undertaken at Biology and Cemistry laboratories PMIPA, andVeterinary laboratory of Jambi Uni...

PENGARUH TRITERPEN TOTAL PEGAGAN (Centella asiatica (L Urban TERHADAP FUNGSI KOGNITIF BELAJAR DAN MENGINGAT PADA MENCIT JANTAN ALBINO (Mus musculus YANG DIHAMBAT DENGAN SKOPOLAMIN

Directory of Open Access Journals (Sweden)

Herlina

2010-11-01

Full Text Available Pegagan (Centella asiatica (L Urban has been described to posses CNS effects such as improving cognitive function, learning and memory. The aim of the research was to evaluate the effects of total triterpen’s pegagan extract on cognitive functions as the learning and memory performance in male albino mice (Mus musculus inhibited by scopolamine. The research design was Complete Randomized Design (RAL – factorial on thirty six mice divided into 4 groups. One control group received only aquabidest (negative control. Three treatment groups received total triterpen 16 mg/kg BW, 32 mg/kg BW orally and piracetam 500 mg/kg BW by intra peritoneally (positive control for 21 days. Data indicating learning and memory process of all subjects were obtained from one-trial passive avoidance test. Data were analyzed by two way ANOVA and BNT (p0,05. In conclusion, total triterpen from pegagan (Centella asiatica (L Urban improved learning ability and memory of male albino mice (Mus musculus even though, it was inhibited by scopolamine.

Molecular heterogeneity in major urinary proteins of Mus musculus subspecies: potential candidates involved in speciation

Science.gov (United States)

Hurst, Jane L.; Beynon, Robert J.; Armstrong, Stuart D.; Davidson, Amanda J.; Roberts, Sarah A.; Gómez-Baena, Guadalupe; Smadja, Carole M.; Ganem, Guila

2017-01-01

When hybridisation carries a cost, natural selection is predicted to favour evolution of traits that allow assortative mating (reinforcement). Incipient speciation between the two European house mouse subspecies, Mus musculus domesticus and M.m.musculus, sharing a hybrid zone, provides an opportunity to understand evolution of assortative mating at a molecular level. Mouse urine odours allow subspecific mate discrimination, with assortative preferences evident in the hybrid zone but not in allopatry. Here we assess the potential of MUPs (major urinary proteins) as candidates for signal divergence by comparing MUP expression in urine samples from the Danish hybrid zone border (contact) and from allopatric populations. Mass spectrometric characterisation identified novel MUPs in both subspecies involving mostly new combinations of amino acid changes previously observed in M.m.domesticus. The subspecies expressed distinct MUP signatures, with most MUPs expressed by only one subspecies. Expression of at least eight MUPs showed significant subspecies divergence both in allopatry and contact zone. Another seven MUPs showed divergence in expression between the subspecies only in the contact zone, consistent with divergence by reinforcement. These proteins are candidates for the semiochemical barrier to hybridisation, providing an opportunity to characterise the nature and evolution of a putative species recognition signal. PMID:28337988

Meiotic synapsis of homogeneously staining regions (HSRs) in chromosome 1 of Mus musculus.

Science.gov (United States)

Winking, H; Reuter, C; Traut, W

1993-05-01

About 50 copies of a long-range repeat DNA family with a repeat size of roughly 100 kb and with sequence homology to mRNAs are clustered in the G-light band D of chromosome 1 of the house mouse, Mus musculus. We studied amplified versions of the cluster which are found in many wild populations of M. musculus. They are cytogenetically conspicuous as one or two C-band positive homogeneously staining regions (single- and double band HSRs) which increase the mitotic length of chromosome 1. The double band HSR was phylogenetically derived from a single band HSR by a paracentric inversion. In homozygous condition, such HSRs contribute, albeit not as much as expected from their mitotic length, to the synaptonemal complex (SC) length of chromosome 1. In HSR heterozygous animals an elongation of the SCs was not noticeable. In single band HSR heterozygous males, synapsis proceeds regularly and continuously from the distal telomere towards the centromeric end without forming buckles. Thus, the single band HSR has no adverse effect on pairing. The same straight pairing behaviour was found in the majority of double band HSR heterozygous spermatocytes. This shows that extensive nonhomologous pairing can take place in the earliest phase of synapsis. Synapsis was discontinuous, leaving the central part of the bivalent 1 asynapsed, in only 14.3% of double band HSR heterozygous cells. In such cells the chromosome 1 SC is completed at a later stage of meiosis. The delay is presumably an effect of the inversion that includes one HSR band and the segment between the two HSR bands.

Peroral Echinococcus multilocularis egg inoculation in Myodes glareolus, Mesocricetus auratus and Mus musculus (CD-1 IGS and C57BL/6j)

DEFF Research Database (Denmark)

Woolsey, Ian David; Jensen, Per Moestrup; Deplazes, Peter

2016-01-01

Echinococcus multilocularis transmission predominantly occurs in Europe between the red fox (Vulpes vulpes) and various species of rodent intermediate hosts. We infected 3 species of rodent, Myodes glareolus (n = 47), Mesocricetus auratus (n = 11) and outbred Mus musculus (CD-1 IGS) (n = 9...

The Southeastern Asian house mouse (Mus musculus castaneus Linn.) as a new passenger host for Cryptococcus neoformans var. grubii molecular type VNI.

Science.gov (United States)

Singh, Karuna; Rani, Jyoti; Neelabh; Rai, Govind Kumar; Singh, Major

2017-11-01

We describe Mus musculus castaneus as a new mammalian host for Cryptococcus neoformans var. grubii (VNI). Eighteen apparently healthy adults and pups of the rodent were collected from human dwellings in Varanasi, a city of India. Both clinical and behavioral examinations of the rodents did not reveal any sign of the disease. Among visceral organs, histological examination of only liver exhibited the presence of single celled, encapsulated, Southgate's mucicarmine positive fungal structures consistent with C. neoformans. Nevertheless, culture of tissue homogenates of brain, lungs, liver, and kidneys yielded white colonies on Sabouraud's dextrose agar and brown mucoid colonies of C. neoformans on Staib's and Tobacco agar media. The pathogen was isolated from habitat soil as well as fresh faeces of the animals. All isolates were urease positive, nitrate and canavanine-glycine bromothymol blue negative, exhibited phenoloxidase activity and grew at 37°C. The isolates were identified as C. neoformans var. grubii with ITS primers and unique marker (GACA)4. The pathogen when inoculated in immunosuppressed mice showed low pathogenicity. To our knowledge, we for the first time report case cluster of Mus musculus castaneus as new passenger host for C. neoformans var. grubii (VNI). © The Author 2017. Published by Oxford University Press on behalf of The International Society for Human and Animal Mycology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Mitochondrial DNA in the hybrid zone between Mus musculus musculus and Mus musculus domesticus: a comparison of two transects

Czech Academy of Sciences Publication Activity Database

Božíková, Eva; Munclinger, P.; Teeter, K. C.; Tucker, P. K.; Macholán, Miloš; Piálek, Jaroslav

2005-01-01

Roč. 84, č. 3 (2005), s. 363-378 ISSN 0024-4066. [The genus Mus as a model for evolutionary studies - a symposium in honour of Louis Thaler. Brno, 28.07.2003-30.07.2003] R&D Projects: GA ČR GA206/03/0205; GA ČR GA206/01/0989 Institutional research plan: CEZ:AV0Z6093917 Keywords : allozyme * gene flow * house mouse Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.261, year: 2005

Hubungan Hiperglikemia dengan Prothrombin Time pada Mencit (Mus musculus yang Diinduksi Aloksan

Directory of Open Access Journals (Sweden)

Muhammad Ibnu Malik

2015-01-01

. Endothelial disfungtion can be detected by activated partial thromboplastin time (APTT and prothrombin time (PT. The objective of this studi was to determine the correlation between hyperglycemia and prothrombin time in mice (Mus musculus induced with aloxan. The design of this research was a post test only control group design conducted in October 2013 until February 2014 in Central Laboratory RS Dr. M. Djamil Padang. The subject were white mice (Mus musculus who have met the inclusion and exclusion criteria. The subject were divided as hyperglycemia group (induced with aloxan and control group. After seven days of adaptation, the aloxan was injected and measurenment of blood glucose and body weight had been done, one time in every four days. Then in day 30th the termination of mice had been done to meassure the prothrombin time. The result showed the prothrombin time between group was shortened with the average prothrombin time of the control group was 7,96 second and the hiperglicemia group was 8,12 second. The result showing no correlation between hyperglycemia and prothrombin time with the degree of signification is (p 0,7 (p > 0,05.Keywords: hyperglycemia, diabetes mellitus, prothrombin time,

Repeat associated mechanisms of genome evolution and function revealed by the Mus caroli and Mus pahari genomes

Science.gov (United States)

Thybert, David; Roller, Maša; Navarro, Fábio C.P.; Fiddes, Ian; Streeter, Ian; Feig, Christine; Martin-Galvez, David; Kolmogorov, Mikhail; Janoušek, Václav; Akanni, Wasiu; Aken, Bronwen; Aldridge, Sarah; Chakrapani, Varshith; Chow, William; Clarke, Laura; Cummins, Carla; Doran, Anthony; Dunn, Matthew; Goodstadt, Leo; Howe, Kerstin; Howell, Matthew; Josselin, Ambre-Aurore; Karn, Robert C.; Laukaitis, Christina M.; Jingtao, Lilue; Martin, Fergal; Muffato, Matthieu; Nachtweide, Stefanie; Quail, Michael A.; Sisu, Cristina; Stanke, Mario; Stefflova, Klara; Van Oosterhout, Cock; Veyrunes, Frederic; Ward, Ben; Yang, Fengtang; Yazdanifar, Golbahar; Zadissa, Amonida; Adams, David J.; Brazma, Alvis; Gerstein, Mark; Paten, Benedict; Pham, Son; Keane, Thomas M.; Odom, Duncan T.; Flicek, Paul

2018-01-01

Understanding the mechanisms driving lineage-specific evolution in both primates and rodents has been hindered by the lack of sister clades with a similar phylogenetic structure having high-quality genome assemblies. Here, we have created chromosome-level assemblies of the Mus caroli and Mus pahari genomes. Together with the Mus musculus and Rattus norvegicus genomes, this set of rodent genomes is similar in divergence times to the Hominidae (human-chimpanzee-gorilla-orangutan). By comparing the evolutionary dynamics between the Muridae and Hominidae, we identified punctate events of chromosome reshuffling that shaped the ancestral karyotype of Mus musculus and Mus caroli between 3 and 6 million yr ago, but that are absent in the Hominidae. Hominidae show between four- and sevenfold lower rates of nucleotide change and feature turnover in both neutral and functional sequences, suggesting an underlying coherence to the Muridae acceleration. Our system of matched, high-quality genome assemblies revealed how specific classes of repeats can play lineage-specific roles in related species. Recent LINE activity has remodeled protein-coding loci to a greater extent across the Muridae than the Hominidae, with functional consequences at the species level such as reproductive isolation. Furthermore, we charted a Muridae-specific retrotransposon expansion at unprecedented resolution, revealing how a single nucleotide mutation transformed a specific SINE element into an active CTCF binding site carrier specifically in Mus caroli, which resulted in thousands of novel, species-specific CTCF binding sites. Our results show that the comparison of matched phylogenetic sets of genomes will be an increasingly powerful strategy for understanding mammalian biology. PMID:29563166

Toxicological Evaluation of Essential Oil From the Leaves of Croton argyrophyllus (Euphorbiaceae) on Aedes aegypti (Diptera: Culicidae) and Mus musculus (Rodentia: Muridae).

Science.gov (United States)

Cruz, R C D; Silva, S L C E; Souza, I A; Gualberto, S A; Carvalho, K S; Santos, F R; Carvalho, M G

2017-07-01

Plant-derived essential oils can be used as insecticides for vector control. However, to establish their safety, it is necessary to perform toxicological studies. Herein, we evaluated the chemical composition and insecticidal activity of the essential oil from the leaves of Croton argyrophyllus on the third- and fourth-instar larvae and adult Aedes aegypti (L., 1762). We also evaluated the acute toxicity of the essential oil in adult female Mus musculus. The lethal concentration 50 (LC50) and 90 (LC90) of C. argyrophyllus essential oil on larvae of Ae. aegypti were 0.31 and 0.70 mg ml-1, respectively, and 5.92 and 8.94 mg ml-1, respectively, on Ae. aegypti adults. The major components of the essential oil were spathulenol (22.80%), (E)-caryophyllene (15.41%), α-pinene (14.07%), and bicyclogermacrene (10.43%). It also displayed acute toxicity in adults of Mus musculus; the intraperitoneal and oral lethal dose 50 (LD50) were 2,000 mg kg-1 and 2,500 mg kg-1, respectively. The results showed that the essential oil from C. argyrophyllus leaves has insecticidal activity on Ae. aegypti larvae and adults at an average lethal concentration below the median lethal dose needed to cause acute toxicity in the common mouse. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

X-ray structure of a soluble Rieske-type ferredoxin from Mus musculus

International Nuclear Information System (INIS)

Levin, Elena J.; Elsen, Nathaniel L.; Seder, Kory D.; McCoy, Jason G.; Fox, Brian G.; Phillips Jr, George N.

2008-01-01

The X-ray crystal structure of a soluble Rieske ferredoxin from M. musculus was solved at 2.07 Å resolution, revealing an iron–sulfur cluster-binding domain with similar architecture to the Rieske-type domains of bacterial aromatic dioxygenases. The ferredoxin was also shown to be capable of accepting electrons from both eukaryotic and prokaryotic oxidoreductases. The 2.07 Å resolution X-ray crystal structure of a soluble Rieske-type ferredoxin from Mus musculus encoded by the gene Mm.266515 is reported. Although they are present as covalent domains in eukaryotic membrane oxidase complexes, soluble Rieske-type ferredoxins have not previously been observed in eukaryotes. The overall structure of the mouse Rieske-type ferredoxin is typical of this class of iron–sulfur proteins and consists of a larger partial β-barrel domain and a smaller domain containing Cys57, His59, Cys80 and His83 that binds the [2Fe–2S] cluster. The S atoms of the cluster are hydrogen-bonded by six backbone amide N atoms in a pattern typical of membrane-bound high-potential eukaryotic respiratory Rieske ferredoxins. However, phylogenetic analysis suggested that the mouse Rieske-type ferredoxin was more closely related to bacterial Rieske-type ferredoxins. Correspondingly, the structure revealed an extended loop most similar to that seen in Rieske-type ferredoxin subunits of bacterial aromatic dioxygenases, including the positioning of an aromatic side chain (Tyr85) between this loop and the [2Fe–2S] cluster. The mouse Rieske-type ferredoxin was shown to be capable of accepting electrons from both eukaryotic and prokaryotic oxidoreductases, although it was unable to serve as an electron donor for a bacterial monooxygenase complex. The human homolog of mouse Rieske-type ferredoxin was also cloned and purified. It behaved identically to mouse Rieske-type ferredoxin in all biochemical characterizations but did not crystallize. Based on its high sequence identity, the structure of the

Sexual selection and the rodent baculum: an intraspecific study in the house mouse (Mus musculus domesticus).

Science.gov (United States)

Ramm, Steven A; Khoo, Lin; Stockley, Paula

2010-01-01

The rapid divergence of genitalia is a pervasive trend in animal evolution, thought to be due to the action of sexual selection. To test predictions from the sexual selection hypothesis, we here report data on the allometry, variation, plasticity and condition dependence of baculum morphology in the house mouse (Mus musculus domesticus). We find that that baculum size: (a) exhibits no consistent pattern of allometric scaling (baculum size being in most cases unrelated to body size), (b) exhibits low to moderate levels of phenotypic variation, (c) does not exhibit phenotypic plasticity in response to differences in perceived levels of sexual competition and (d) exhibits limited evidence of condition dependence. These patterns provide only limited evidence in support of the sexual selection hypothesis, and no consistent support for any particular sexual selection mechanism; however, more direct measures of how genital morphology influences male fertilization success are required.

Repeat associated mechanisms of genome evolution and function revealed by the Mus caroli and Mus pahari genomes.

Science.gov (United States)

Thybert, David; Roller, Maša; Navarro, Fábio C P; Fiddes, Ian; Streeter, Ian; Feig, Christine; Martin-Galvez, David; Kolmogorov, Mikhail; Janoušek, Václav; Akanni, Wasiu; Aken, Bronwen; Aldridge, Sarah; Chakrapani, Varshith; Chow, William; Clarke, Laura; Cummins, Carla; Doran, Anthony; Dunn, Matthew; Goodstadt, Leo; Howe, Kerstin; Howell, Matthew; Josselin, Ambre-Aurore; Karn, Robert C; Laukaitis, Christina M; Jingtao, Lilue; Martin, Fergal; Muffato, Matthieu; Nachtweide, Stefanie; Quail, Michael A; Sisu, Cristina; Stanke, Mario; Stefflova, Klara; Van Oosterhout, Cock; Veyrunes, Frederic; Ward, Ben; Yang, Fengtang; Yazdanifar, Golbahar; Zadissa, Amonida; Adams, David J; Brazma, Alvis; Gerstein, Mark; Paten, Benedict; Pham, Son; Keane, Thomas M; Odom, Duncan T; Flicek, Paul

2018-04-01

Understanding the mechanisms driving lineage-specific evolution in both primates and rodents has been hindered by the lack of sister clades with a similar phylogenetic structure having high-quality genome assemblies. Here, we have created chromosome-level assemblies of the Mus caroli and Mus pahari genomes. Together with the Mus musculus and Rattus norvegicus genomes, this set of rodent genomes is similar in divergence times to the Hominidae (human-chimpanzee-gorilla-orangutan). By comparing the evolutionary dynamics between the Muridae and Hominidae, we identified punctate events of chromosome reshuffling that shaped the ancestral karyotype of Mus musculus and Mus caroli between 3 and 6 million yr ago, but that are absent in the Hominidae. Hominidae show between four- and sevenfold lower rates of nucleotide change and feature turnover in both neutral and functional sequences, suggesting an underlying coherence to the Muridae acceleration. Our system of matched, high-quality genome assemblies revealed how specific classes of repeats can play lineage-specific roles in related species. Recent LINE activity has remodeled protein-coding loci to a greater extent across the Muridae than the Hominidae, with functional consequences at the species level such as reproductive isolation. Furthermore, we charted a Muridae-specific retrotransposon expansion at unprecedented resolution, revealing how a single nucleotide mutation transformed a specific SINE element into an active CTCF binding site carrier specifically in Mus caroli , which resulted in thousands of novel, species-specific CTCF binding sites. Our results show that the comparison of matched phylogenetic sets of genomes will be an increasingly powerful strategy for understanding mammalian biology. © 2018 Thybert et al.; Published by Cold Spring Harbor Laboratory Press.

STRUKTUR HISTOLOGI HATI MENCIT(Mus musculus L. SETELAH PEMBERIAN EKSTRAK DAUN EKOR NAGA (Rhapidhophora pinnata Schott

Directory of Open Access Journals (Sweden)

Ni Komang Tia Pramesti

2017-09-01

Full Text Available ABSTRACT Rhapidhophora pinnata, Schott is a traditional medical plant that has been use remedy for treatment of hypertension, stroke. Aims of  this research is to determine the effect of Rhapidhophora pinnata Schott leaf extract toward  mouse (Mus musculus L liverhistological structure. This research used completely randomized  design with 28 female mice that were divide into 4 groups of  P0 (control received 0,9% NaCl, group P1, P2, and P3 received 50, 100 and 150 mg/kg bw respectively by oral administration. The treatment were given daily for 14 days. All of the mice were sacrificed by ether after 15 days. The liver were examined for their histopathological changes, namely fatty degeneration, hydropic degenaration and necrosis. Results were statistically analised by Kruskal-Wallis method. Treatment groups showed no significant differences with regard of liver histopatological changes, however hemorrhage, sinusoid congestion and inflamatory cell infiltration were found in liver.   Keyword : Rhapidhophora pinnata Schott, liver, mice

THE PATTERN OF THE AGGRESSIVE BEHAVIOR IN THE LABORATORY MOUSE (MUS MUSCULUS

Directory of Open Access Journals (Sweden)

Maria BUNEA

2010-01-01

Full Text Available Nature has found solutions for decreasing the aggressive impulse, using various inhibitory mechanisms as means of balancing the forces between two fighting individuals, thus avoiding it to lead to the destruction of their own species. These nature's “ pacifyng” solutions are mostly found in animals which are armed with various potentially lethal “weapons”, while in species that live on large territoires and thus have the possibility to avoid conflict, these mechanisms are poorly developed. The purpose of this research is to study the extent of the inhibitory mechanisms against aggression in the laboratory mouse, species in which these mechanisms of diminishing aggression and of avoiding conflicts don't work the same in artificial conditions, where individuals are forced to live in small areas, and to identify the behavioral chains that form the innate manifestations of the aggressive behavior in Mus musculus sp. The results of this study show that in the circumstance of caged individuals, which are crowded so closely together, the intensity of aggression is increasing. The dominance hierarchy is well established after their first fight, but due to the spatial constraint and the fact that there is no place where to flee, the submissive individual oftenly fights back. In every single interraction the aggressive behavior follows a fixed action pattern.

Chromosomal heterozygosity and fertility in house mice (Mus musculus domesticus) from Northern Italy.

Science.gov (United States)

Hauffe, H C; Searle, J B

1998-11-01

Following the discovery of over 40 Robertsonian (Rb) races of Mus musculus domesticus in Europe and North Africa, the house mouse has been studied extensively as an ideal model to determine the chromosomal changes that may cause or accompany speciation. Current models of chromosomal speciation are based on the assumption that heterozygous individuals have a particularly low fertility, although recent studies indicate otherwise. Despite their importance, fertility estimates for the house mouse are incomplete because traditional measurements, such as anaphase I nondisjunction and germ cell death, are rarely estimated in conjunction with litter size. In an attempt to bridge this gap, we have taken advantage of the house mouse hybrid zone in Upper Valtellina (Lombardy, Italy) in which five Rb races interbreed. We present data on the fertility of naturally occurring ("wild-caught") hybrids and of offspring from laboratory crosses of wild-caught mice ("laboratory-reared"), using various measurements. Wild-caught mice heterozygous for one fusion were more infertile than predicted from past studies, possibly due to genic hybridity; laboratory-reared heterozygotes carrying seven or eight trivalents at meiosis I and heterozygotes carrying one pentavalent also had low fertilities. These low fertilities are especially significant given the probable occurrence of a reinforcement event in Upper Valtellina.

Penelitian Pendahuluan Pengaruh Daun Manggis sebagai Rodentisida Nabati pada Mencit Mus musculus Strain Balepsi

Directory of Open Access Journals (Sweden)

Agus Kardinan

2000-07-01

Full Text Available Research has been conducted at Pest and Disease Laboratory, Research Institute for Spices and Medicinal Crops, Bogor, during 1997-1998. The objective was to evaluate the possibility of Mangosteen (Garcinia mangostana leaves to be used as botanical rodenticide which is tested to reproduction ability of mice Mus musculus. Eight to ten weeks old mice with the average weight of 25 gram were obtained from Research Institute for Livestock, Ciawi. Research was arranged at randomized block design, 8 treatments and 4 replications. Data was analyzed by determining the average value and their standard deviation values. Observations were done to the weight of testis, weight of embryo, number of embryo, volume of extracts drank by mice and mice behavior during experiment. Result revealed that there was no indication that the leaves extract affected the weight of testis, but it affected the number and weight of embryo. There was indication that mangosteen leaves acted as antifertility on mice. Giving leaves extract increased the total volume of extract drink. There was no abnormality at the activity of mice during experiment, included sex activity, poisonous symptoms and others.

PRDM9 drives evolutionary erosion of hotspots in Mus musculus through haplotype-specific initiation of meiotic recombination.

Science.gov (United States)

Baker, Christopher L; Kajita, Shimpei; Walker, Michael; Saxl, Ruth L; Raghupathy, Narayanan; Choi, Kwangbom; Petkov, Petko M; Paigen, Kenneth

2015-01-01

Meiotic recombination generates new genetic variation and assures the proper segregation of chromosomes in gametes. PRDM9, a zinc finger protein with histone methyltransferase activity, initiates meiotic recombination by binding DNA at recombination hotspots and directing the position of DNA double-strand breaks (DSB). The DSB repair mechanism suggests that hotspots should eventually self-destruct, yet genome-wide recombination levels remain constant, a conundrum known as the hotspot paradox. To test if PRDM9 drives this evolutionary erosion, we measured activity of the Prdm9Cst allele in two Mus musculus subspecies, M.m. castaneus, in which Prdm9Cst arose, and M.m. domesticus, into which Prdm9Cst was introduced experimentally. Comparing these two strains, we find that haplotype differences at hotspots lead to qualitative and quantitative changes in PRDM9 binding and activity. Using Mus spretus as an outlier, we found most variants affecting PRDM9Cst binding arose and were fixed in M.m. castaneus, suppressing hotspot activity. Furthermore, M.m. castaneus×M.m. domesticus F1 hybrids exhibit novel hotspots, with large haplotype biases in both PRDM9 binding and chromatin modification. These novel hotspots represent sites of historic evolutionary erosion that become activated in hybrids due to crosstalk between one parent's Prdm9 allele and the opposite parent's chromosome. Together these data support a model where haplotype-specific PRDM9 binding directs biased gene conversion at hotspots, ultimately leading to hotspot erosion.

No evidence for punishment in communally nursing female house mice (Mus musculus domesticus).

Science.gov (United States)

Ferrari, Manuela; König, Barbara

2017-01-01

Punishment is claimed as an important mechanism to stabilise costly cooperation in humans, but its importance in social animals has been questioned recently due to both conceptual considerations and a lack of empirical evidence (only few published studies). We empirically tested whether there is evidence for punishment in communally nursing house mice (Mus musculus domesticus, direct descendants of "wild" animals). Communally breeding females pool their litters and raise all offspring together, indiscriminately caring for own and other offspring. Such a situation resembles a public good and provides scope for exploitation if females vary in their relative contributions to the joint nest (offspring number). We allowed two females to communally breed and conducted removal experiments both in the presence and absence of pups. We aimed to test whether reduced investment by one of the females (induced through separation from the partner and their combined offspring for 4 or 12 hours) leads to increased aggression by the other female after the reunion. We found no evidence for punishment, on the contrary, females increased socio-positive behaviours. The costs of losing a partner in a communally breeding species might be too high and hinder the evolution of punishment. Our findings add to a growing list of examples questioning the role of punishment in cooperating non-human animals and emphasise the importance of empirical testing of its assumptions and predictions.

Embryo quality of mice (“Mus musculus” fed royal jelly Qualidade embrionária de camundongos ("Mus musculus" suplementados com geléia real

Directory of Open Access Journals (Sweden)

Bruno Edésio dos Santos Melo

2009-03-01

Full Text Available The study was carried out to verify the effect of feeding royal jelly associated to follicle growth induction on number and quality of mice (Mus musculus embryos. Sixty Swiss females ageing from eight to ten weeks were distributed into three treatments: the first one, composed by animals fed 0.2 mL of physiological solution intraperitoneal (control group, n=20; the second and third ones, composed by females fed 0.5 and 1.0 mg of royal jelly diluted in 0.2 mL of physiological solution (n=20, respectively. Royal jelly was administered during 15 days, followed by the follicular growth induction process. Embryos were collected 68 hours after mating, by uterine flushing. No treatment effects on the number of females that answered to superovulatory process, the number of total recovery structures, the number of viable and non viable structures and the morphological quality of viable embryos (P>0.05 were observed. Therefore, royal jelly doses used were not efficient to increase the number of embryos and to improve the quality recovery from superovulated mice.Objetivou-se verificar a influência da geléia real, associada ao tratamento de indução de crescimento folicular, no número e na qualidade de embriões de camundongos (Mus musculus. Foram utilizadas 60 fêmeas da linhagem Suíço albino com idade entre oito e dez semanas, distribuídas em três tratamentos: o primeiro, composto por animais que receberam 0,2 mL de solução fisiológica, via intraperitonial (grupo controle, n=20; o segundo e terceiro, compostos de fêmeas que receberam 0,5 e 1 mg de geléia real diluídos em 0,2 mL de solução fisiológica via intraperitonial (n=20, respectivamente. Foi administrada geléia real por um período de 15 dias, segundo o processo de indução do crescimento folicular. As coletas dos embriões ocorreram 68 horas após a cobertura, utilizando-se o método da lavagem uterina. Não houve diferença no número de fêmeas que responderam ao tratamento

The role of salivary androgen-binding protein in reproductive isolation between two subspecies of house mouse: Mus musculus musculus and Mus musculus domesticus

Czech Academy of Sciences Publication Activity Database

Bímová, Barbora; Karn, R. C.; Piálek, Jaroslav

2005-01-01

Roč. 84, č. 3 (2005), s. 349-361 ISSN 0024-4066. [The genus Mus as a model for evolutionary studies - a symposium in honour of Louis Thaler. Brno, 28.07.2003-30.07.2003] R&D Projects: GA AV ČR IAA6093201; GA AV ČR IAA6045902 Grant - others:National Research Council(US) COBASE Institutional research plan: CEZ:AV0Z6093917 Keywords : assortative mating * hybrid zone * sexual selection Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.261, year: 2005

Classical Mus musculus Igκ enhancers support transcription but not high level somatic hypermutation from a V-lambda promoter in chicken DT40 cells.

Directory of Open Access Journals (Sweden)

Naga Rama Kothapalli

2011-04-01

Full Text Available Somatic hypermutation (SHM of immunoglobulin genes is initiated by activation-induced cytidine deaminase (AID in activated B cells. This process is strictly dependent on transcription. Hence, cis-acting transcriptional control elements have been proposed to target SHM to immunoglobulin loci. The Mus musculus Igκ locus is regulated by the intronic enhancer (iE/MAR and the 3' enhancer (3'E, and multiple studies using transgenic and knock-out approaches in mice and cell lines have reported somewhat contradictory results about the function of these enhancers in AID-mediated sequence diversification. Here we show that the M. musculus iE/MAR and 3'E elements are active solely as transcriptional enhancer when placed in the context of the IGL locus in Gallus gallus DT40 cells, but they are very inefficient in targeting AID-mediated mutation events to this locus. This suggests that either key components of the cis-regulatory targeting elements reside outside the murine Igκ transcriptional enhancer sequences, or that the targeting of AID activity to Ig loci occurs by largely species-specific mechanisms.

Arabidopsis CDS blastp result: AK061637 [KOME

Lifescience Database Archive (English)

Full Text Available AK061637 001-036-A11 At1g77130.1 glycogenin glucosyltransferase (glycogenin)-relate...d contains similarity to glycogenin-1 from Mus musculus [SP|Q9R062], Rattus norvegicus [SP|O08730], Homo sapiens [SP|P46976] 4e-84 ...

Laju peningkatan konsentrasi timbal Pb dalam darah hewan uji mencit Mus musculus di bengkel otomotif

Directory of Open Access Journals (Sweden)

Mohammad Razif Sukatma

2012-02-01

Full Text Available This research was conducted in automotive workshop of VEDC Malang and the samples were taken at the automotive machineand automotive electric workshops. The parameters which examined were the Pb concentration in the mouse blood (Mus musculus in2 and 3 months years old. The measurement was run for 5 times every 10 days, and the result was mean value of the increasing rate ofPb concentration in the mouse blood. The aim of this research was to determine the increasing rate of Pb concentration in the mouseblood which has the relation with different working area, different age, and also duration of exposure. Based on the data of laboratorytest, research continued by T-test analysis, Simple regression test, and correlation, and also General Linear Model. By doing statisticanalysis with the different working area, duration of explanation, and different age.Result of this research showed that there were the differences of rapid increasing of Pb concentration in both workshop. Generallythe age which influence so much for that (in the mouse body and have the relation with the body stamina. If the mouse body absorbamount of Pb constantly, so the Pb concentration in it will increase more and more and it cause the decreasing of the body height.

Effect of Physalis peruviana "tomatillo" fruit extract in Mus musculus var. swis with induced hyperlipidemi.

Directory of Open Access Journals (Sweden)

Julio Campos Florián

2011-06-01

Full Text Available The objective of this research was to determine the hypolipidemic activity of the fruit of Physalis peruviana "tomatillo" in a model of acute hyperlipidemia induced by triton. Mus musculus var. swis males as experimental animals. We worked with four groups of mice, the white group received distilled water orally and saline intraperitoneally, the control group received distilled water orally and intraperitoneally triton, the problem group 1 received orally 0.05g/100g Physalis peruviana extract intraperitoneally and triton and the problem group 2 received orally 0.2g/100g extract of Physalis peruviana and triton intraperitoneally. After 24 hours of administering the treatments were performed measurements of serum cholesterol and triglycerides. Mean levels of cholesterol (mg/dL were: 58.87 ± 11.54 (white, 121.71 ± 15.00 (control, 58.08 ± 9.21 (Problem 1 and 66 78 ± 16.77 (Problem 2. Average levels of triglycerides (g /L were: 0.48 ± 0.07 (white, 1.84 ± 0.18 (control, 0.34 ± 0.10 (Problem 1 and 0.94 ± 0.25 (Problem 2. We found significant reductions (p <0.000 concentrations of both cholesterol and triglycerides in relation to those obtained in the group treated only with Triton.

AcEST: DK950437 [AcEST

Lifescience Database Archive (English)

Full Text Available n Hook homolog 1 OS=Mus musculus GN=... 45 4e-04 sp|Q9UJC3|HOOK1_HUMAN Protein Hook homolog 1 OS=Homo sapien... 483 IVELESQVDSLSARVAELNTERMSSQQ 563 I EL+ Q++ ++ EL TE+ S++ Sbjct: 489 IEELQEQLEQKHRKMNELETEQRLSKE 515 >sp|Q9Y2K

QuartetS-DB: A Large-Scale Orthology Database for Prokaryotes and Eukaryotes Inferred by Evolutionary Evidence

Science.gov (United States)

2012-01-01

particular functions and identify species that contain these proteins. For example, if users select two species, Homo sapiens and Mus musculus, and...Kerr AR, McCormack TJ, Riley M: Evolution by leaps: gene duplication in bacteria. Biol Direct 2009, 4:46. 12. Remm M, Storm CE, Sonnhammer EL

Genome patterns of selection and introgression of haplotypes in natural populations of the house mouse (Mus musculus.

Directory of Open Access Journals (Sweden)

Fabian Staubach

Full Text Available General parameters of selection, such as the frequency and strength of positive selection in natural populations or the role of introgression, are still insufficiently understood. The house mouse (Mus musculus is a particularly well-suited model system to approach such questions, since it has a defined history of splits into subspecies and populations and since extensive genome information is available. We have used high-density single-nucleotide polymorphism (SNP typing arrays to assess genomic patterns of positive selection and introgression of alleles in two natural populations of each of the subspecies M. m. domesticus and M. m. musculus. Applying different statistical procedures, we find a large number of regions subject to apparent selective sweeps, indicating frequent positive selection on rare alleles or novel mutations. Genes in the regions include well-studied imprinted loci (e.g. Plagl1/Zac1, homologues of human genes involved in adaptations (e.g. alpha-amylase genes or in genetic diseases (e.g. Huntingtin and Parkin. Haplotype matching between the two subspecies reveals a large number of haplotypes that show patterns of introgression from specific populations of the respective other subspecies, with at least 10% of the genome being affected by partial or full introgression. Using neutral simulations for comparison, we find that the size and the fraction of introgressed haplotypes are not compatible with a pure migration or incomplete lineage sorting model. Hence, it appears that introgressed haplotypes can rise in frequency due to positive selection and thus can contribute to the adaptive genomic landscape of natural populations. Our data support the notion that natural genomes are subject to complex adaptive processes, including the introgression of haplotypes from other differentiated populations or species at a larger scale than previously assumed for animals. This implies that some of the admixture found in inbred strains of mice

NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1| unnamed protein product [Mus musculus] gb|EAW65549.1| non imprinted in Prader-Willi/Angelman syndrome 1, ...isoform CRA_a [Homo sapiens] gb|EAW65551.1| non imprinted in Prader-Willi/Angelman syndrome 1, isoform CRA_a... [Homo sapiens] gb|ABM82178.1| non imprinted in Prader-Willi/Angelman syndrome 1 ...[synthetic construct] gb|ABM85364.1| non imprinted in Prader-Willi/Angelman syndrome 1 [synthetic construct] CAD97953.1 1e-113 81% ...

Micro-evolutionary divergence patterns of mandible shapes in wild house mouse (Mus musculus populations

Directory of Open Access Journals (Sweden)

Tautz Diethard

2011-10-01

Full Text Available Abstract Background Insights into the micro-evolutionary patterns of morphological traits require an assessment of the natural variation of the trait within and between populations and closely related species. The mouse mandible is a particularly suitable morphological trait for such an analysis, since it has long been used as a model to study the quantitative genetics of shape. In addition, many distinct populations, sub-species and closely related species are known for the house mouse. However, morphological comparisons among wild caught animals require an assessment in how far environmental and technical factors could interfere with the shape change measurements. Results Using geometric morphometrics, we have surveyed mandible shapes in 15 natural populations of the genus Mus, with a focus on the subspecies Mus musculus domesticus. In parallel we have carefully assessed possibly confounding technical and biological factors. We find that there are distinct differences on average between populations, subspecies and species, but these differences are smaller than differences between individuals within populations. Populations from summer-dry regions, although more ancestral, are less distinct from each other than are populations from the more recently colonized northern areas. Populations with especially distinct shapes occur in an area of sympatry of M. m. domesticus and M. spretus and on recently colonized sub-antarctic islands. We have also studied a number of inbred strains to assess in how far their mandible shapes resemble those from the wild. We find that they fall indeed into the shape space of natural variation between individuals in populations. Conclusions Although mandible shapes in natural populations can be influenced by environmental variables, these influences are insufficient to explain the average extent of shape differences between populations, such that evolutionary processes must be invoked to explain this level of diversity

Early gene expression divergence between allopatric populations of the house mouse (Mus musculus domesticus).

Science.gov (United States)

Bryk, Jarosław; Somel, Mehmet; Lorenc, Anna; Teschke, Meike

2013-03-01

Divergence of gene expression is known to contribute to the differentiation and separation of populations and species, although the dynamics of this process in early stages of population divergence remains unclear. We analyzed gene expression differences in three organs (brain, liver, and testis) between two natural populations of Mus musculus domesticus that have been separated for at most 3000 years. We used two different microarray platforms to corroborate the results at a large scale and identified hundreds of genes with significant expression differences between the populations. We find that although the three tissues have similar number of differentially expressed genes, brain and liver have more tissue-specific genes than testis. Most genes show changes in a single tissue only, even when expressed in all tissues, supporting the notion that tissue-specific enhancers act as separable targets of evolution. In terms of functional categories, in brain and to a smaller extent in liver, we find transcription factors and their targets to be particularly variable between populations, similar to previous findings in primates. Testis, however, has a different set of differently expressed genes, both with respect to functional categories and overall correlation with the other tissues, the latter indicating that gene expression divergence of potential importance might be present in other datasets where no differences in fraction of differentially expressed genes were reported. Our results show that a significant amount of gene expression divergence quickly accumulates between allopatric populations.

Dicty_cDB: Contig-U11532-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available cology Modeling. 62 6e-05 1 ( AC004912 ) Homo sapiens PAC clone RP5-871B15 from 7, ...n chromo... 62 6e-05 1 ( AC122028 ) Mus musculus BAC clone RP24-394D4 from 2, complet... 62 6e-05 1 ( DD267290 ) Molecular Hepatotoxi

FRAKSI ETANOL 96% BIJI KORO BENGUK (Mucuna pruriens L. SEBAGAI PENINGKAT KUALITAS SPERMATOZOA MENCIT (Mus musculus

Directory of Open Access Journals (Sweden)

Sri Winarni

2012-11-01

Full Text Available Background: The examination of sperm quality is the main priority for infertility diagnosis. Based on previous study with mice, active ingredient of Mucuna pruriens L. or koro benguk (Papilionaceae, the L-dopa, may affect the quality of spermatozoa.Objective: Research was to study the effect of 96% ethanol fraction Mucuna pruriens seed on spermatozoaquality of mice exposed to 2-Methoxy ethanol. L-dopa in 96% ethanol fraction of M. pruriens seed was 14.7%.Methode: This was an experimental study using complete randomized design. Subjects were BALB/C mice (Mus musculus. Five groups served as control, 3 groups received subcutaneos injection of 2-ME as muchas 100 mg/kg.bw/day for 12 days, followed with 96% ethanol fraction Mucuna pruriens seed starting from14 mg/kg.bw/day, 28 mg/kg.bw/day, and 56 mg/kg.bw/day for 51 days.Result: The 96% ethanol fraction of Mucuna pruriens seeds are significant increase motility (p<0,01 andthe percentage of normal spermatozoa morphology (p= 0,042.Conclusion: 96% ethanol fraction of Mucuna pruriens seeds are able to increase motility and the percentage of normal spermatozoa morphology in mice exposed to 2-ME. Keywords: Mucuna pruriens L., L-dopa, mouse spermatozoa

Spermatogenic structure and fertility of Mus musculus after exposure of mangosteen (Garcinia mangostana L) pericarp extract

Science.gov (United States)

Hayati, Alfiah; Agustin, Melia Eka; Rokhimaningrum, Farida Ayu; Adro'i, Hasan; Darmanto, Win

2016-03-01

This study aimed to determine the effect of mangosteen (Garcinia mangostana L.) pericarp extract on spermatogenics number, seminiferous tubules sized, profile protein of epididymal and testicular sperm, and fertility of mice (Mus musculus). Fourty two male mice strain BALB/C was divided equally into 7 groups. The control group was given 0.05 ml of 0.05% CMC solution. Three group were given mangosteen pericarp extract at various doses (75, 100 and 150 mg/kg body weight, respectively) for 7 days, while the other three groups were given the same extract dose for 35 days. Parameters evaluated on histological of spermatogonia, spermatocytes, round spermatids, seminiferous tubule diameter, and thickness of germinal epithelium, analysis of testicular and epidydimal protein profile with SDS-Page, and than fertility test on female mice. The results showed that mangosteen pericarp extract at 75 and 100 mg/kg dose for 7 days had no effect on spermatogenics number and seminiferous tubule sizes, but the treatment dose of 150 mg/kg for 7 days and all treatment (doses of 75, 100, and 150 mg/kg) for 35 days led to significant decrease on the number of spermatogenics and seminiferous tubule sizes; effect on protein profiles testicular and epididymal sperm; and lower fertilization.

PENGARUH DOSIS DAN LAMA PERLAKUAN EKSTRAK DAUN KALIANDRA MERAH (Calliandra calothyrsus Meissn. TERHADAP STRUKTUR HISTOLOGI GINJAL MENCIT (Mus musculus L.

Directory of Open Access Journals (Sweden)

Nur Assiam

2014-09-01

Full Text Available This research aims to determine the effect of red calliandra (Calliandra calothyrsusMeissn. leaf extrac on the histological structure of the kidney of mice (Mus musculus L..Treatment was administered orally with varying doses. This research used a CompletelyRandomized Design in factorial pattern of two factors, doses (0 or control, 2, 4, and 6 mg/kgBW and length of treatment (7, 14, and 21 days, so there are 12 combination groups with 3replications of each. Organ was collected on days 8, 15, and 22 to observe histologicalstructure of the kidney. Renal histological observation of edema, Bowman’s spaceconstriction, and protein deposition, showed no correlation between both factors, but a veryreal correlation occurs in the damage of fatty degeneration, hemorrhage, and nucleuspyknotic. Histological observation of glomerular congestion and infiltration of inflammatorycells did not show any correlation between dose and duration of treatment.Keywords: red calliandra, histopathology of kidney, male mice

Pengaruh Lendir Bekicot (Achatina fulica terhadap Jumlah Sel Fibroblas pada Penyembuhan Luka Sayat Studi Eksperimental pada Kulit Mencit (Mus musculus

Directory of Open Access Journals (Sweden)

Perez Wahyu Purnasari

2012-12-01

Design and methods: The study is an experimental research with post test only randomized control group design. The subjects were 18 Mus musculus strain mice that were divided into 3 groups. 1st group as a control group of untreated, 2nd group was given povidone iodine 10%, and 3rd group was given land snails’ mucus during 5th days. On the 6th day the mices were killed for histological study. Results: The data showed that average number of fibroblast in 1st group is 93,85; 2nd group is 126,37; and 3rd is group 217,5. The results of one way anova statistical test showed significant difference among the three groups p = 0,000. The results of post hoc test showed significant difference in all groups (p < 0,05. Conclusion: The mucus of land snail is influence the number of fibroblast in healing cuts (Sains Medika, 4(2:195-203.

Mitochondrial Genetic Diversity and Phylogeography of Mus musculus castaneus in Northern Punjab, Pakistan.

Science.gov (United States)

Bibi, Shahnaz; Nadeem, Muhammad Sajid; Wiewel, Andrew Stephen; Beg, Mirza Azhar; Hameed, Khalid; Jabeen, Musarrat; Raja, Ghazala Kaukab

2017-12-01

Regions of Iran, Afghanistan, Pakistan and northwestern India have been proposed as the place of origin of Mus musculus castaneus. But despite the fact that Pakistan encompasses an important part of its range, M. m. castaneus populations in Pakistan have not been the subject of intensive genetic and biogeographic studies, except for a very small number of samples included in past studies. We studied genetic variation in M. m. castaneus (CAS) from northern Punjab Province, Pakistan, by using cytochrome b (Cytb) analysis in a sample of 98 individuals. Median-joining network revealed four well differentiated CAS sub-lineages coexisting within a small geographical region; these had previously been thought to have largely non-overlapping geographic distributions. Moreover, haplotypes from Pakistan occupied a central position in the network and all identified global haplotypes were also present in Pakistan. All identified CAS sub-lineages proved to be highly diverse on the basis of haplotype and nucleotide diversity indices. Tajima's D test and Fu's Fs tests of neutrality suggest recent population expansions in all sub-lineages. Expansion times were estimated as 21,760-134,930, 10,800-64,400 and 4950-30,665 ybp using substitution rates of 2.5%, 5% and 11%, respectively. Our results support the hypothesis that northern Punjab Province in Pakistan is the most likely source area for M. m. castaneus, and that the CAS sub-lineages in this region have undergone rapid population expansion events at different time periods, which appear to have benefitted from human-mediated transport, although one of them clearly predates the establishment of human settlements in this region.

Efficacy and Palatability of Different Rodenticide Formulations Applied against House Mouse (Mus musculus L. in Plant Storage Facilities

Directory of Open Access Journals (Sweden)

Goran Jokić

2008-01-01

Full Text Available Palatability (daily intake of different rodenticide formulations based on bromadiolone was compared in experiments with house mouse (Mus musculus L. in agricultural storage facilities, and rodent numbers were assessed at the beginning and end of experiment, as well as rodenticide efficacy. The dynamic of bait intake was monitored for ten days in facilities of the Institute of Animal Husbandry in Zemun and the Agricultural Cooperatives at Starčevo and Omoljica. The experiments complied with the relevant standard method of OEPP/EPPO. Agricultural products were stored either as bulk commodities or in sacs laid on pallete racks in the treated facilities. Baits were laid in boxes on mice routes below palletes holding sacs and on places where significant damage had been observed, at 1-3 m spacing and in 10-20 g portions. Mouse abundance was estimated based on the highest and lowest daily intakes of bait by mice over a period of 10 days, which was divided by the mouse daily feed requirement. The presence of house mouse was also monitored over the next 20 days. The efficacy of test products was computed using Abbott’s formula.

Tissue-Specific Contributions of Paternally Expressed Gene 3 in Lactation and Maternal Care of Mus musculus.

Directory of Open Access Journals (Sweden)

Wesley D Frey

Full Text Available Paternally Expressed Gene 3 (Peg3 is an imprinted gene that controls milk letdown and maternal-caring behaviors. In this study, a conditional knockout allele has been developed in Mus musculus to further characterize these known functions of Peg3 in a tissue-specific manner. The mutant line was first crossed with a germline Cre. The progeny of this cross displayed growth retardation phenotypes. This is consistent with those seen in the previous mutant lines of Peg3, confirming the usefulness of the new mutant allele. The mutant line was subsequently crossed individually with MMTV- and Nkx2.1-Cre lines to test Peg3's roles in the mammary gland and hypothalamus, respectively. According to the results, the milk letdown process was impaired in the nursing females with the Peg3 mutation in the mammary gland, but not in the hypothalamus. This suggests that Peg3's roles in the milk letdown process are more critical in the mammary gland than in the hypothalamus. In contrast, one of the maternal-caring behaviors, nest-building, was interrupted in the females with the mutation in both MMTV- and Nkx2.1-driven lines. Overall, this is the first study to introduce a conditional knockout allele of Peg3 and to further dissect its contribution to mammalian reproduction in a tissue-specific manner.

Genomic organization, transcript variants and comparative analysis of the human nucleoporin 155 (NUP155) gene

DEFF Research Database (Denmark)

Zhang, X.; Yang, J.; Yu, J.

2002-01-01

Nucleoporin 155 (Nup155) is a major component of the nuclear pore complex (NPC) involved in cellular nucleo-cytoplasmic transport. We have acquired the complete sequence and interpreted the genomic organization of the Nup155 orthologos from human (Homo sapiens) and pufferfish (Fugu rubripes), which...... complementary to RNAs of the Nup155 orthologs from Fugu and mouse. Comparative analysis of the Nup155 orthologs in many species, including H. sapiens, Mus musculus, Rattus norvegicus, F. rubripes, Arabidopsis thaliana, Drosophila melanogaster, and Saccharomyces cerevisiae, has revealed two paralogs in S...

BIOAKTIFITAS BUNGA SEPATU (Hibiscus rosa-sinensis L. TERHADAP KADAR KOLESTEROL DARAH MENCIT (Mus musculus YANG MENGALAMI HIPERKOLESTEROLEMIA DENGAN DIET TINGGI LEMAK

Directory of Open Access Journals (Sweden)

Rinza Rahmawati Samsudin

2017-12-01

  Tujuan penelitian ini adalah untuk mengetahui pengaruh bioaktifitas ekstrak bunga sepatu (Hibiscus rosa-sinensis l. terhadap  kadar kolesterol darah mencit (Mus musculus yang mengalami hiperkolesterolemia dengan diet tinggi lemak. Penelitian ini merupakan penelitian eksperimental murni, dengan menggunakan rancangan randomized post-test only control group design. Bunga sepatu mengandung pigmen antosianin yang termasuk golongan flavonoid yang berperan sebagai antioksidan. Sebanyak dua puluh delapan mencit dibagi menjadi empat kelompok (K1, K2, K3 dan K4. Kelompok K1 adalah kelompok yang mendapat perlakukan pakan tinggi lemak dan aquadest setelah aklimatasi. Kelompok K2, K3, dan K4 adalah kelompok  terapi yang mendapat perlakukan pakan tinggi lemak, ekstrak bunga septum sebanyak 1 ml dan aquadest setelah aklimatasi. Pemberian pakan tinggi lemak berlangsung selama 28 hari. Selama penelitian berlangsung penimbangan berat badan tikus dilakukan sebanyak lima kali. Hasil penelitian menunjukan bahwa pemberian 1 ml ekstrak bunga sepatu selama dua puluh delapan hari dapat menurunkan kadar kolesterol mencit dimana nilai p<0.05.   Kata kunci: ekstrak bunga sepatu, kadar kolesterol, diet tinggi lemak

Aktivitas Penyembuhan Luka Sediaan Topikal Ekstrak Bawang Merah (Allium cepa terhadap Luka Sayat Kulit Mencit (Mus Musculus (THE ACTIVITY OF TOPICAL EXTRACT OF ONIONS (ALLIUM CEPA ON WOUND HEALING PROCESS IN MICE (MUS MUSCULUS

Directory of Open Access Journals (Sweden)

Visa Yunanda

2017-01-01

Full Text Available Wound healing is a physiological response of the body to restore continuity, structure and function ofthe injured tissue. Onion is one of the plants that are empirically used by the community to heal wounds.The purpose of this study was to observe the effect of topical extract of onions (Allium cepa on woundhealing process in mice (Mus musculus strain BalbC. This study used the posttest-only control groupdesign with completely randomized design (CRD. The samples were 12 male mice with weight ranged of22-32 g divided into four treatments; i.e.: Vaseline, topical extract of onion 5%, topical extract of onion30% and topical extract of onion 55% with 3 replications. Wound healing evaluated macroscopically toobserve hyperemia, wound contraction, granulation, crusting and pus production; and microscopically bycounting the number of fibroblasts on day 10. Hyperemia, granulation, crusting and pus production wereanalyzed descriptively. Wound contraction and the number of fibroblasts were analyzed using ANOVA(p<0.05 and followed with Duncan’s test (p<0,05. Descriptive observations obtained hyperemia lasteduntil day 3, granulation in wounds used topical extract of onion 30% and 55% were faster than the other,crusting lasted until day 6 and the production of pus was not found in any treatment. Statistical testresults showed that topical extract of onion 55% significantly affected wound contraction and topicalextract of onion 30% and 55% significantly affected maturation, which characterized by the decreasednumber of fibroblasts. The results of this study showed that topical extract of onion had significant effect(p<0.05 on wound healing and the effect was in line with the increased concentration of the onion extract.

(reprocessed)CAGE peaks - FANTOM5 | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us FANTOM...g38/mm10). Data file File name: (reprocessed)CAGE_peaks (Homo sapiens) File URL: ftp://ftp.biosciencedbc.jp/archive/fantom...)CAGE_peaks (Mus musculus) File URL: ftp://ftp.biosciencedbc.jp/archive/fantom5/d...his Database Site Policy | Contact Us (reprocessed)CAGE peaks - FANTOM5 | LSDB Archive ...

KOLONISASI Mus musculus albino DI LABORATORIUM LOKA LITBANG P2B2 BANJARNEGARA

Directory of Open Access Journals (Sweden)

Dewi Marbawati

2012-11-01

Full Text Available The improvement and development of science and technologycal in health area must be followed with improvement of requirement of test animal would especially white mouse (Mus musculus albino/mencit. Usage of white mouse (mencit because of relatively easy in handling, the size relatively small, the price relatively cheap, once birth can reach 16- 18, have similiarity in circulation system of human and doesn't have ability to vomit because having spillway in bouncing up, that is why white mouse used for drug trial research. This research expected to obtain stable white mouse colony in laboratory to fulfill requirement of white mouse as subject for research.Research was started in March-November 2008 in Loka Litbang P2B2 Banjarnegara. This research was elementary research with observational design. Data were collected from white mouse growth observation. Result of observation showed reproduction of white mouse after 5 month, from 6 white mouse increased become 17 (increased 2 times more, with number of deaths 11,76%. This white mouse survive until 12 months, but the average was 6 month. Oldest mencit until research ends (November 2008 ranges from 8 months. Daily observation data showed that white mouse can bear children until 6/pregnance. According to literature study mouse can bear children average 68/pregnance. Generaly baby mouse was around 1 gram, heavily horns depend on type (strain of white mouse. Result of white mouse weight showed increase of white mouse's body weight every 2 weeks was 8,6 grams. Observation data of development white mouse showed after 4 days the white mouse hair was seen, specially moustache that was clearly seen, on 5 day whole body was white. At the age of 10 days ear opened, part of other body like external mamilla and genitals become explains looked to be. At the age of 12 days eye started opens and active walking.

A survey on helminthic infection in mice (Mus musculus and rats (Rattus norvegicus and Rattus rattus in Kermanshah, Iran

Directory of Open Access Journals (Sweden)

Norollah Pakdel

2013-06-01

Full Text Available Parasitic infections of rodents can compromise scientific research as well as the health of the animals and humans. Based on previous studies, infection rate of parasitic helminths is different in various regions of Iran. The current survey was aimed to determine endoparasitic helminths infection in 138 trapped rodents of Kermanshah county, Iran. Mice and rats were trapped using metal snares from January to October 2011 and euthanized. Rodents included 110 Mus musculus (79.00%, 23 Rattus norvegicus (17.00%, and five Rattus rattus (4.00%. The gastrointestinal and respiratory tracts were removed and examined to identify parasitic helminths. The results indicated that 42.02% of examined rodents were infected with eight helminths species, i.e. Trichuris muris (14.49%, Syphacia obvelata (13.76%, Syphacia muris (2.89%, Aspicularis tetrapetra (5.07%, Heterakis spumosa (5.07%, Capillaria hepatica eggs (3.62%, Hyminolepis diminuta (12.30%, and Cystisercus fasciolaris, the larva of Taenia teanieformis (4.34%. Given the results of this study, we concluded that examined rodents were more infected with nematodes than other helminths. As rodents are usually infected with a number of zoonotic parasites, hence control of these animals has an important role in safeguarding public health.

The reactivity of plant, murine and human genome to electron beam irradiation

International Nuclear Information System (INIS)

Gavrila, L.; Usurelu, D.; Radu, I.; Timus, D.

2005-01-01

A broad spectrum of chromosomal rearrangements is described in plants (Allium cepa), mouse (Mus musculus domestics) and in humans (Homo sapiens sapiens), following in vivo and in vitro beta irradiation. Irradiations were performed at EAL, using a 2.998 GHz traveling-wave electron accelerator. The primary effect of electron beam irradiation is chromosomal breakage followed up by a variety of chromosomal rearrangements i.e. chromosomal aberrations represented mainly by chromatid gaps, deletions, ring chromosomes, dicentrics, translocations, complex chromosomal interchanges, acentric fragments and double minutes (DM). The clastogenic effects were associated in some instances with cell sterilization (i.e. cell death)

Cross-experimental analysis of coat color variations and morphological characteristics of the japanese wild mouse, Mus musculus.

Science.gov (United States)

Suzuki, Taichi A; Iwasa, Masahiro A

2013-01-01

There are many coat colors in the laboratory mouse, Mus musculus. On the basis of traditional genetics, there are four loci, A-D, related to coat color expressions. As shown by previous studies, Japanese wild mice have gray backs and white bellies and are assumed to carry the A(w) allele at the A (agouti) locus, which is dominant over any other alleles. However, we collected Japanese wild mice from central Honshu with black coats. To understand this black coat expression, we performed cross experiments concerning the four loci using wild-caught mice and DBA/2 laboratory mice from the standpoint of traditional genetics. The offspring of the current crosses showed the wild type, the blackish type, and the intermediate type from some combinations of parents. Considering the coat colors of the offspring, we did not obtain any evidence that the Japanese wild mice always carry the A(w) allele at the A locus. Furthermore, we were not able to explain the current coat color expressions using the traditional logic with regard to the A-D loci and concluded that it is possible for another locus (loci) to be related to the coat color expressions. On the other hand, skull characteristics and external body measurements of the captured wild mice were fundamentally different from those of DBA/2 and offspring from captured wild mice and DBA/2 combinations. Thus, we concluded that the Japanese wild mice had original criteria from a morphological viewpoint.

Learning and Olfaction: Understanding and Enhancing a Critical Information Channel

Science.gov (United States)

2013-05-13

Mouse Strains (Mus-Musculus) and Major Histocompatibility Types by Humans ( Homo - Sapiens ). Journal of Comparative Psychology 100, 262-265 (1986). 13...min) 0 10 20 30 40 50 60 70 80 90 100 0 10 20 30 40 50 60 70 80 90 100 R el at iv e A bu nd an ce 48.09 33.64 10.39 42.64 44.3636.54 39.6925.26 30.62

An RNAi-Enhanced Logic Circuit for Cancer Specific Detection and Destruction

Science.gov (United States)

2013-02-01

monomeric protein secreted by Corynebacterium diphtheriae, and pro-apoptotic members of Bcl-2 family: mBax (Mus musculus), hBax ( Homo sapiens ), and its...Gata3 mStaple. Intron- feature sequences – donor site, branch point, poly- pyrimidine tract, and acceptor site – were selected based on previously...sequences found in literature our intron features were chosen according SplicePort [4], an online analyzer that detects the likelihood of splicing to

Pengaruh Pemberian Ekstrak Etanol Daun Kecapi (Sandoricum koetjape (Burm.f. Merr. Terhadap Penurunan Kadar Kolesterol Total pada Mencit Jantan (Mus musculus

Directory of Open Access Journals (Sweden)

Rudi Kartika

2016-06-01

Full Text Available The research about utilization of ethanol extract form leafkecapi (Sandoricum koetjape (Burm.f.Merr.has been done, it proved could decrease  total cholesterol levels in male mice (Mus musculus. In this research sample macerated with ethanol 96% and then concentrated by rotary evaporator, and gained 15.6% of yield. Based on the results of phytochemical test, secondary metabolites compound that contained in bark kecapi are alkaloid, flavonoid, triterpenoid, steroid, phenolic and saponin. On antihiperkolesterolemia activity test by using male mice, there are several treatments that negative control (-, positive control (+ and three treatment with different doses i.e. a low doses (9.5 mg/kg BB, middle doses (19 mg/kg BB and high doses (38 mg/kg BB. The parameter measured was blood serum of male mice by using a Cholesterol Test Strips. From this test it showed that the effectiveness of decreased total cholesterol level doses of 19 mg/kg BB showed total cholesterol level under 100 mg/dL. Keywords:      Leaf kecapi (Sandoricum koetjape (Burm.f. Merr., Phytochemicals test, Total cholesterol levels, Cholesterol test strips.

Genotoxic effects in wild rodents (Rattus rattus and Mus musculus) in an open coal mining area.

Science.gov (United States)

León, Grethel; Pérez, Lyda Espitia; Linares, Juan Carlos; Hartmann, Andreas; Quintana, Milton

2007-06-15

Coal is a mixture of a variety of compounds containing mutagenic and carcinogenic polycyclic aromatic hydrocarbons. Exposure to coal is considered as an important non-cellular and cellular source of reactive oxygen species that can induce DNA damage. In addition, spontaneous combustion can occur in coal mining areas, further releasing compounds with detrimental effects on the environment. In this study the comet assay was used to investigate potential genotoxic effects of coal mining activities in peripheral blood cells of the wild rodents Rattus rattus and Mus musculus. The study was conducted in a coal mining area of the Municipio de Puerto Libertador, South West of the Departamento de Cordoba, Colombia. Animals from two areas in the coal mining zone and a control area located in the Municipio de Lorica were investigated. The results showed evidence that exposure to coal results in elevated primary DNA lesions in blood cells of rodents. Three different parameters for DNA damage were assessed, namely, DNA damage index, migration length and percentage damaged cells. All parameters showed statistically significantly higher values in mice and rats from the coal mining area in comparison to the animals from the control area. The parameter "DNA Damage Index" was found to be most sensitive and to best indicate a genotoxic hazard. Both species investigated were shown to be sensitive indicators of environmental genotoxicity caused by coal mining activities. In summary, our study constitutes the first investigation of potential genotoxic effects of open coal mining carried out in Puerto Libertador. The investigations provide a guide for measures to evaluate genotoxic hazards, thereby contributing to the development of appropriate measures and regulations for more careful operations during coal mining.

NCBI nr-aa BLAST: CBRC-OLAT-26-0164 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-26-0164 ref|NP_031715.1| chondroadherin [Mus musculus] sp|O55226|CHAD_MOUSE Chondroad...herin precursor (Cartilage leucine-rich protein) gb|AAC39963.1| chondroadherin [Mus musculus] gb|AAH12672.1| Chondroad...herin [Mus musculus] emb|CAI25589.1| chondroadherin [Mus musculus] dbj|BAE34451.1| unn...amed protein product [Mus musculus] gb|EDL15934.1| chondroadherin [Mus musculus] NP_031715.1 5e-85 57% ...

Alteration of Motor Network Function Following Injury

Science.gov (United States)

2013-10-01

Mus musculus, and Homo sapiens . We used these primers in RT-PCR reactions (GoTaq Green; Promega) to obtain PCR products of predicted length, which were...shown theoretically that this can indeed stabilize specific activity features (Ball et al. 2010; Burdakov 2005; Franklin et al. 2010; MacLean et al...compensatory increases in H-current (MacLean et al., 2003, 2005). However, these examples feature mechanisms that act over longer time scales of days to

Pathosphere.org: Pathogen Detection and Characterization Through a Web-based, Open-source Informatics Platform

Science.gov (United States)

2015-12-29

human), Homo sapiens chromosome (human), Mus_musculus ( rodent ), Sus scrofa (pig), mitochondrion genome, and Xenopus laevis (frog) . The taxonomy... Amazon Web Services. PLoS Comput Biol 2011, 7:e1002147. 10. Briese T, Paweska JT, McMullan LK, Hutchison SK, Street C, Palacios G, Khristova ML...human enterovirus C genotypes found in respiratory samples from Peru . J Gen Virol 2013, 94(Pt 1):120–7. 54. Jacob ST, Crozier I, Schieffelin JS

Male meiosis and gametogenesis in wild house mice (Mus musculus domesticus) from a chromosomal hybrid zone; a comparison between "simple" Robertsonian heterozygotes and homozygotes.

Science.gov (United States)

Wallace, B M; Searle, J B; Everett, C A

1992-01-01

Wild male house mice Mus musculus domesticus were collected from the hybrid zone between the John o'Groats race (2n = 32) and the standard race (2n = 40) in northern Scotland. Meiosis in both homozygotes (2n = 32, 36, and 40) and single Robertsonian heterozygotes (2n = 33, 35, and 37) was found to be orderly. At prophase/metaphase I in heterozygotes, a trivalent was formed from the metacentric and two homologous acrocentrics. At pachytene, this trivalent usually had a single side arm at the position of the centromeres, as a result of nonhomologous pairing of the acrocentrics. This side arm persisted into diplotene. Generally only a single chiasma was formed between each acrocentric and the metacentric. Anaphase I nondisjunction frequencies were estimated as 1.5% for the homozygotes and 2.7% for the heterozygotes. The extent of germ cell death between the pachytene and round spermatid stages was 18% greater in heterozygotes than in homozygotes. Our results concur with previous studies which indicate that single Robertsonian heterozygotes in wild house mice have near-normal fertility.

Syphacia obvelata (Nematode, Oxyuridae) infecting laboratory mice Mus musculus (Rodentia, Muridae): phylogeny and host-parasite relationship.

Science.gov (United States)

Abdel-Gaber, Rewaida

2016-03-01

Syphacia obvelata is a pinworm nematode parasite infecting man and laboratory animals in high abundance. This parasitological study was carried out during the period of March 2014-February 2015 to investigate the helminth parasites infecting the laboratory mice Mus musculus in the Animal House at Cairo University, Egypt. The prevalence of S. obvelata in M. musculus was 75.0 %. The extent of infection with S. obvelata is analyzed according to the sex of the host mice. It was shown that the prevalence of male infection was greater than female worms. Morphological characterization revealed that the present Oxyurid species possesses a rounded cephalic end with less developed lips, esophagus divided into cylindrical corpus, and globular bulb supported internally with valvular apparatus; three mamelons are located at the ventral surface with a single chitinized spicule and a gubernaculum provided with an accessory hook in males, and ovijector apparatus opens ventrally by the vulva surrounded by protruded lips in female worms. Body of the male was 0.623-1.130 (0.830 ± 0.11) mm long and 0.092-0.130 (0.110 ± 0.01) mm wide; the esophagus was 0.164-0.280 (0.210 ± 0.01) mm long; the nerve ring and excretory pore are located at 0.035-0.132 (0.073 ± 0.01) and 0.087-0.191 (0.145 ± 0.01) mm from the anterior end, respectively, while the female measured 2.930-4.650 (3.540 ± 0.1) mm long and 0.120-0.232 (0.156 ± 0.001) mm wide; the esophagus was 0.213-0.410 (0.342 ± 0.01) mm long; the nerve ring, excretory pore, and vulval opening are located at 0.026-0.157 (0.121 ± 0.01), 0.134-0.243 (0.195 ± 0.01), and 0.323-0.632 (0.546 ± 0.11) mm from the anterior end, respectively; eggs measured 0.120-0.139 (0.129 ± 0.001) mm long and 0.030-0.052 (0.045 ± 0.001) mm wide. It compared morphometrically with other Syphacia species described previously and showed little differences in

NCBI nr-aa BLAST: CBRC-CJAC-01-1133 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1133 ref|NP_068677.2| hairless protein [Mus musculus] sp|Q61645|HAIR_MOUSE Protein hair...less gb|AAH49182.1| Hairless [Mus musculus] gb|EDL35888.1| hairless, isoform CRA_a [Mus musculus] gb|EDL35889.1| hai...rless, isoform CRA_a [Mus musculus] gb|EDL35890.1| hairless, isoform CRA_a [Mus musculus] NP_068677.2 5.1 44% ...

Efeitos da música clássica como elemento de enriquecimento ambiental em Mus musculus em cativeiro (Rodentia: Muridae

Directory of Open Access Journals (Sweden)

José Geraldo Pereira da Cruz

2010-04-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2010v23n2p191 No ambiente selvagem, os animais são submetidos a mudanças constantes nos estímulos sensoriais. Entretanto, o ambiente de cativeiro é muito mais pobre em termos de estímulos fornecidos aos animais alojados no seu interior. Numa tentativa de remediar esta situação e promover um melhor bem estar, camundongos (Mus musculus foram expostos a duas condições: sem estímulos auditivos e com música clássica. Em todos os experimentos foi utilizada uma bateria de testes comportamentais. Os resultados demonstram uma diminuição significativa na imobilidade no nado forçado, aumento de entradas nos braços fechados do labirinto em cruz elevado e diminuição na imobilidade no campo aberto, nos animais que haviam sido pré-expostos anteriormente a 24h de música e sugerem que a música clássica causas mudanças na atividade motora em camundongos. Este estudo leva a conclusão que o enriquecimento do ambiente causa profundos efeitos sobre o comportamento de camundongos nos testes comportamentais e a música clássica é um método relativamente simples de contribuir para o bem estar de camundongos em cativeiro, mas pode comprometer resultados de experimentos como o nado forçado.

Toxicological evaluation of essential oil from the leaves of Croton tetradenius (Euphorbiaceae) on Aedes aegypti and Mus musculus.

Science.gov (United States)

Carvalho, Karine da Silva; E Silva, Sandra Lúcia da Cunha; de Souza, Ivone Antonia; Gualberto, Simone Andrade; da Cruz, Rômulo Carlos Dantas; Dos Santos, Frances Regiane; de Carvalho, Mário Geraldo

2016-09-01

For control of Aedes aegypti, the main vector of dengue, botanical insecticides can be a viable alternative. Herein, we evaluated the chemical composition and insecticidal activity of the essential oils of the leaves of Croton tetradenius on Ae. aegypti larvae and adults. We also evaluated the acute toxicity in Mus musculus. The essential oil chemical analysis was performed using chromatography coupled with mass spectrometry and flame ionization detection. Female mice were used for assessing toxicity according to the Organization for Economic Cooperation and Development's Test Guideline 423/2001. Doses administered to mice orally and intraperitoneally were 5, 50, 300, and 2000 mg kg(-1). There was a greater toxic effect on larvae (LC50 = 0.152 mg mL(-1) and LC90 = 0.297 mg mL(-1)) and on adults (LC50 = 1.842 mg mL(-1) and LC90 = 3.156 mg mL(-1)) of Ae. aegypti after 24 h of exposure, when compared to other periods of exposure. Chemical analysis revealed 26 components, with camphor (25.49 %) as the major component. The acute toxicity via the intraperitoneal route identified an LD50 = 200 mg kg(-1) and by the oral route an LD50 = 500 mg kg(-1). Thus, the essential oil of C. tetradenius presents insecticidal potential for Ae. aegypti and has high safety threshold at the concentrations evaluated in this study.

The radioprotective effects of Noni (Morinda citrifolia L.) juice on the bone marrow of irradiated Mus musculus L

International Nuclear Information System (INIS)

Boquiren, Ryan Albert Leonard N.; Te Tan, Alvin E.

2000-03-01

The radioprotective effects of Noni juice on the bone marrow of irradiated Mus musculus L. (7-week old IRC strain) was studied using the micronucleus test. Five mice were used for each of the six groups; negative and positive control, 25%, 50%, 75%, 100% treatment. Both negative and positive control groups were not treated with Noni juice. However, the negative control was not irradiated. Four different concentrations, a mixture of distilled water and commercial Noni juice, were administered via oral gavage to mice in their specific groups during the 15-day feeding schedule. A day (24H) after the last treatment, the mice were irradiated (6 Gy of gamma radiation). Two days (48H) after irradiation, the mice were sacrifice and the femur were extracted. The bone marrow cells were collected and slides were prepared. One thousand polychromatic erythrocytes (PCE) were screened for the presence of micronucleus per mouse. The mean frequency of micronucleated PCE were as follows: negative control, 15; positive control, 45; 25% treatment, 21; 50% treatment, 18; 75% treatment, 11; 100% treatment, 7. The Kruskal-Wallis test showed that the groups' responses varied (α=0.05). Multiple comparison showed that there were significant differences between: (1) 25% and 100% treatment group; (2) positive control group and 75% treatment group; (3) positive control group and 100% treatment group, thus indicating that Noni juice is effective in inhibiting micronucleus formation at high concentrations. The result also showed that radioprotective potential of Noni juice follows a dose-dependent pattern. (Author)

The radioprotective effects of Noni (Morinda citrifolia L.) juice on the bone marrow of irradiated Mus musculus L

Energy Technology Data Exchange (ETDEWEB)

Boquiren, Ryan Albert Leonard N.; Te Tan, Alvin E

2000-03-01

The radioprotective effects of Noni juice on the bone marrow of irradiated Mus musculus L. (7-week old IRC strain) was studied using the micronucleus test. Five mice were used for each of the six groups; negative and positive control, 25%, 50%, 75%, 100% treatment. Both negative and positive control groups were not treated with Noni juice. However, the negative control was not irradiated. Four different concentrations, a mixture of distilled water and commercial Noni juice, were administered via oral gavage to mice in their specific groups during the 15-day feeding schedule. A day (24H) after the last treatment, the mice were irradiated (6 Gy of gamma radiation). Two days (48H) after irradiation, the mice were sacrifice and the femur were extracted. The bone marrow cells were collected and slides were prepared. One thousand polychromatic erythrocytes (PCE) were screened for the presence of micronucleus per mouse. The mean frequency of micronucleated PCE were as follows: negative control, 15; positive control, 45; 25% treatment, 21; 50% treatment, 18; 75% treatment, 11; 100% treatment, 7. The Kruskal-Wallis test showed that the groups' responses varied ({alpha}=0.05). Multiple comparison showed that there were significant differences between: (1) 25% and 100% treatment group; (2) positive control group and 75% treatment group; (3) positive control group and 100% treatment group, thus indicating that Noni juice is effective in inhibiting micronucleus formation at high concentrations. The result also showed that radioprotective potential of Noni juice follows a dose-dependent pattern. (Author)

Fraksi Heksan dan Fraksi Metanol Ekstrak Biji Pepaya Muda Menghambat Spermatogonia Mencit (Mus Musculus Jantan

Directory of Open Access Journals (Sweden)

Bagus Komang Satriyasa

2010-03-01

spermatogoniaA decreased significantly (p < 0,01. It is concluded that hexan fraction and methanol fraction ofunripe carica papaya seeds extract can decrease spermatogonia A cell of male mice (mus musculus.

Histometría de la glándula sublingual de ratones (Mus musculus machos y hembras infectados con la cepa RAL del parásito de Chagas, Trypanosoma cruzi

Directory of Open Access Journals (Sweden)

Sérgio de Albuquerque

2008-06-01

Full Text Available Analizamos morfológica e histométricamente la glándula sublingual de ratones infectados con la cepa RAL del Trypanosoma cruzi, en machos y hembras. Usamos ratones albinos (Mus musculus, variedad Swiss, inoculados con 2x104 tripomastigotes sanguíneos de la cepa RAL del T. cruzi.. Sacrificamos los animales en el pico de la parasitemia (12º día y fijamos las glándulas sublinguales en ALFAC. Los cortes histológicos teñidos con HE fueron evaluados histométricamente (cariometría y estereología. La parasitemia fue más elevada en las hembras. Histopatológicamente, los "ácinos" (acini de los animales infectados eran menores, con escasa secreción, y conductos estriados menores. Los núcleos de las "medialunas" eran menores y había nidos de amastigotes en el citoplasma. Cariométricamente, los núcleos de los ácinos, medialunas y conductos estriados eran menores en los ratones infectados. Estereológicamente, los volúmenes relativos ocupados por ácinos y conductos estriados fueron menores e, inversamente, fue mayor el volumen para el tejido conjuntivo de los machos infectados. Las densidades de superficie de ácinos y conductos fueron mayores, y el diámetro y el espesor de la pared menores, en este grupo. Por otro lado, la densidad de ácinos fue menor, y las de los conductos estriados y tejido conjuntivo, fueron mayores en las hembras infectadas. Las densidades de superficie de ácinos y conductos estriados fueron mayores, mientras que el diámetro y espesor de la pared de los ácinos fueron menores (y las de los conductos estriados mayores, en este grupo. La cepa RAL del T. cruzi causó un cuadro general de atrofia general en la glándula sublingual, con numerosos nidos de parásitos.Histometry of the sublingual gland in male and female mice (Mus musculus infected with the RAL strain of the Chagas parasite, Trypanosoma cruzi. The aim of this work was to analyze histologically and histometrically the sublingual gland of mice infected

Gene : CBRC-MMUS-06-0104 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0104 6 A Pheromone receptors V1A16_RAT 2e-53 39% ref|NP_598931.1| vomeronasa...l 1 receptor, C15 [Mus musculus] gb|AAL47876.1| vomeronasal receptor V1RC15 [Mus musculus] dbj|BAC2634...7.1| unnamed protein product [Mus musculus] gb|AAI19598.1| Vomeronasal 1 receptor, C15 [Mus musculus] gb|AAI19597.1| Vomeronasa...l 1 receptor, C15 [Mus musculus] gb|EDK98787.1| vomeronasal 1 ...l-length enriched library, clone:4831417D05 product:similar to VOMERONASAL RECEPTOR V1RC3 [Mus musculus], fu

Permanent magnetic field, direct electric field, and infrared to reduce blood glucose level and hepatic function in mus musculus with diabetic mellitus

Science.gov (United States)

Suhariningsih; Basuki Notobroto, Hari; Winarni, Dwi; Achmad Hussein, Saikhu; Anggono Prijo, Tri

2017-05-01

Blood contains several electrolytes with positive (cation) and negative (anion) ion load. Both electrolytes deliver impulse synergistically adjusting body needs. Those electrolytes give specific effect to external disturbance such as electric, magnetic, even infrared field. A study has been conducted to reduce blood glucose level and liver function, in type 2 Diabetes Mellitus patients, using Biophysics concept which uses combination therapy of permanent magnetic field, electric field, and infrared. This study used 48 healthy mice (mus musculus), male, age 3-4 weeks, with approximately 25-30 g in weight. Mice was fed with lard as high fat diet orally, before Streptozotocin (STZ) induction become diabetic mice. Therapy was conducted by putting mice in a chamber that emits the combination of permanent magnetic field, electric field, and infrared, every day for 1 hour for 28 days. There were 4 combinations of therapy/treatment, namely: (1) permanent magnetic field, direct electric field, and infrared; (2) permanent magnetic field, direct electric field, without infrared; (3) permanent magnetic field, alternating electric field, and infrared; and (4) permanent magnetic field, alternating electric field, without infrared. The results of therapy show that every combination is able to reduce blood glucose level, AST, and ALT. However, the best result is by using combination of permanent magnetic field, direct electric field, and infrared.

Effect of Powder Leaf Breadfruit Disposals (Arthocarpus Altilis) in Oil Mandar District and Polman Against Cholesterol and Glucose Mice (Mus Musculus)

Science.gov (United States)

Mu'nisa, A.; Asmawati, A.; Farida, A.; FA, Fressy; Erni

2018-01-01

The purpose of this study was to determine the effect of powdered leaves of breadfruit (Arthocarpus altilis) on oil is mandated origin of the Polman glucose and cholesterol levels in mice (Mus musculus). This study comprised 4 treatments and each treatment consisted of 5 replicates, ie groups of mice were fed a standard (negative control); 2 groups: group of mice fed with standard and cholesterol feed (positive control); Group 3 that mice fed with standard and Selayar oil; and group 4: group of mice fed with standard and Mandar oil that has been given powdered leaves of breadfruit. Measurement of glucose and blood cholesterol levels in mice done 3 times ie 2 weeks after the adaptation period (phase 1), 2 weeks after administration of the oil (phase 2) and 2 weeks after feeding cholesterol (stage 3). Based on the analysis of data both cholesterol and glucose levels showed that in a group of 4 decreased glucose and cholesterol levels in stage 2 but at stage 3 an increase in the group of mice given only the oil while in the group of mice given the oil and powdered leaves of breadfruit indicate glucose levels and normal cholesterol. The conclusion of this study show that the addition of powdered leaves of breadfruit into cooking oil Mandar influential in glucose levels and normalize blood cholesterol levels in mice.

Efecto del extracto del fruto de Physalis peruviana "tomatillo" en Mus musculus var. swis con hiperlipidemia inducida.

Directory of Open Access Journals (Sweden)

Julio Campos Florián

2011-01-01

Full Text Available El objetivo de la presente i nvestigación fue determinar la actividad hipolipidémica del fruto de Physalis peruviana “tomatillo” en un modelo de hiperlipidemia aguda inducida con tritón. Se utilizaron Mus musculus var. swis machos como animales de experimentación. Se trabajó con cuatro grupos de ratones, el grupo blanco recibió agua destilada por vía oral y solución salina fisiológica por vía intraperitoneal, el grupo control recibió agua destilada por vía oral y tritón por vía intraperitoneal, el grupo problema 1 recibió por vía oral 0.05g/100g del extracto de Physalis peruviana y tritón por vía intraperitoneal y el grupo problema 2 recibió por vía oral 0.2g/100g del extracto de Physalis peruviana y tritón por vía intraperitoneal. Luego de 24 horas de administrar los tratamientos se re alizaron las mediciones en suero de las concentraciones de colesterol y triglicéridos. Los niveles promedio de colesterol (mg/dL fueron: 58.87±11.54 (blanco, 121.71±15.00 (control, 58.08±9. 21 (problema 1 y 66.78±16.77 (problema 2. Los niveles promedio de triglicéridos (g/L fueron: 0.48±0.07 (blanco, 1.84±0.18 (control, 0.34±0.10 (problema 1 y 0.94±0.25 (problema 2. Se encontró reducciones significativas (p<0.000, tanto de las concentraciones de colesterol como de triglicéridos en relación a las o btenidas en el grupo tratado sólo con tritón.

NCBI nr-aa BLAST: CBRC-MMUS-07-0085 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-07-0085 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-RNOR-01-0219 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-01-0219 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-RNOR-01-0216 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-01-0216 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa

Mus musculus bone fluoride concentration as a useful biomarker for risk assessment of skeletal fluorosis in volcanic areas.

Science.gov (United States)

Linhares, Diana; Camarinho, Ricardo; Garcia, Patrícia Ventura; Rodrigues, Armindo Dos Santos

2018-08-01

Fluoride is often found in elevated concentrations in volcanic areas due to the release of magmatic fluorine as hydrogen fluorine through volcanic degassing. The exposure to high levels of fluoride can affect the processes of bone formation and resorption causing skeletal fluorosis, a pathology that can easily be mistaken for other skeletal diseases. In this study, we aimed to determine if fluoride concentration in the femoral bone of wild populations of the house mouse (Mus musculus) is a good biomarker of exposure to active volcanic environments naturally enriched in fluoride, allowing their use in biomonitoring programs. The fluoride concentration of the whole femoral bone of 9 mice from Furnas (5 males and 4 females) and 33 mice from Rabo de Peixe (16 males and 17 females) was measured by the potentiometric method with a fluoride ion selective electrode. Fluoride in bones was significantly higher in the mice from Furnas when compared with the mice from Rabo de Peixe (616.5 ± 129.3 μg F/g vs. 253.8 ± 10.5 μg F/g). Accumulation rates were also significantly higher in the mice collected in Furnas when compared with Rabo de Peixe individuals (3.84 ± 0.52 μg F/day vs. 1.22 ± 0.06 μg F/day). The results demonstrate a significant association between exposure to fluoride in the active volcanic environment and fluoride content in bone, revealing that bone fluoride concentration is a suitable biomarker of chronic environmental exposure to fluoride. Copyright © 2018 Elsevier Ltd. All rights reserved.

New Metacentric Populations and Phylogenetic Hypotheses Involving Whole-Arm Reciprocal Translocation in Mus musculus domesticus from Sicily, Southern Italy.

Science.gov (United States)

Castiglia, Riccardo; Capanna, Ernesto; Bezerra, Alexandra M R; Bizzoco, Domenico; Zambigli, Emanuela; Solano, Emanuela

2015-01-01

The house mouse Mus musculus domesticus is characterized by more than 100 metacentric populations, due to the occurrence of Robertsonian (Rb) fusions, together with the standard all-telocentric karyotype (2n = 40). We examined G-banded karyotypes of 18 mice from 10 localities in Sicily and describe 3 new metacentric populations: 'Ragusa Ibla' (IRAG), 2n = 33-36, Rb(2.4), Rb(5.6), Rb(9.16), Rb(13.17); 'Piana degli Albanesi' (IPIA), 2n = 23, Rb(1.18), Rb(2.15), Rb(3.5), Rb(4.12), Rb(6.11), Rb(7.8), Rb(9.16), Rb(10.14), Rb(13.17); 'Trapani' (ITRA), 2n = 22, Rb(1.18), Rb(2.15), Rb(3.7), Rb(4.12), Rb(5.9), Rb(6.11), Rb(8.16), Rb(10.14), Rb(13.17). Three mice belonged to the previously reported 'Castelbuono' race (ICAS), 2n = 24, which is very similar to the nearby 'Palermo' (IPAL) race, 2n = 26. Three Rb fusions not yet observed in wild mouse populations were identified: Rb(3.5), Rb(3.7) and Rb(5.9). Rb fusions shared among 4 races (IPIA, IRAG, ICAS, and IPAL) allowed us to describe their potential phylogenetic relationships. We obtained 2 alternative phylogenetic trees. The differences between them are mainly due to various modes of formation of IPIA and ITRA. In the first hypothesis, the specific Rb fusions occurred independently. In the second, those of IRAG originated from those of IPIA via whole-arm reciprocal translocations. © 2015 S. Karger AG, Basel.

ORF Alignment: NT_033777 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NT_033777 gi|28571958 >1bor0 1 53 282 342 4e-04 ... ref|NP_083045.3| synoviolin 1 [Mu...s musculus] gb|AAH42199.1| Synoviolin 1 [Mus ... musculus] gb|AAH80722.1| Synoviolin 1 [Mus musculus]... ... gb|AAH57917.1| Synoviolin 1 [Mus musculus] ... Length = 61 ... Query: 280 EELRQSDNICIICREDMV

NCBI nr-aa BLAST: CBRC-PCAP-01-1368 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-1368 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-PHAM-01-1594 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1594 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-MLUC-01-1112 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-1112 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-OPRI-01-0982 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0982 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-VPAC-01-1554 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1554 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-MMUR-01-1494 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1494 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-TTRU-01-0117 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0117 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-GGOR-01-1297 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-1297 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-CINT-01-0186 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CINT-01-0186 ref|NP_083045.3| synovial apoptosis inhibitor 1, synoviolin [Mus ...musculus] sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin precursor (Synovial apoptosis inhibit...or 1) gb|AAH42199.1| Synovial apoptosis inhibitor 1, synoviolin [Mus musculus] gb|AAH57917.1| Synovial apoptosis inhibitor 1, synovio...lin [Mus musculus] gb|AAH80722.1| Synovial apoptosis inhibitor 1, synoviolin... [Mus musculus] gb|EDL33195.1| synovial apoptosis inhibitor 1, synoviolin, isoform CRA_b [Mus musculus] NP_083045.3 1e-167 51% ...

Pengaruh Ekstrak Daun Sambiloto (Andrographis paniculata terhadap Struktur Mikroanatomi Hepar dan Kadar Glutamat Piruvat Transaminase Serum Mencit (Mus musculus yang Terpapar Diazinon

Directory of Open Access Journals (Sweden)

TRI WULANDARI

2007-11-01

Full Text Available Diazinon is a pesticide which is often using by farmer to kill insect as theenemy of the plant. The over using of pesticide may result in the remaining of diazinon residue in farming product. This residue can cause the damage of body tissue, especially liver. The aim of research were to find out the effect of leaves sambiloto (Andrographis paniculata Ness. extract on microanatomic structure of liver and serum glutamate pyruvate transaminase (GPT level of mice (Mus musculus L. exposed to diazinon. The research used Compelete Random Design with five treatments. The treatment of each group were using CMC 1% (placebo control, diazinon solution 40 mg/Kg BW (negative ontrol and the leaves sambiloto extract 12,6; 25,2 and 37,8 mg /kg BW. Diazinon solution was given within 10 days and continued with extract of sambiloto leaves also within 10 days. Parameter observed was the microanatomic structure of liver and serum GPT level. The data was analyzed of Analysis of Varians (Anova and continued with DMRT at significance 5%. The result of the research showed that the giving of the extract of sambiloto leaves in some dose variation degree is significantly influential to repair the microanatomic structure of liver and to decrease the serum GPT level was 37,8 mg/Kg BW.

Permanent magnetic field, direct electric field, and infrared to reduce blood glucose level and hepatic function in mus musculus with diabetic mellitus

International Nuclear Information System (INIS)

Suhariningsih; Prijo, Tri Anggono; Notobroto, Hari Basuki; Winarni, Dwi; Hussein, Saikhu Achmad

2017-01-01

Blood contains several electrolytes with positive (cation) and negative (anion) ion load. Both electrolytes deliver impulse synergistically adjusting body needs. Those electrolytes give specific effect to external disturbance such as electric, magnetic, even infrared field. A study has been conducted to reduce blood glucose level and liver function, in type 2 Diabetes Mellitus patients, using Biophysics concept which uses combination therapy of permanent magnetic field, electric field, and infrared. This study used 48 healthy mice ( mus musculus ), male, age 3-4 weeks, with approximately 25-30 g in weight. Mice was fed with lard as high fat diet orally, before Streptozotocin (STZ) induction become diabetic mice. Therapy was conducted by putting mice in a chamber that emits the combination of permanent magnetic field, electric field, and infrared, every day for 1 hour for 28 days. There were 4 combinations of therapy/treatment, namely: (1) permanent magnetic field, direct electric field, and infrared; (2) permanent magnetic field, direct electric field, without infrared; (3) permanent magnetic field, alternating electric field, and infrared; and (4) permanent magnetic field, alternating electric field, without infrared. The results of therapy show that every combination is able to reduce blood glucose level, AST, and ALT. However, the best result is by using combination of permanent magnetic field, direct electric field, and infrared. (paper)

NCBI nr-aa BLAST: CBRC-BTAU-01-2652 [SEVENS

Lifescience Database Archive (English)

Full Text Available s musculus] gb|AAH17129.1| Solute carrier family 16 (monocarboxylic acid transporters), member 6 [Mus muscul...us] emb|CAM25213.1| solute carrier family 16 (monocarboxylic acid transporters), member 6 [Mus musculus] gb|...EDL34359.1| solute carrier family 16 (monocarboxylic acid transporters), member 6..., isoform CRA_a [Mus musculus] gb|EDL34361.1| solute carrier family 16 (monocarboxylic acid transporters), member 6, isoform CRA_a [Mus musculus] NP_598799.1 1e-110 76% ...

Food preferences of wild house-mice (Mus musclus L).

Science.gov (United States)

Rowe, F P; Bradfield, A; Redfern, R

1974-12-01

The relative acceptance of various plain foods by wild house-mice (Mus musculus L.) was compared in laboratory choice tests. The palatability of glycerine and six oils, each included at 5% in pinhead oatmeal, was compared in a similar manner.The most favoured food was found to be whole canary seed (Phalaris canariensis). Pinhead oatmeal and wheat were also comparatively well accepted. Glycerine, corn oil, arachis oil and mineral oil were more palatable than either olive, linseed or cod-liver oils.The results of the choice tests are considered in relation to the use of poison baits for the control of free-living mice.

NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0135 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-139 80% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0136 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0136 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-175 100% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2632 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2632 ref|NP_076136.2| non-imprinted in Prader-Willi/Angelman syndrome ...2 [Mus musculus] sp|Q9JJC8|NIPA2_MOUSE RecName: Full=Magnesium transporter NIPA2; AltName: Full=Non-imprinte...tein product [Mus musculus] tpg|DAA01178.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 2 [Mus ...musculus] dbj|BAE32806.1| unnamed protein product [Mus musculus] gb|EDL21872.1| non imprint...ed in Prader-Willi/Angelman syndrome 2 homolog (human), isoform CRA_a [Mus musculus] gb|EDL21874.1| non imprint

NCBI nr-aa BLAST: CBRC-OCUN-01-0645 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0645 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 3e-46 53% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0141 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0141 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-135 78% ...

NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

Electrophoretic pattern of blood serum proteins of some of the vertebrates of Pakistan

International Nuclear Information System (INIS)

Shakoori, Abdul Rauf; Zaheer, Saleem Akhtar; Ahmad, Muhammad Salih.

1976-01-01

The electrophoretic pattern of blood serum proteins of some of the common fishes e.g. Catla catla, Cirrhina mrigala, Channa punctatus, Channa marulius, Wallago attu, Heterop-neustes fossilis; amphibia e.g., Rana tigrina, Rana cyanophlyctis, Bufo melanostictus; reptiles e.g. Varanus bengalensis, Uromastix hardwickii; birds e.g. Columba livia, Gallus domesticus, Passer domestica, Anas platyrhynchos; and mammals e.g. Homo sapiens, Mus musculus, Lepus cuniculus have been described. The mobility of proteins of blood sera has been studied over cellulose acetate paper and then a comparative pattern analysed

Synaptic vesicles isolated from the electric organ of Torpedo californica and from the central nervous system of Mus musculus contain small ribonucleic acids (sRNAs

Directory of Open Access Journals (Sweden)

Huinan Li

2017-06-01

Full Text Available Synaptic vesicles (SVs are presynaptic organelles that load and release small molecule neurotransmitters at chemical synapses. In addition to classic neurotransmitters, we have demonstrated that SVs isolated from the Peripheral Nervous Systems (PNS of the electric organ of Torpedo californica, a model cholinergic synapse, and SVs isolated from the Central Nervous System (CNS of Mus musculus (mouse contain small ribonucleic acids (sRNAs; ≤50 nucleotides (Scientific Reports, 5:1–14(14918 Li et al. (2015 [1]. Our previous publication provided the five most abundant sequences associated with the T. californica SVs, and the ten most abundant sequences associated with the mouse SVs, representing 59% and 39% of the total sRNA reads sequenced, respectively. We provide here a full repository of the SV sRNAs sequenced from T. californica and the mouse deposited in the NCBI as biosamples. Three data studies are included: SVs isolated from the electric organ of T. californica using standard techniques, SVs isolated from the electric organ of T. californica using standard techniques with an additional affinity purification step, and finally, SVs isolated from the CNS of mouse. The three biosamples are available at https://www.ncbi.nlm.nih.gov/biosample/ SRS1523467, SRS1523466, and SRS1523472 respectively.

DEFINIENDO HOMO SAPIENS-SAPIENS: APROXIMACIÓN ANTROPOLÓGICA DEFININDO HOMO SAPIENS-SAPIENS: APROXIMAÇÃO ANTROPOLÓGICA DEFINING HOMO SAPIENS-SAPIENS: ANTHROPOLOGICAL APPROACH

Directory of Open Access Journals (Sweden)

Carolina Valdebenito

2007-06-01

Full Text Available Este artículo reflexiona sobre los encuentros y desencuentros entre el ser humano y el resto de los animales, en tanto miembros de sistemas en permanente interacción(1. Abordar la definición de Homo, repasar su evolución biológica y cultural y reflexionar sobre los resabios de animalidad que quedan en el comportamiento social del Homo sapiens-sapiens es su objetivo principal. Se busca reflexionar sobre los dilemas morales que acompañan al hombre en tanto ser cultural; para ello se analizan dos dilemas éticos: la violencia y el incestoEste artigo reflete sobre os encontros e desencontros entre o ser humano e os demais animais, enquanto membros de sistemas em permanente interação(1. Seu principal objetivo é abordar a definição de Homo, traçar um panorama de sua evolução biológica e cultural e refletir sobre os resquícios da animalidade que permanecem no comportamento social do Homo sapiens-sapiens. Busca-se refletir sobre os dilemas morais que acompanham o homem enquanto ser cultural, o que para isso são considerados como dilemas éticos: a violência e o incestoThis paper reflects on the similarities and differences between human beings and animals as members of systems in permanent interaction. The main goal is to define Homo, reviewing his/her biological and cultural evolution and reflecting on the animal social behaviors that still remain in Homo sapiens-sapiens. The paper reflect on the moral dilemmas present in humans as cultural beings, taking as example the ethical dilemmas of violence and incest

NCBI nr-aa BLAST: CBRC-STRI-01-2305 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2305 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 8e-64 55% ...

NCBI nr-aa BLAST: CBRC-STRI-01-1937 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1937 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 2e-25 41% ...

Influence of Polysaccharide Krestin from Coriolus versicolor Extract on Nitrite and Malondialdehyde Concencentrations of Mus musculus Serum Exposed by Mycobacterium tuberculosis

Directory of Open Access Journals (Sweden)

Sri Puji Astuti Wahyuningsih

2016-03-01

Full Text Available Mycobacterium tuberculosis is a major infection agent of tuberculosis that is controlled by the response of cell-mediated immunity. It is macrophages and cytolytic T lymphocytes. Activated macrophages will produce free radicals. Excessive free radicals cause tissue damage. Polysaccharide krestin contains β-glucan. It is a scavenger of free radicals. This research aimed to identify the influence of polysaccharide krestin from C. versicolor on nitrite and malondialdehyde concentrations of mice serum exposed by M. tuberculosis. Nitrite concentration was determined by nitrite assay. Malondialdehyde concentration was determined by TBARS assay. The result showed that adding polysaccharide krestin before exposure (P1 and adding polysaccharide krestin before-after exposure (P3 had the best potential to decrease nitrite concentration. Nitrite concentrations of P1 and P3 were 1.364 ± 0.523 M and 1.456 ± 0.712 M respectively. Meanwhile, P1 group and adding polysaccharide krestin after exposure (P2 had the best potential to decrease malondialdehyde concentration. Malondialdehyde concentrations of P1 and P2 were 1125.86 ± 97.96 µM and 953.86 ± 328.16 µM respectively. Their nitrite and malondialdehyde concentrations decreased, compared to K and K- groups. The research conclusion was that adding polysaccharide krestin before exposure could decrease both nitrite and malondialdehyde concentrations.How to CiteWahyuningsih, S., Pramudya, M., & Sugiharto, S. (2016. Influence of Polysaccharide Krestin from Coriolus versicolor Extract on Nitrite and Malondialdehyde Concencentrations of Mus musculus Serum Exposed by Mycobacterium tuberculosis. Biosaintifika: Journal of Biology & Biology Education, 8(1, 12-17.

Curcumin Is Efective In Improving Folliculogenesis Profile And Oo-cytes Quality In Vitro In Ectopic Endometriosis Mouse (Mus muscu-lus Models

Directory of Open Access Journals (Sweden)

Aulia Firmawati

2018-02-01

Full Text Available Endometriosis is the presence of ectopic endometrial tissue, such as that outside the uter-ine cavity, which can cause chronic inflammatory reactions. Curcumin is one of traditional herbal med-icines that is widely used. Some experiments have managed to find a mechanism to treat an ectopic endometriosis through the mechanism of suppression of several cytokines such as TNF-alpha, NF-kB and COX-2, this study was an experimental laboratory study, with five treatments and six replications, using female mice (Mus musculus that had reached puberty. The study consisted of three phases: the first phase was the microscopic examination of in vitro oocytes quality, and the second was histopatho-logical examination of folliculogenesis profile using Hematoxillin eosin staining, the results of this study showed significant difference between positive control group (P0 with treatment and negative control (KN groups in folliculogenesis profile (p <0.05. Examination of in vitro oocytes quality showed sig-nificant difference between positive control group with treatment group and negative control group (p <0.05. Curcumin has several roles in cytokines modulation in ectopic endometriosis mouse models. Curcumin may reduce the occurrence of apoptosis of granulosa cells so that it may directly improve oocyte quality and folliculogenesis profile, in conclusion, curcumin effectively overcomes fertility prob-lems through the mechanism of cytokines modulation that plays a role in some cases of endometriosis such as: TNF-alpha, NF-kB and COX-2. Curcumin may improve folliculogenesis profile and in vitro oocytes quality.

WOUND HEALING ACTIVITY OF UNGUENTUM DOSAGE FORM OF ETHANOLIC EXTRACTS OF Areca catechu L. NUT IN Mus musculus albinus

Directory of Open Access Journals (Sweden)

Azizah Vonna

2015-10-01

Full Text Available The activity test of ethanol extract of betel nut ointment (Areca catechu L. in wound healing on mice (Mus musculus albinus has been carried out to determine the ability of the ethanol extract of betel nut ointment in wound healing and determine the concentration which was accelerate the wound healing on mice between 2 concentrations. This experimental research method used completely randomized design (CRD using 20 mices divided into 4 treatment groups ; ointment base, povidone iodine ointment, ethanol extract of betel nut ointment (SEEBP 2% and SEEBP 4%. Each treatment groups was tested in the incision which was made along the 15 mm parallel to the spine (Os. Vetebre with the depth until subcutaneous skin layers. The ointment was applied twice a day for about 21 days and observed changes every day for during the period of observation. The results showed that the average length of time of the scab formation, the scab exfoliation, and the wound healing successively are for the ointment base was 6.6; 10.2 and 18.2 days, povidone iodine ointment was 7; 11.2 and 14.8 days, SEEBP 2% was 5.75; 7.75 and 13.25 days, SEEBP 4% was 4.2; 8.8 and 12.8 days. ANOVA and LSD results of scab formation time showed a significant difference between SEEBP 4% with base ointment and povidone iodine ointment (p <0.05. Results of the exfoliation scab showed a significance difference between SEEBP 2% with base ointment and povidone iodine ointment (p <0.05. The duration of wound healing showed that there was significance difference between SEEBP 2%, SEBP 4% and povidone iodine ointment with ointment base  (p<0.05.Thus, betel nut ointment as an effect on healing process. The concentration which can accelerate wound healing in mice is SEEBP 4%.

Age-Related Changes in Locomotor Performance Reveal a Similar Pattern for Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens.

Science.gov (United States)

Marck, Adrien; Berthelot, Geoffroy; Foulonneau, Vincent; Marc, Andy; Antero-Jacquemin, Juliana; Noirez, Philippe; Bronikowski, Anne M; Morgan, Theodore J; Garland, Theodore; Carter, Patrick A; Hersen, Pascal; Di Meglio, Jean-Marc; Toussaint, Jean-François

2017-04-01

Locomotion is one of the major physiological functions for most animals. Previous studies have described aging mechanisms linked to locomotor performance among different species. However, the precise dynamics of these age-related changes, and their interactions with development and senescence, are largely unknown. Here, we use the same conceptual framework to describe locomotor performances in Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens. We show that locomotion is a consistent biomarker of age-related changes, with an asymmetrical pattern throughout life, regardless of the type of effort or its duration. However, there is variation (i) among species for the same mode of locomotion, (ii) within species for different modes of locomotion, and (iii) among individuals of the same species for the same mode of locomotion. Age-related patterns are modulated by genetic (such as selective breeding) as well as environmental conditions (such as temperature). However, in all cases, the intersection of the rising developmental phase and the declining senescent phase reveals neither a sharp transition nor a plateau, but a smooth transition, emphasizing a crucial moment: the age at peak performance. This transition may define a specific target for future investigations on the dynamics of such biological interactions. © The Author 2016. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Dicty_cDB: Contig-U10011-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 38 0.082 2 ( AC018940 ) Homo sapiens clone RP11-22A2, WORKING DRAFT SEQUE... 44 0.088 3 ( EJ460859 ) 1093018538988 Global-Ocean-Sampl...in family member 1; AltName: Ful... 72 3e-11 ( Q92738 ) RecName: Full=USP6 N-terminal-like protein; AltName:...chromos... 68 4e-10 BC051184_1( BC051184 |pid:none) Mus musculus USP6 N-terminal li...ke,... 68 4e-10 (A6H8I2) RecName: Full=Small G protein signaling modulator 3 hom... 68 4e-10 (Q80XC3) RecName: Full=USP6 N-term...Plasmodium berghei cDNA clone:LV000110, liver sta... 38 0.33 2 ( AC006287 ) Homo sapiens, clone hRPK.22_A_1, compl

NCBI nr-aa BLAST: CBRC-OPRI-01-1437 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1437 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blind...Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan) [Mus mu...sculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) [Mus musculus] gb|EDL13781.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 1e-162 81% ...

NCBI nr-aa BLAST: CBRC-MDOM-08-0120 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0120 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness...Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan) [Mus mu...sculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness..., tritan) [Mus musculus] gb|EDL13781.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 0.0 87% ...

NCBI nr-aa BLAST: CBRC-VPAC-01-1432 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1432 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness...Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan) [Mus mu...sculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness..., tritan) [Mus musculus] gb|EDL13781.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 0.0 85% ...

NCBI nr-aa BLAST: CBRC-MEUG-01-2797 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2797 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness...Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan) [Mus mu...sculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness..., tritan) [Mus musculus] gb|EDL13781.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 0.0 86% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-0695 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0695 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness...Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan) [Mus mu...sculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness..., tritan) [Mus musculus] gb|EDL13781.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 1e-145 80% ...

NCBI nr-aa BLAST: CBRC-MMUS-04-0013 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-04-0013 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-PTRO-07-0067 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-07-0067 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-RMAC-04-0050 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-04-0050 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-CFAM-12-0016 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-12-0016 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0845 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-FRUB-02-0074 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0074 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TBEL-01-1883 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1883 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-LAFR-01-1734 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-1734 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TNIG-10-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-10-0006 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-OCUN-01-1522 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1522 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-FCAT-01-1020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-1020 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-GACU-18-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-18-0022 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-CJAC-01-1332 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1332 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TNIG-14-0023 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-14-0023 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

Characterization of Steroid Receptor RNA Activator Protein Function in Modulating the Estrogen Signaling Pathway

Science.gov (United States)

2008-03-01

two opposite directions. Material and methods Alignment of SRAP sequences: Putative SRAP sequence from Homo sapiens , Bos Taurus, Mus musculus...0.5 1 1.5 2 control IP IP +V5 competition R el at iv e H D A C a ct iv ity IP IP + V5 * MCF-7cont MCF-7 SRAP-V5 High.A cells Fig 7 Appendix 5...1 0 1 2 3 PRO WT NONE RNA UT D el ta C T ** A B C Figure 4: SRAP down regulates the ERbeta expression in mRNA level. A) Four plenti-SRA constructs

Dicty_cDB: AFI409 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available BC077988 |pid:none) Xenopus laevis achalasia, adrenoco... 103 2e-20 AK088247_1( AK088247 |pid:none) Mus musc...ulus 2 days neonate thymus... 95 5e-18 BC067671_1( BC067671 |pid:none) Danio rerio achalasia, adrenocorti......1 7e-17 AK222509_1( AK222509 |pid:none) Homo sapiens mRNA for achalasia, a... 91 7e-17 (Q9NRG9) RecName: Ful...20826 fis, cl... 91 1e-16 BC120418_1( BC120418 |pid:none) Bos taurus achalasia, adrenocortic... 91 1e-16 BT0

Genetic structure and invasion history of the house mouse (Mus musculus domesticus) in Senegal, West Africa: a legacy of colonial and contemporary times.

Science.gov (United States)

Lippens, C; Estoup, A; Hima, M K; Loiseau, A; Tatard, C; Dalecky, A; Bâ, K; Kane, M; Diallo, M; Sow, A; Niang, Y; Piry, S; Berthier, K; Leblois, R; Duplantier, J-M; Brouat, C

2017-08-01

Knowledge of the genetic make-up and demographic history of invasive populations is critical to understand invasion mechanisms. Commensal rodents are ideal models to study whether complex invasion histories are typical of introductions involving human activities. The house mouse Mus musculus domesticus is a major invasive synanthropic rodent originating from South-West Asia. It has been largely studied in Europe and on several remote islands, but the genetic structure and invasion history of this taxon have been little investigated in several continental areas, including West Africa. In this study, we focussed on invasive populations of M. m. domesticus in Senegal. In this focal area for European settlers, the distribution area and invasion spread of the house mouse is documented by decades of data on commensal rodent communities. Genetic variation at one mitochondrial locus and 16 nuclear microsatellite markers was analysed from individuals sampled in 36 sites distributed across the country. A combination of phylogeographic and population genetics methods showed that there was a single introduction event on the northern coast of Senegal, from an exogenous (probably West European) source, followed by a secondary introduction from northern Senegal into a coastal site further south. The geographic locations of these introduction sites were consistent with the colonial history of Senegal. Overall, the marked microsatellite genetic structure observed in Senegal, even between sites located close together, revealed a complex interplay of different demographic processes occurring during house mouse spatial expansion, including sequential founder effects and stratified dispersal due to human transport along major roads.

A candidate subspecies discrimination system involving a vomeronasal receptor gene with different alleles fixed in M. m. domesticus and M. m. musculus.

Directory of Open Access Journals (Sweden)

Robert C Karn

2010-09-01

Full Text Available Assortative mating, a potentially efficient prezygotic reproductive barrier, may prevent loss of genetic potential by avoiding the production of unfit hybrids (i.e., because of hybrid infertility or hybrid breakdown that occur at regions of secondary contact between incipient species. In the case of the mouse hybrid zone, where two subspecies of Mus musculus (M. m. domesticus and M. m. musculus meet and exchange genes to a limited extent, assortative mating requires a means of subspecies recognition. We based the work reported here on the hypothesis that, if there is a pheromone sufficiently diverged between M. m. domesticus and M. m. musculus to mediate subspecies recognition, then that process must also require a specific receptor(s, also sufficiently diverged between the subspecies, to receive the signal and elicit an assortative mating response. We studied the mouse V1R genes, which encode a large family of receptors in the vomeronasal organ (VNO, by screening Perlegen SNP data and identified one, Vmn1r67, with 24 fixed SNP differences most of which (15/24 are nonsynonymous nucleotide substitutions between M. m. domesticus and M. m. musculus. We observed substantial linkage disequilibrium (LD between Vmn1r67 and Abpa27, a mouse salivary androgen-binding protein gene that encodes a proteinaceous pheromone (ABP capable of mediating assortative mating, perhaps in conjunction with its bound small lipophilic ligand. The LD we observed is likely a case of association rather than residual physical linkage from a very recent selective sweep, because an intervening gene, Vmn1r71, shows significant intra(subspecific polymorphism but no inter(subspecific divergence in its nucleotide sequence. We discuss alternative explanations of these observations, for example that Abpa27 and Vmn1r67 are coevolving as signal and receptor to reinforce subspecies hybridization barriers or that the unusually divergent Vmn1r67 allele was not a product of fast positive

The regeneration of thermal wound on mice skin (Mus Musculus) after Q-Switch Nd: YAG laser irradiation for cancer therapy candidate

Science.gov (United States)

Apsari, R.; Nahdliyatun, E.; Winarni, D.

2017-09-01

The aims of this study are to investigate the regeneration of mice skin tissue (Mus Musculus) irradiated by Q-Switch Nd: YAG laser and morphological change due to Q-Switch Nd: YAG laser irradiation compared to conventional heating (hairdryer). The 2-3 month of twenty-seven mice were used for experimental animals. Mice were incised in the dorsum by the damage effect of laser energy dose (therapeutic dose) of 29.5 J/cm2 with 10 seconds of exposure time, 10 Hz of repetition rate, and 100 pulses of the given single pulse energy. The mice skin tissue was injuried by hairdryer to get burned effect. Mice were divided into three groups, Group I (control) were not treated by anything, Group II were treated by Q-Switch Nd: YAG laser irradiation and sacrificed on (0, 1, 3, 5) days, and Group III were treated by hairdryer then sacrificed on (0, 1, 3, 5) days. Pathology examination showed that the energy of 29,5 J/cm2 dose produced the hole effect (ablation) through the hypodermic layer caused by optical breakdown and collagen coagulation. Thus, the 60 °C temperature of burn showed coagulation necrosis because piknosis discovered in the injured area. The regeneration process showed that the mice skin tissue's ability to regenerate was irradiated by fast laser because of the focus of Q-Switch Nd: YAG laser. It was showed by the scab releases on third day and completely reepithelialization formation on the fifth day. The collagen fibers distribution was same as normal skin tissue on day 5 and so did angiogenesis. Therefore, Q-Switch Nd: YAG laser can be applied for problems of dermatology medical therapies, especially melasma, nevus of ota and tatto therapy. For skin cancer therapy application, energy dose of unregenerated skin tissue is chosen because the death expected effect is permanent.

NCBI nr-aa BLAST: CBRC-MMUS-06-0131 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0131 ref|NP_444459.1| vomeronasal 1 receptor, B8 [Mus musculus] sp|Q9EQ45|VN1B8_MOUSE Vomeronas...al type-1 receptor B8 (Vomeronasal type-1 receptor A13) gb|AAG42088.1|AF291494_1 vomeronasa...l receptor V1RB8 [Mus musculus] dbj|BAB79220.1| vomeronasal receptor 1 A13 [Mus musculus] gb|AAI40252.1| Vomeronasa...l 1 receptor, B8 [synthetic construct] gb|EDK99274.1| vomeronasal ...1 receptor, B8 [Mus musculus] gb|AAI46525.1| Vomeronasal 1 receptor, B8 [synthetic construct] NP_444459.1 1e-175 100% ...

DEFINIENDO HOMO SAPIENS-SAPIENS: APROXIMACIÓN ANTROPOLÓGICA DEFININDO HOMO SAPIENS-SAPIENS: APROXIMAÇÃO ANTROPOLÓGICA DEFINING HOMO SAPIENS-SAPIENS: ANTHROPOLOGICAL APPROACH

OpenAIRE

Carolina Valdebenito

2007-01-01

Este artículo reflexiona sobre los encuentros y desencuentros entre el ser humano y el resto de los animales, en tanto miembros de sistemas en permanente interacción(1). Abordar la definición de Homo, repasar su evolución biológica y cultural y reflexionar sobre los resabios de animalidad que quedan en el comportamiento social del Homo sapiens-sapiens es su objetivo principal. Se busca reflexionar sobre los dilemas morales que acompañan al hombre en tanto ser cultural; para ello se analizan d...

Gene : CBRC-MMUS-06-0060 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0060 6 A Pheromone receptors V1A16_RAT 2e-54 41% ref|NP_598937.1| vomeronasa...l 1 receptor, C21 [Mus musculus] gb|AAL47882.1| vomeronasal receptor V1RC21 [Mus musculus] gb|AAI32387.1| Vomeronasa...-length enriched library, clone:C230065D10 product:similar to VOMERONASAL RECEPTOR V1RC3 [Mus musculus], ful

The Effect of Calcusol™ to the Plasma Free Radical and Serum Creatinin in Mus Musculus Nephrolithiasis Model

Directory of Open Access Journals (Sweden)

A’liyatur Rosyidah

2013-09-01

Full Text Available Calcusol™ is a traditional medicine (jamu made from Tempuyung (Sonchus arvensis extract and is usually used for cure kidney stone disease. However, there has not been any studies which investigate the its mechanism. The aim of this study is to know the effect of Calcusol™ to the plasma free radical and serum creatinin of Mus musculus model for renal calcium-oxalate accumulation. This study is carried out by administration of Porang (Amorphophallus muelleri tuber flour for 3 months with the doses 6 mg/100g BW to induce renal calcium oxalate accumulation and Calcusol™ treatment for 7 days with the doses of 3.3mg/g BW. Group I was used as a control group. Group II was only given porang every day for 3 months. Group III was only given Calcusol™ for 7 days. Group IV were given porang for 3 months then given Calcusol™ for 7 days. Group V were given porang and Calcusol™ simultaneously for 3 months. Porang and CalcusolTM is administrated orally. Blood was collected from the tail of the animal for serum creatinin test and plasma free radical test using TBARS method. The data was analyzed using ANOVA followed by Tukey HSD to compare the means employing SPSS 16.0 for windows. The result of the research shows that the treatment Calcusol™ on mice model for renal calcium oxalate accumulation. The content of MDA at group I, group II, group III, group IV and group V, respectivelyis 0.81±0.5 mg/ml; 2.63±0.8 mg/ml; 0.56±0.5 mg/ml; 2.09±0.9 mg/ml and 0.17±0.17 mg/ml. The content of serum creatinine are 0.15±0.04 mg/dL; 0.13±0.03 mg/dL; 0.12±0.08 mg/dL; 0.11±0.016 mg/dL and 0.14±0.015 mg/dL at group I, group II, group III, Group IV, and group V respectively. This indicates that Calcusol™ decreases plasma free radical production during renal stone formation, while serum creatinin reduced but not significantly changed. Calcusol™ has an effect to decrease free radical during renalstone formation inmice model for calcium oxalate accumulation

Evidencias empíricas de regularidades estadísticas y leyes de potencia en los genomas de Arabidopsis thaliana, Oriza sativa y Mus musculus Empirical evidences of statistical regularities and power laws in the genomes of Arabidopsis thaliana, Oriza sativa and Mus musculus

Directory of Open Access Journals (Sweden)

Martha I Almanza P.

2010-07-01

Full Text Available La masiva cantidad de datos biológicos provenientes de las disciplinas "ómicas" y su aprovechamiento en el mejoramiento genético vegetal requiere de nuevos abordajes teóricos y estadísticos que describan de forma satisfactoria principios generales en los genomas. El total de secuencias de los genes de los genomas vegetales de Arabidopsis thaliana y Oriza sativa y del genoma animal Mus musculus fueron extraídas y depuradas de la base de datos pública del Genebank mediante el diseño de algoritmos en lenguaje de programación Python. Se analizaron las distribuciones de las variables frecuencia de uso y tamaño de los genes, exones e intrones por cromosoma y entre genomas. Los resultados señalaron que las variables presentan patrones de comportamiento no lineales en forma de ley de potencia que difieren estadísticamente entre los genomas pero no entre los cromosomas de un mismo genoma. Además, el análisis aportó evidencias respecto al tamaño promedio constante de las secuencias de exones y de los genes simples por cromosoma y entre genomas. Los hallazgos sugieren: primero, que el genoma se auto-organiza de la misma manera en los cromosomas independientemente del tamaño o número de genes que estos contengan, y, segundo, que tanto los cromosomas como sus elementos constituyentes: genes, exones e intrones han evolucionado conjuntamente. El estudio señala que las leyes de potencia cumplen un papel amortiguador en las leyes de variación biológica y proporcionan medidas cuantitativas de la organización de las secuencias de ADN que definen la identidad de un genoma. La regularidad estadística de estas medidas genéticas tiene potenciales aplicaciones en el incremento del valor predictivo de los actuales modelos de mejoramiento genético vegetal.The huge quantity of biological data arising from the omics disciplines and their benefit in plant breeding require of new theoretical and statistical approaches in order to get a satisfactory

Where are the wormy mice? A re-examination of hybrid parasitism in the European house mouse hybrid zone

Czech Academy of Sciences Publication Activity Database

Baird, Stuart J. E.; Ribas, Alexis; Macholán, Miloš; Albrecht, Tomáš; Piálek, Jaroslav; Goüy de Bellocq, Joëlle

2012-01-01

Roč. 66, č. 9 (2012), s. 2757-2772 ISSN 0014-3820 R&D Projects: GA ČR GA206/08/0640 Institutional support : RVO:68081766 ; RVO:67985904 Keywords : helminths * Mus musculus domesticus * Mus musculus musculus * resistance * immune gene transitive compatibility Subject RIV: EG - Zoology Impact factor: 4.864, year: 2012

Food habits of introduced rodents in high-elevation shrubland of Haleakala National Park, Maui, Hawai'i

Science.gov (United States)

Cole, F. Russell; Loope, Lloyd L.; Medeiros, Arthur C.; Howe, Cameron E.; Anderson, Laurel J.

2000-01-01

Mus musculus and Rattus rattus are ubiquitous consumers in the high-elevation shrubland of Haleakala National Park. Food habits of these two rodent species were determined from stomach samples obtained by snaptrapping along transects located at four different elevations during November 1984 and February, May, and August 1985. Mus musculus fed primarily on fruits, grass seeds, and arthropods. Rattus rattus ate various fruits, dicot leaves, and arthropods. Arthropods, many of which are endemic, were taken frequently by Mus musculus throughout the year at the highest elevation where plant food resources were scarce. Araneida, Lepidoptera (primarily larvae), Coleoptera, and Homoptera were the main arthropod taxa taken. These rodents, particularly Mus musculus, exert strong predation pressure on populations of arthropod species, including locally endemic species on upper Haleakala Volcano.

NCBI nr-aa BLAST: CBRC-MMUS-06-0014 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0014 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blind... pigment gb|AAB53320.1| blue cone pigment [Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) [Mus musculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blind...s), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 0.0 100% ...

NCBI nr-aa BLAST: CBRC-BTAU-01-2837 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-2837 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness... pigment gb|AAB53320.1| blue cone pigment [Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindnes...s, tritan) [Mus musculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness...s), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 0.0 86% ...

NCBI nr-aa BLAST: CBRC-OGAR-01-1096 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OGAR-01-1096 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness... pigment gb|AAB53320.1| blue cone pigment [Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindnes...s, tritan) [Mus musculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness...s), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 1e-105 63% ...

NCBI nr-aa BLAST: CBRC-LAFR-01-3136 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-3136 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness... pigment gb|AAB53320.1| blue cone pigment [Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindnes...s, tritan) [Mus musculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness...s), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 1e-152 85% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0072 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0072 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness... pigment gb|AAB53320.1| blue cone pigment [Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindnes...s, tritan) [Mus musculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness...s), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 0.0 95% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-1188 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1188 ref|NP_031564.1| opsin 1 (cone pigments), short-wave-sensitive (color blindness... pigment gb|AAB53320.1| blue cone pigment [Mus musculus] gb|AAH26021.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindnes...s, tritan) [Mus musculus] gb|AAH58267.1| Opsin 1 (cone pigments), short-wave-sensitive (color blindness...s), short-wave-sensitive (color blindness, tritan), isoform CRA_a [Mus musculus] NP_031564.1 1e-151 75% ...

A comparison of tooth structure in Neanderthals and early Homo sapiens sapiens: a radiographic study.

OpenAIRE

Zilberman, U; Smith, P

1992-01-01

Tooth components of 1st and 2nd erupted permanent molars were measured from standardised radiographs of Homo sapiens sapiens and Homo sapiens neanderthalensis. Enamel height was greater in Homo sapiens sapiens but pulp height and width and the height of the enamel to floor of the pulp chamber were greater in Homo sapiens neanderthalensis. Dentine height, crown width and enamel width showed similar results in the two groups. Unerupted first molars were measured to analyse the influence of func...

AcEST: DK950322 [AcEST

Lifescience Database Archive (English)

Full Text Available 19 OS=Mus mus... 34 0.62 >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms...YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms...ith multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 87.0 bits (214), Expect = 8

Presencia de los géneros invasores Mus y Rattus en áreas naturales de Chile: un riesgo ambiental y epidemiológico Presence of the invasive genera Mus and Rattus in natural areas in Chile: an environmental and epidemiological risk

Directory of Open Access Journals (Sweden)

GABRIEL LOBOS

2005-03-01

Full Text Available Realizamos un estudio que incluyó muestreos y prospecciones en un gradiente latitudinal en Chile continental para determinar la presencia y ausencia de roedores murinos introducidos, particularmente Mus musculus, Rattus rattus y R. norvegicus en áreas naturales o silvestres a lo largo de Chile. Además se analizó el riesgo epidemiológico que representan estas especies en el marco de un estudio sobre el virus Hanta. Los resultados mostraron que M. musculus rara vez es recolectado en áreas naturales. Sin embargo, las dos especies de Rattus han invadido ampliamente la región mediterránea chilena. Las regiones desérticas, los ambientes de alturas y las regiones australes, serían biótopos restringidos para estos invasores. Desde una perspectiva epidemiológica, la presencia del virus Hanta (variedades Andes y Seoul en Rattus es un elemento que demuestra que las especies invasoras además de generar impactos ecológicos, pueden ocasionar problemas económicos y de salud pública. La fragilidad de los ecosistemas mediterráneos determina que la presencia de especies exóticas constituya un elemento de alto riesgo para la conservación del patrimonio natural del país. Probablemente, la conservación de áreas naturales constituye la mejor herramienta para enfrentar a estas especies exóticasWe conducted a latitudinal study in natural areas of continental Chile to evaluate the occurrence of the introduced murine rodents Mus musculus, Rattus rattus and R. norvegicus. Furthermore, we evaluated the epidemiological risk of these species as part of an ongoing study on Hantavirus. The results allowed us to conclude that M. musculus occurs rarely in natural environments. However, the two species of Rattus have widely invaded the mediterranean region of Chile. Desert, altitudinal and high latitude regions seem to be restricted areas for these invasive rodents. From an epidemiological perspective, the occurrence of Hantavirus in Rattus (Andes and Seoul

Effect of bovine pellucid zone 3 monoclonal antibodies on B cell lymphoma 2 expressions of granulosa cell and mice (Mus musculus follicle diameter

Directory of Open Access Journals (Sweden)

Heti Ira Ayue

2017-01-01

Full Text Available Objective: To evaluate the effects of pellucid zone 3 monoclonal antibodies against B-cell lymphoma 2 (BCL-2 expression and mice follicle diameter at various time periods.Methods: The animal model of this study was 36 Balb/c mice (Mus musculus. A true experimental design was used with a post-test only control group approach. BCL-2 expression was observed using immunohistochemistry, while the follicle diameter was observed by haematoxylin-eosin staining. The data was analyzed using nested ANOVA to compare the results of the mean expression of BCL-2 on the 5th and 20th day of observation in the pre-antral and antral follicle between the control and treatment groups.Results: No significant differences were found in BCL-2 gene expression. There were also no significant differences in BCL-2 expression on the 10th day of pre-antral follicle analysis. Moreover, there were no significant differences between the mean follicle diameter on the 5th, 10th, and 20th day of pre-antral and antral follicle development between the control and treatment groups. The addition of bovine pellucid zone 3 (bZP3 monoclonal antibodies on the 5th and 20th day of observation did not decrease the expression of BCL-2 gene in the pre-antral and antral follicle of mice. Administering bZP3 monoclonal antibodies on the 10th day of observation did not affect BCL-2 expression in the pre-antral follicle but did decrease BCL-2 expression in the antral follicle. Supplying bZP3 monoclonal antibodies on the 5th, 10th and 20th day did not affect the diameter of pre-antral and antral follicles of the mice.Conclusion: The monoclonal antibodies bovine zona pelusida 3 has the potential to be developed as a safe immunocontraception preparation.

Maternal-foetal genomic conflict and speciation: no evidence for hybrid placental dysplasia in crosses between two house mouse subspecies

Czech Academy of Sciences Publication Activity Database

Kropáčková, L.; Piálek, Jaroslav; Gergelits, Václav; Forejt, Jiří; Reifová, R.

2015-01-01

Roč. 28, č. 3 (2015), s. 688-698 ISSN 1010-061X R&D Projects: GA ČR GA13-08078S Institutional support: RVO:68081766 ; RVO:68378050 Keywords : hybrid placental dysplasia * genomic conflicts * speciation * X chromosome * house mouse * Mus musculus musculus * Mus musculus domesticus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.747, year: 2015

The mouse hybrid zone in Central Europe: from morphology to molecules

Czech Academy of Sciences Publication Activity Database

Ďureje, Ľudovít; Macholán, Miloš; Baird, Stuart J. E.; Piálek, Jaroslav

2012-01-01

Roč. 61, 3-4 (2012), s. 308-318 ISSN 0139-7893 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : geography * introgression * mtDNA * Mus musculus musculus * Mus musculus domesticus * X chromosome * Y chromosome Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 0.494, year: 2012

NCBI nr-aa BLAST: CBRC-RNOR-04-0256 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0256 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0238 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-MMUS-06-0122 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0122 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-OCUN-01-1141 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1141 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0135 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0259 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

IMGT/GeneInfo: T cell receptor gamma TRG and delta TRD genes in database give access to all TR potential V(D)J recombinations

Science.gov (United States)

Baum, Thierry-Pascal; Hierle, Vivien; Pasqual, Nicolas; Bellahcene, Fatena; Chaume, Denys; Lefranc, Marie-Paule; Jouvin-Marche, Evelyne; Marche, Patrice Noël; Demongeot, Jacques

2006-01-01

Background Adaptative immune repertoire diversity in vertebrate species is generated by recombination of variable (V), diversity (D) and joining (J) genes in the immunoglobulin (IG) loci of B lymphocytes and in the T cell receptor (TR) loci of T lymphocytes. These V-J and V-D-J gene rearrangements at the DNA level involve recombination signal sequences (RSS). Whereas many data exist, they are scattered in non specialized resources with different nomenclatures (eg. flat files) and are difficult to extract. Description IMGT/GeneInfo is an online information system that provides, through a user-friendly interface, exhaustive information resulting from the complex mechanisms of T cell receptor V-J and V-D-J recombinations. T cells comprise two populations which express the αβ and γδ TR, respectively. The first version of the system dealt with the Homo sapiens and Mus musculus TRA and TRB loci whose gene rearrangements allow the synthesis of the αβ TR chains. In this paper, we present the second version of IMGT/GeneInfo where we complete the database for the Homo sapiens and Mus musculus TRG and TRD loci along with the introduction of a quality control procedure for existing and new data. We also include new functionalities to the four loci analysis, giving, to date, a very informative tool which allows to work on V(D)J genes of all TR loci in both human and mouse species. IMGT/GeneInfo provides more than 59,000 rearrangement combinations with a full gene description which is freely available at . Conclusion IMGT/GeneInfo allows all TR information sequences to be in the same spot, and are now available within two computer-mouse clicks. This is useful for biologists and bioinformaticians for the study of T lymphocyte V(D)J gene rearrangements and their applications in immune response analysis. PMID:16640788

ORF Alignment: NC_003103 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available s] ref|NP_766317.1| caspase recruitment domain 4 ... [Mus musculus] gb|AAH42670.1| Caspase recruitment... domain ... 4 [Mus musculus] sp|Q8BHB0|CARD4_MOUSE Caspase ... recruitment domain protein 4 d

Conduction Abnormalities and Pacemaker Implantations After SAPIEN 3 Vs SAPIEN XT Prosthesis Aortic Valve Implantation.

Science.gov (United States)

Husser, Oliver; Kessler, Thorsten; Burgdorf, Christof; Templin, Christian; Pellegrini, Costanza; Schneider, Simon; Kasel, Albert Markus; Kastrati, Adnan; Schunkert, Heribert; Hengstenberg, Christian

2016-02-01

Transcatheter aortic valve implantation is increasingly used in patients with aortic stenosis. Post-procedural intraventricular conduction abnormalities and permanent pacemaker implantations remain a serious concern. Recently, the Edwards SAPIEN 3 prosthesis has replaced the SAPIEN XT. We sought to determine the incidences of new-onset intraventricular conduction abnormalities and permanent pacemaker implantations by comparing the 2 devices. We analyzed the last consecutive 103 patients undergoing transcatheter aortic valve implantation with SAPIEN XT before SAPIEN 3 was used in the next 105 patients. To analyze permanent pacemaker implantations and new-onset intraventricular conduction abnormalities, patients with these conditions at baseline were excluded. Electrocardiograms were recorded at baseline, after the procedure, and before discharge. SAPIEN 3 was associated with higher device success (100% vs 92%; P=.005) and less paravalvular leakage (0% vs 7%; Ppacemaker implantations was 12.6% (23 of 183) with no difference between the 2 groups (SAPIEN 3: 12.5% [12 of 96] vs SAPIEN XT: 12.6% [11 of 87]; P=.99). SAPIEN 3 was associated with a higher rate of new-onset intraventricular conduction abnormalities (49% vs 27%; P=.007) due to a higher rate of fascicular blocks (17% vs 5%; P=.021). There was no statistically significant difference in transient (29% [20 of 69] vs persistent 19% [12 of 64]; P=.168) left bundle branch blocks (28% [19 of 69] vs 17% [11 of 64]; P=.154) when SAPIEN 3 was compared with SAPIEN XT. We found a trend toward a higher rate of new-onset intraventricular conduction abnormalities with SAPIEN 3 compared with SAPIEN XT, although this did not result in a higher permanent pacemaker implantation rate. Copyright © 2015 Sociedad Española de Cardiología. Published by Elsevier España, S.L.U. All rights reserved.

Is water really a barrier for the house mouse? A comparative study of two mouse subspecies

Czech Academy of Sciences Publication Activity Database

Hiadlovská, Zuzana; Strnadová, Markéta; Macholán, Miloš; Vošlajerová Bímová, Barbora

2012-01-01

Roč. 61, 3-4 (2012), s. 319-329 ISSN 0139-7893 R&D Projects: GA ČR GA206/08/0640; GA ČR GAP506/11/1792 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : dispersal * Mus musculus domesticus * Mus musculus musculus * swimming * water barrier Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 0.494, year: 2012

Dicty_cDB: Contig-U15590-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -20 CT005272_460( CT005272 |pid:none) Leishmania major strain Friedlin... 85 7e-20 S37963( S37963 ;S47957) mitochondrial intermed...D6) RecName: Full=Mitochondrial intermediate peptidase; ... 89 5e-34 CP000964_2806( CP000964 |pid:none) Klebsie... U80034_1( U80034 |pid:none) Homo sapiens mitochondrial intermediat... 93 4e-31 AY075581_1( AY075581 |pid:no...95 2e-17 AK050120_1( AK050120 |pid:none) Mus musculus adult male liver tumo... 91 3e-16 (Q753X4) RecName: Full=Mitochondrial interm... (A7TSL2) RecName: Full=Mitochondrial intermediate peptidase; ... 101 3e-34 (Q6CH

NCBI nr-aa BLAST: CBRC-STRI-01-1973 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1973 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9E...Q46|VN1B7_MOUSE RecName: Full=Vomeronasal type-1 receptor B7; AltName: Full=Vomeronasal type-1 receptor A11 ...gb|AAG42087.1|AF291493_1 vomeronasal receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A1...1 [Mus musculus] gb|AAI41627.1| Vomeronasal 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-1277 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1277 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2495 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2495 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2240 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2240 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2627 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2627 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

A Comparison of mucosal surface area and villous histology in small intestines of the Brazilian free-tailed bat (Tadarida brasiliensis) and the mouse (Mus musculus).

Science.gov (United States)

Zhang, Zhi-Qiang; Brun, Antonio; Price, Edwin R; Cruz-Neto, Ariovaldo P; Karasov, William H; Caviedes-Vidal, Enrique

2015-01-01

Studies on birds have led to the hypothesis that increased intestinal absorption between enterocytes (paracellular) evolved as a compensation for smaller intestinal size in fliers, which was perhaps selected to minimize the mass of digesta carried. This hypothesis predicts that bats will also exhibit relatively reduced intestinal size and high paracellular absorption, compared with nonflying mammals. Published studies on three bat species indicate relatively high paracellular absorption. One mechanism for increasing paracellular absorption per cm2 small intestine (SI) is increased number of tight junctions (TJs) across which paracellular absorption occurs. To our knowledge, we provide the first comparative analysis of enterocyte size and number in flying and nonflying mammals. Intestines of insectivorous bats Tadarida brasiliensis were compared with Mus musculus using hematoxylin and eosin staining method. Bats had shorter and narrower SIs than mice, and after correction for body size difference by normalizing to mass3/4, the bats had 40% less nominal surface area than the mouse, as predicted. Villous enhancement of surface area was 90% greater in the bat than in the mouse, mainly because of longer villi and a greater density of villi in bat intestines. Bat and mouse were similar in enterocyte diameter. Bats exceeded mice by 54.4% in villous area per cm length SI and by 95% in number of enterocytes per cm2 of the nominal surface area of the SI. Therefore, an increased density of TJs per cm2 SI may be a mechanistic explanation that helps to understand the high paracellular absorption observed in bats compared to nonflying mammals. © 2014 Wiley Periodicals, Inc.

NCBI nr-aa BLAST: CBRC-TNIG-03-0019 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-03-0019 ref|NP_059087.2| solute carrier family 5 (inositol transporters),... member 3 [Mus musculus] gb|EDL03793.1| solute carrier family 5 (inositol transporters), member 3 [Mus musculus] NP_059087.2 1e-113 51% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0928 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0928 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 1e-81 52% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0428 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 2e-82 51% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-0933 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-0933 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 7e-78 52% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0143 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0143 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 4e-85 55% ...

Transgressive segregation in a behavioural trait? Explorative strategies in two house mouse subspecies and their hybrids

Czech Academy of Sciences Publication Activity Database

Hiadlovská, Zuzana; Vošlajerová Bímová, Barbora; Mikula, Ondřej; Piálek, Jaroslav; Macholán, Miloš

2013-01-01

Roč. 108, č. 1 (2013), s. 225-235 ISSN 0024-4066 R&D Projects: GA ČR GA206/08/0640; GA ČR GAP506/11/1792; GA AV ČR KJB600930701 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : dispersion * exploration * hybridization * Mus musculus domesticus * Mus musculus musculus * open field test Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 2.535, year: 2013

NCBI nr-aa BLAST: CBRC-MMUS-02-0385 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-02-0385 gb|AAK56078.1|AF332049_1 adrenergic receptor alpha 2B [Mus muscul...us] gb|AAA37131.1| alpha-2 adrenergic receptor gb|EDL28187.1| adrenergic receptor, alpha 2b [Mus musculus] AAK56078.1 0.0 99% ...

Helminth Infections of House Mouse (Mus musulus and Wood Mouse (Apodemus sylvaticus from the Suburban Areas of Hamadan City, Western Iran.

Directory of Open Access Journals (Sweden)

Ali Yousefi

2014-12-01

Full Text Available To determine the prevalence and intensity of helminths and their zoonotic importance in small rodents inhabiting in the suburban areas of Hamadan City, Iran.The present survey was conducted on the helminth infections of two species of rodents Apodemus sylvaticus (n=60 and Mus musculus(n=72 in the suburban areas of Hamadan City during 2010-2012. Rodents were collected and examined for helminth in the different organs. The nematodes were collected in 5% formalin solution and cleared in lactophenol, cestodes and trematodes collected from intestine fixed in AFA solution and stained by acetocarmine, cleared in xylol for identification.Helminths found in A. sylvaticus and M. musculus and their prevalence for the first time in suburban areas of Hamadan City were as follows; In A. sylvaticus: Cysticercus fasciolaris(3.33%, Syphacia fredrici(26.67%, S. stroma(8.33%, Anoplocephalidae sp. (1.67%, Skrjabinotaenia lobata(5%, Plagiorchis muris(1.67% and in M. musculus:Hymenolepis nana (16.67%, H.diminuta (5.55%, S. obvelata(30.56%, S. ohtarom (9.72%, Rodentolepis crassa (1.39%, C. fasciolaris (1.39%. Among 11 species in two rodents 4 species including S. obvelata, H. nana, H.diminuta,and P. muris have zoonotic importance. Statistically the relation between gender and their helminth infections was not significant in either M. musculus or A. sylvaticus (P>0.05.This study reports 11 species of helminths and on the other hand 3 species were identified for the first time in Iran and 5 species of them have potential health importance for public health and cat.

Tooth Morphogenesis and FGF4 Expression During Development of Molar Tooth in Three Muroid Rodents: Calomyscus elburzensis (Calomyscidae), Mesocricetus auratus (Cricetidae) and Mus musculus (Muridae).

Science.gov (United States)

Hamidi, Kordiyeh; Darvish, Jamshid; Matin, Maryam M; Javanmard, Athar Sadat; Kilpatrick, C William

2017-12-01

To date, no studies have examined the tooth formation during developmental stages of brush-tailed mice (Calomyscidae) and true hamsters (Cricetidae). Herein, we compared the timing of tooth morphogenesis and FGF4 expression pattern during development of the first lower molar in Goodwin's brush-tailed mouse, Calomyscus elburzensis with two other muroid rodents; the house mouse, Mus musculus (Muridae), model organism for tooth morphogenesis, and the golden hamster, Mesocricetus auratus which shares great similarities in cusp pattern with brush-tailed mice. All three species were bred in captivity and developing embryos were isolated at different embryonic days (E). Histological evaluation of lower molars was performed and spatiotemporal pattern of FGF4 expression was determined by immunohistochemistry. Results indicated that morphogenesis of the tooth cusps starts at the beginning of the cap stage of the first lower molar (E14 in house mouse, about E11.5 in golden hamster and E22 in Goodwin's brush-tailed mouse). During the cap to bell stage (E15 in house mouse, E12 in golden hamster and at about E24 in Goodwin's brush-tailed mouse), a decrease in the expression of FGF4 was observed in the mesenchyme, except for the cusp tips. According to our observations, the developmental process of the first lower molar formation in Goodwin's brush-tailed mouse began much later as compared with the other two species. Despite the differences in the temporal pattern of molar development between these three members of the same superfamily (Muroidea), the correlation in the expression of FGF4 with specific stages of tooth morphogenesis supported its regulatory function. Anat Rec, 300:2138-2149, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

DEFINIENDO HOMO SAPIENS-SAPIENS: APROXIMACIÓN ANTROPOLÓGICA

OpenAIRE

Valdebenito, Carolina

2007-01-01

Este artículo reflexiona sobre los encuentros y desencuentros entre el ser humano y el resto de los animales, en tanto miembros de sistemas en permanente interacción(1). Abordar la definición de Homo, repasar su evolución biológica y cultural y reflexionar sobre los resabios de animalidad que quedan en el comportamiento social del Homo sapiens-sapiens es su objetivo principal. Se busca reflexionar sobre los dilemas morales que acompañan al hombre en tanto ser cultural; para ello se analizan d...

NCBI nr-aa BLAST: CBRC-OLAT-12-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-12-0001 gb|AAK56078.1|AF332049_1 adrenergic receptor alpha 2B [Mus muscul...us] gb|AAA37131.1| alpha-2 adrenergic receptor gb|EDL28187.1| adrenergic receptor, alpha 2b [Mus musculus] AAK56078.1 1e-102 49% ...

NASCENT: an automatic protein interaction network generation tool for non-model organisms.

Science.gov (United States)

Banky, Daniel; Ordog, Rafael; Grolmusz, Vince

2009-04-24

Large quantity of reliable protein interaction data are available for model organisms in public depositories (e.g., MINT, DIP, HPRD, INTERACT). Most data correspond to experiments with the proteins of Saccharomyces cerevisiae, Drosophila melanogaster, Homo sapiens, Caenorhabditis elegans, Escherichia coli and Mus musculus. For other important organisms the data availability is poor or non-existent. Here we present NASCENT, a completely automatic web-based tool and also a downloadable Java program, capable of modeling and generating protein interaction networks even for non-model organisms. The tool performs protein interaction network modeling through gene-name mapping, and outputs the resulting network in graphical form and also in computer-readable graph-forms, directly applicable by popular network modeling software. http://nascent.pitgroup.org.

Dicty_cDB: Contig-U10276-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 1_1( AB019491 |pid:none) Homo sapiens IDN4-GGTR8 mRNA, part... 39 0.52 ( Q92738 ) RecName: Full=USP6 N-terminal-li...em... 40 0.18 BC051184_1( BC051184 |pid:none) Mus musculus USP6 N-terminal like,... 39 0.31 (Q66K14) RecName...: Full=TBC1 domain family member 9B; &AB449893_... 39 0.31 (Q80XC3) RecName: Full=USP6 N-terminal-like prote...7489 ) 1095460264250 Global-Ocean-Sampling_GS-31-01-01-1... 44 0.91 2 ( EA427602 ) Sequence 77 from patent U...ns chromosome 12 clone ABC7-42389800N19... 46 3.3 1 ( ER597226 ) 1093016226857 Global-Ocean-Sampling_GS-3

Evidencias empíricas de regularidades estadísticas y leyes de potencia en los genomas de Arabidopsis thaliana, Oriza sativa y Mus musculus

Directory of Open Access Journals (Sweden)

Martha I Almanza P.

2010-07-01

Full Text Available La masiva cantidad de datos biológicos provenientes de las disciplinas "ómicas" y su aprovechamiento en el mejoramiento genético vegetal requiere de nuevos abordajes teóricos y estadísticos que describan de forma satisfactoria principios generales en los genomas. El total de secuencias de los genes de los genomas vegetales de Arabidopsis thaliana y Oriza sativa y del genoma animal Mus musculus fueron extraídas y depuradas de la base de datos pública del Genebank mediante el diseño de algoritmos en lenguaje de programación Python. Se analizaron las distribuciones de las variables frecuencia de uso y tamaño de los genes, exones e intrones por cromosoma y entre genomas. Los resultados señalaron que las variables presentan patrones de comportamiento no lineales en forma de ley de potencia que difieren estadísticamente entre los genomas pero no entre los cromosomas de un mismo genoma. Además, el análisis aportó evidencias respecto al tamaño promedio constante de las secuencias de exones y de los genes simples por cromosoma y entre genomas. Los hallazgos sugieren: primero, que el genoma se auto-organiza de la misma manera en los cromosomas independientemente del tamaño o número de genes que estos contengan, y, segundo, que tanto los cromosomas como sus elementos constituyentes: genes, exones e intrones han evolucionado conjuntamente. El estudio señala que las leyes de potencia cumplen un papel amortiguador en las leyes de variación biológica y proporcionan medidas cuantitativas de la organización de las secuencias de ADN que definen la identidad de un genoma. La regularidad estadística de estas medidas genéticas tiene potenciales aplicaciones en el incremento del valor predictivo de los actuales modelos de mejoramiento genético vegetal.

Genetic conflict outweighs heterogametic incompatibility in the mouse hybrid zone?

Czech Academy of Sciences Publication Activity Database

Macholán, Miloš; Baird, S. J. E.; Munclinger, P.; Dufková, Petra; Bímová, Barbora; Piálek, Jaroslav

2008-01-01

Roč. 8, - (2008), s. 271-284 ISSN 1471-2148 R&D Projects: GA ČR GA206/06/0707; GA ČR GA206/06/0955; GA AV ČR IAA600930506; GA ČR GA206/08/0640 Grant - others:GA ČR(CZ) GP206/03/D148 Institutional research plan: CEZ:AV0Z50450515; CEZ:AV0Z60930519 Keywords : Mus musculus musculus * Mus musculus domesticus Subject RIV: EG - Zoology Impact factor: 4.050, year: 2008

NCBI nr-aa BLAST: CBRC-STRI-01-2691 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2691 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 1e-74 49% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2568 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2568 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 5e-49 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2291 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2291 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 1e-79 50% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0474 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0474 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-81 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0722 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0722 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-65 49% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2741 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2741 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-83 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2574 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2574 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 2e-85 52% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0161 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0161 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 3e-84 52% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2502 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2502 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 5e-70 49% ...

NCBI nr-aa BLAST: CBRC-TGUT-08-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TGUT-08-0001 ref|NP_067250.2| potassium voltage-gated channel, shaker-related ...assium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] emb|CAM23761.1| potassium voltage-gated channel, shak...4.1| potassium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] NP_067250.2 0.0 79% ...

NCBI nr-aa BLAST: CBRC-ACAR-01-0365 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0365 ref|NP_067250.2| potassium voltage-gated channel, shaker-related ...assium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] emb|CAM23761.1| potassium voltage-gated channel, shak...4.1| potassium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] NP_067250.2 0.0 79% ...

NCBI nr-aa BLAST: CBRC-MLUC-01-0737 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0737 ref|NP_067250.2| potassium voltage-gated channel, shaker-related ...assium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] emb|CAM23761.1| potassium voltage-gated channel, shak...4.1| potassium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] NP_067250.2 0.0 87% ...

NCBI nr-aa BLAST: CBRC-ETEL-01-1362 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-1362 ref|NP_067250.2| potassium voltage-gated channel, shaker-related ...assium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] emb|CAM23761.1| potassium voltage-gated channel, shak...4.1| potassium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] NP_067250.2 0.0 93% ...

NCBI nr-aa BLAST: CBRC-OANA-01-2250 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OANA-01-2250 ref|NP_067250.2| potassium voltage-gated channel, shaker-related ...assium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] emb|CAM23761.1| potassium voltage-gated channel, shak...4.1| potassium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] NP_067250.2 0.0 92% ...

IMGT/GeneInfo: T cell receptor gamma TRG and delta TRD genes in database give access to all TR potential V(DJ recombinations

Directory of Open Access Journals (Sweden)

Jouvin-Marche Evelyne

2006-04-01

Full Text Available Abstract Background Adaptative immune repertoire diversity in vertebrate species is generated by recombination of variable (V, diversity (D and joining (J genes in the immunoglobulin (IG loci of B lymphocytes and in the T cell receptor (TR loci of T lymphocytes. These V-J and V-D-J gene rearrangements at the DNA level involve recombination signal sequences (RSS. Whereas many data exist, they are scattered in non specialized resources with different nomenclatures (eg. flat files and are difficult to extract. Description IMGT/GeneInfo is an online information system that provides, through a user-friendly interface, exhaustive information resulting from the complex mechanisms of T cell receptor V-J and V-D-J recombinations. T cells comprise two populations which express the αβ and γδ TR, respectively. The first version of the system dealt with the Homo sapiens and Mus musculus TRA and TRB loci whose gene rearrangements allow the synthesis of the αβ TR chains. In this paper, we present the second version of IMGT/GeneInfo where we complete the database for the Homo sapiens and Mus musculus TRG and TRD loci along with the introduction of a quality control procedure for existing and new data. We also include new functionalities to the four loci analysis, giving, to date, a very informative tool which allows to work on V(DJ genes of all TR loci in both human and mouse species. IMGT/GeneInfo provides more than 59,000 rearrangement combinations with a full gene description which is freely available at http://imgt.cines.fr/GeneInfo. Conclusion IMGT/GeneInfo allows all TR information sequences to be in the same spot, and are now available within two computer-mouse clicks. This is useful for biologists and bioinformaticians for the study of T lymphocyte V(DJ gene rearrangements and their applications in immune response analysis.

Dicty_cDB: Contig-U10913-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available .013 ( Q92738 ) RecName: Full=USP6 N-terminal-like protein; AltName: Fu... 44 0.013 D13644_1( D13644 |pid:none) Homo sapie...4 2 ( AC090393 ) Homo sapiens chromosome 18, clone RP11-738B2, com... 36 2.7 7 ( ER548332 ) 1093016199934 Global-Ocean-Sampli...288 pro... 44 0.012 BC051184_1( BC051184 |pid:none) Mus musculus USP6 N-terminal like,... 44 0.013 AK099868_... BT038351 |pid:none) Zea mays full-length cDNA clone ZM... 44 0.013 (Q80XC3) RecName: Full=USP6 N-terminal-li...095506062409 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.83 1 ( CC504594 ) CH240_344F23.TARBAC13P2 CHORI-240

Mining meiosis and gametogenesis with DNA microarrays.

Science.gov (United States)

Schlecht, Ulrich; Primig, Michael

2003-04-01

Gametogenesis is a key developmental process that involves complex transcriptional regulation of numerous genes including many that are conserved between unicellular eukaryotes and mammals. Recent expression-profiling experiments using microarrays have provided insight into the co-ordinated transcription of several hundred genes during mitotic growth and meiotic development in budding and fission yeast. Furthermore, microarray-based studies have identified numerous loci that are regulated during the cell cycle or expressed in a germ-cell specific manner in eukaryotic model systems like Caenorhabditis elegans, Mus musculus as well as Homo sapiens. The unprecedented amount of information produced by post-genome biology has spawned novel approaches to organizing biological knowledge using currently available information technology. This review outlines experiments that contribute to an emerging comprehensive picture of the molecular machinery governing sexual reproduction in eukaryotes.

AcEST: DK955384 [AcEST

Lifescience Database Archive (English)

Full Text Available >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms...OUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 5...XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Length = 196 Score = 5

AcEST: DK953370 [AcEST

Lifescience Database Archive (English)

Full Text Available PS2_MOUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Scor...NA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms PE=2 SV=1 Leng...FDPEIPQTLRLEFAKANTK 104 >sp|Q9YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms

The Emergence of Homo sapiens.

Science.gov (United States)

Rensberger, Boyce

1980-01-01

Describes chronologically the evolution of the human race on earth so as to refute Darwin's theory of descent from animals. Skull fragments from sites around the world suggest at least two possible routes toward the emergence of Homo sapiens sapiens. (Author/SK)

Spatial Construction Skills of Chimpanzees ("Pan Troglodytes") and Young Human Children ("Homo Sapiens Sapiens")

Science.gov (United States)

Poti, Patrizia; Hayashi, Misato; Matsuzawa, Tetsuro

2009-01-01

Spatial construction tasks are basic tests of visual-spatial processing. Two studies have assessed spatial construction skills in chimpanzees (Pan troglodytes) and young children (Homo sapiens sapiens) with a block modelling task. Study 1a subjects were three young chimpanzees and five adult chimpanzees. Study 1b subjects were 30 human children…

The evolution of Homo sapiens denisova and Homo sapiens neanderthalensis miRNA targeting genes in the prenatal and postnatal brain.

Science.gov (United States)

Gunbin, Konstantin V; Afonnikov, Dmitry A; Kolchanov, Nikolay A; Derevianko, Anatoly P; Rogaev, Eugeny I

2015-01-01

As the evolution of miRNA genes has been found to be one of the important factors in formation of the modern type of man, we performed a comparative analysis of the evolution of miRNA genes in two archaic hominines, Homo sapiens neanderthalensis and Homo sapiens denisova, and elucidated the expression of their target mRNAs in bain. A comparative analysis of the genomes of primates, including species in the genus Homo, identified a group of miRNA genes having fixed substitutions with important implications for the evolution of Homo sapiens neanderthalensis and Homo sapiens denisova. The mRNAs targeted by miRNAs with mutations specific for Homo sapiens denisova exhibited enhanced expression during postnatal brain development in modern humans. By contrast, the expression of mRNAs targeted by miRNAs bearing variations specific for Homo sapiens neanderthalensis was shown to be enhanced in prenatal brain development. Our results highlight the importance of changes in miRNA gene sequences in the course of Homo sapiens denisova and Homo sapiens neanderthalensis evolution. The genetic alterations of miRNAs regulating the spatiotemporal expression of multiple genes in the prenatal and postnatal brain may contribute to the progressive evolution of brain function, which is consistent with the observations of fine technical and typological properties of tools and decorative items reported from archaeological Denisovan sites. The data also suggest that differential spatial-temporal regulation of gene products promoted by the subspecies-specific mutations in the miRNA genes might have occurred in the brains of Homo sapiens denisova and Homo sapiens neanderthalensis, potentially contributing to the cultural differences between these two archaic hominines.

Genome-wide study of correlations between genomic features and their relationship with the regulation of gene expression.

Science.gov (United States)

Kravatsky, Yuri V; Chechetkin, Vladimir R; Tchurikov, Nikolai A; Kravatskaya, Galina I

2015-02-01

The broad class of tasks in genetics and epigenetics can be reduced to the study of various features that are distributed over the genome (genome tracks). The rapid and efficient processing of the huge amount of data stored in the genome-scale databases cannot be achieved without the software packages based on the analytical criteria. However, strong inhomogeneity of genome tracks hampers the development of relevant statistics. We developed the criteria for the assessment of genome track inhomogeneity and correlations between two genome tracks. We also developed a software package, Genome Track Analyzer, based on this theory. The theory and software were tested on simulated data and were applied to the study of correlations between CpG islands and transcription start sites in the Homo sapiens genome, between profiles of protein-binding sites in chromosomes of Drosophila melanogaster, and between DNA double-strand breaks and histone marks in the H. sapiens genome. Significant correlations between transcription start sites on the forward and the reverse strands were observed in genomes of D. melanogaster, Caenorhabditis elegans, Mus musculus, H. sapiens, and Danio rerio. The observed correlations may be related to the regulation of gene expression in eukaryotes. Genome Track Analyzer is freely available at http://ancorr.eimb.ru/. © The Author 2015. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.

NCBI nr-aa BLAST: CBRC-PTRO-04-0004 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-04-0004 sp|Q8VBS7|VN1A6_MOUSE Vomeronasal type-1 receptor A6 (Vomeronasal... type-1 receptor A3) (Vomeronasal type-1 receptor A1) (Vomeronasal type-1 receptor A10) dbj|BAB79209.1| vomeronasa...l receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasal receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasa

Dicty_cDB: VHO533 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL...157766_4( AL157766 |pid:none) 96 2e-18 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 94 8e-18 (Q9JLC8) RecName: Full=Sacsin; 94 8e-18 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA

AcEST: DK950692 [AcEST

Lifescience Database Archive (English)

Full Text Available |Q8VC52|RBPS2_MOUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length ...ultiple splicing OS=Mus musculus GN=Rbpms PE=2 SV=1 Length = 197 Score = 77.0 bits (188), Expect = 8e-14 Ide...S_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Length = 196 Score =

AcEST: DK950959 [AcEST

Lifescience Database Archive (English)

Full Text Available XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Length = 196 Score = 4...iple splicing OS=Mus musculus GN=Rbpms PE=2 SV=1 Length = 197 Score = 47.8 bits (112), Expect = 6e-05 Identi...nding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 46.2 bits (1

AcEST: DK958175 [AcEST

Lifescience Database Archive (English)

Full Text Available USE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 36...>sp|Q9YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Lengt... EEVRTLFVSGLPIDIKPRELYLLFRPFKGYE 47 >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms

Programming and Playing with RoboSapien on line

Directory of Open Access Journals (Sweden)

Vladimir M Cvjetkovic

2011-07-01

Full Text Available RoboSapien is famous human like robot toy intended for playing with, of interested in, of all ages, and learning through the game, of some basic characteristics of robots and robotic control. The programming of RoboSapien as described in user’s manual is limited with the internal memory, battery life, and not very convenient input of actions through the multipurpose buttons of the RoboSapien IR remote control device. In order to offer better conditions for experimenting and using of RoboSapien, the web user interface was developed, that provides interactive user control, programming of command sequences of arbitrary length, observing of RoboSapien actions using the web cam that shows the movements and actions on web page. Access and control of RoboSapien by remote user through the web page user interface, is controlled by access levels depending on whether the user is logged in or not. The whole system is implemented in C# as ASP.NET project with NI USB 6501 digital I/O driving the CMOS 4066 analog switches for controlling the RoboSapien IR remote control device.

Dicty_cDB: VHK810 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available g significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 5...e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsi...n; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA

Diagnosing Homo sapiens in the fossil record.

Science.gov (United States)

Stringer, Christopher Brian; Buck, Laura Tabitha

2014-01-01

Diagnosing Homo sapiens is a critical question in the study of human evolution. Although what constitutes living members of our own species is straightforward, in the fossil record this is still a matter of much debate. The issue is complicated by questions of species diagnoses and ideas about the mode by which a new species is born, by the arguments surrounding the behavioural and cognitive separateness of the species, by the increasing appreciation of variation in the early African H. sapiens record and by new DNA evidence of hybridization with extinct species. This study synthesizes thinking on the fossils, archaeology and underlying evolutionary models of the last several decades with recent DNA results from both H. sapiens and fossil species. It is concluded that, although it may not be possible or even desirable to cleanly partition out a homogenous morphological description of recent H. sapiens in the fossil record, there are key, distinguishing morphological traits in the cranium, dentition and pelvis that can be usefully employed to diagnose the H. sapiens lineage. Increasing advances in retrieving and understanding relevant genetic data provide a complementary and perhaps potentially even more fruitful means of characterizing the differences between H. sapiens and its close relatives.

AcEST: BP921475 [AcEST

Lifescience Database Archive (English)

Full Text Available BlastX Result : Swiss-Prot sp_hit_id O35902 Definition sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus Al...gnificant alignments: (bits) Value sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus GN=Dsg3 PE=2 SV=1 31 2....2 sp|Q29IL2|POMT2_DROPS Protein O-mannosyl-transferase 2 OS=Drosop... 30 4.8 >sp|O35902|DSG3_MOUSE Desmog

A Summary of the Naval Postgraduate School Research Program.

Science.gov (United States)

1981-04-01

compaction achieved in the procedure is very large. Point process methodology is being applied to tnat analysis of sleep-wake behavior in mice (mus musculus...Initial data analysis has indicated that there is no evidence for ultradian rhythms in mice (mus musculus). Further analysis of cir- cadian rhythms...One of these antennas is a 20 foot wire monopole erected in the center of the image plane in order to transmit a high voltage pulse to the test

Dicty_cDB: VHN647 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ignments: (bits) Value CP001577_292( CP001577 |pid:none) Micromonas sp. RCC299 chromosome... 106 2e-21 (Q9NZJ4) RecName: Full=Sacsi...n; &AL157766_4( AL157766 |pid:none) 105 5e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsi..... 103 2e-20 (Q9JLC8) RecName: Full=Sacsin; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsi

Dicty_cDB: VHO809 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available e E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL1...57766 |pid:none) 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 B...C138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsin

Dicty_cDB: VHD239 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available lignments: (bits) Value BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 112 3e-23 BC13...8482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 112 4e-23 (Q9NZJ4) RecName: Full=Sacsin; &...AL157766_4( AL157766 |pid:none) 112 4e-23 (Q9JLC8) RecName: Full=Sacsin; 112 4e-2

Dicty_cDB: VHD478 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 35 0.63 (Q9NZJ4) RecName: Full=Sacs...in; &AL157766_4( AL157766 |pid:none) 35 0.63 (Q9JLC8) RecName: Full=Sacsin; 35 0.63... BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 35 0.63 AL732351_6( AL732351 |pid:non

What constitutes Homo sapiens? Morphology versus received wisdom.

Science.gov (United States)

Schwartz, Jeffrey

2016-06-20

Although Linnaeus coined Homo sapiens in 1735, it was Blumenbach forty years later who provided the first morphological definition of the species. Since humans were not then allowed to be ante-Diluvian, his effort applied to the genus, as well. After the Feldhofer Grotto Neanderthal disproved this creationist notion, and human-fossil hunting became legitimate, new specimens were allocated either to sapiens or new species within Homo, or even to new species within new genera. Yet as these taxonomic acts reflected the morphological differences between specimens, they failed to address the question: What constitutes H. sapiens? When in 1950 Mayr collapsed all human fossils into Homo, he not only denied humans a diverse evolutionary past, he also shifted the key to identifying its species from morphology to geological age - a practice most paleoanthropologists still follow. Thus, for example, H. erectus is the species that preceded H. sapiens, and H. sapiens is the species into which H. erectus morphed. In order to deal with a growing morass of morphologically dissimilar specimens, the non-taxonomic terms "archaic" (AS) and "anatomically modern" (AMS) were introduced to distinguish between the earlier and later versions of H. sapiens, thereby making the species impossible to define. In attempting to disentangle fact from scenario, I begin from the beginning, trying to delineate features that may be distinctive of extant humans (ES), and then turning to the fossils that have been included in the species. With the exception of Upper Paleolithic humans - e.g. from Cro-Magnon, Dolni Vestonice, Mladeč - I argue that many specimens regarded as AMS, and all those deemed AS, are not H. sapiens. The features these AMS do share with ES suggest the existence of a sapiens clade. Further, restudy of near-recent fossils, especially from southwestern China (∼11-14.5 ka), reinforces what discoveries such as H. floresiensis indicate: "If it's recent, it's not necessarily H. sapiens".

Dramatic changes in 67 miRNAs during initiation of first wave of spermatogenesis in Mus musculus testis: global regulatory insights generated by miRNA-mRNA network analysis.

Science.gov (United States)

Sree, Sreesha; Radhakrishnan, Karthika; Indu, Sivankutty; Kumar, Pradeep G

2014-09-01

We mapped global changes in miRNA and mRNA profiles spanning the first wave of spermatogenesis using prepubertal (Postnatal Day 8 [P8]), pubertal (P16), and adolescent (P24) Mus musculus testes and identified the differential expression of 67 miRNAs and 8226 mRNAs. These two data sets were integrated into miRNA-dependent regulatory networks based on miRWalk predictions. In a network representing the P8 to P16 transition, downregulation of four miRNAs and upregulation of 19 miRNAs were linked with 81 upregulated target mRNAs and 228 downregulated target mRNAs, respectively. Furthermore, during the P16 to P24 transition, two miRNAs were downregulated, and eight miRNAs were upregulated, which linked with 64 upregulated mRNAs and 389 downregulated mRNAs, respectively. Only three of the miRNAs present in the network (miR-34b-5p, miR-34c, and miR-449a) showed a progressive increase from P8 through P16 to P24, while the remaining miRNAs in the network showed statistically significant changes in their levels either during the P8 to P16 transition or during the P16 to P24 transition. Analysis of the chromosomal location of these differentially expressed miRNAs showed that 14 out of 25 miRNAs upregulated from P8 to P16, and 18 out of 40 miRNAs upregulated from P8 to P24 were X-linked. This is suggestive of their escape from meiotic sex chromosome inactivation and postmeiotic sex chromatin. This integrated network of miRNA-level and mRNA-level changes in mouse testis during the first wave of spermatogenesis is expected to build a base for evaluating the role of miRNA-mediated gene expression regulation in maturing mammalian testis. © 2014 by the Society for the Study of Reproduction, Inc.

NCBI nr-aa BLAST: CBRC-RNOR-08-0336 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-08-0336 ref|NP_666341.1| dynein cytoplasmic 1 light intermediate chain 1 ...[Mus musculus] sp|Q8R1Q8|DC1L1_MOUSE Cytoplasmic dynein 1 light intermediate chain 1 (Dynein light intermedia...te chain 1, cytosolic) (Dynein light chain A) (DLC-A) gb|AAH23347.1| Dynein cytoplasmic 1 light intermediat...b|EDL09299.1| dynein cytoplasmic 1 light intermediate chain 1 [Mus musculus] NP_666341.1 1e-137 63% ...

Dicty_cDB: VHE271 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -21 (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 3e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006

Dicty_cDB: VHC102 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ucing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 1...05 4e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsi...n; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 CP0015

Large-scale trends in the evolution of gene structures within 11 animal genomes.

Directory of Open Access Journals (Sweden)

Mark Yandell

2006-03-01

Full Text Available We have used the annotations of six animal genomes (Homo sapiens, Mus musculus, Ciona intestinalis, Drosophila melanogaster, Anopheles gambiae, and Caenorhabditis elegans together with the sequences of five unannotated Drosophila genomes to survey changes in protein sequence and gene structure over a variety of timescales--from the less than 5 million years since the divergence of D. simulans and D. melanogaster to the more than 500 million years that have elapsed since the Cambrian explosion. To do so, we have developed a new open-source software library called CGL (for "Comparative Genomics Library". Our results demonstrate that change in intron-exon structure is gradual, clock-like, and largely independent of coding-sequence evolution. This means that genome annotations can be used in new ways to inform, corroborate, and test conclusions drawn from comparative genomics analyses that are based upon protein and nucleotide sequence similarities.

Genetics and evolution of hybrid male sterility in house mice.

Science.gov (United States)

White, Michael A; Stubbings, Maria; Dumont, Beth L; Payseur, Bret A

2012-07-01

Comparative genetic mapping provides insights into the evolution of the reproductive barriers that separate closely related species. This approach has been used to document the accumulation of reproductive incompatibilities over time, but has only been applied to a few taxa. House mice offer a powerful system to reconstruct the evolution of reproductive isolation between multiple subspecies pairs. However, studies of the primary reproductive barrier in house mice-hybrid male sterility-have been restricted to a single subspecies pair: Mus musculus musculus and Mus musculus domesticus. To provide a more complete characterization of reproductive isolation in house mice, we conducted an F(2) intercross between wild-derived inbred strains from Mus musculus castaneus and M. m. domesticus. We identified autosomal and X-linked QTL associated with a range of hybrid male sterility phenotypes, including testis weight, sperm density, and sperm morphology. The pseudoautosomal region (PAR) was strongly associated with hybrid sterility phenotypes when heterozygous. We compared QTL found in this cross with QTL identified in a previous F(2) intercross between M. m. musculus and M. m. domesticus and found three shared autosomal QTL. Most QTL were not shared, demonstrating that the genetic basis of hybrid male sterility largely differs between these closely related subspecies pairs. These results lay the groundwork for identifying genes responsible for the early stages of speciation in house mice.

Mutations at the mei-41, mus(1)101, mus(1)103, mus(2)205 and mus(3)310 loci of Drosophila exhibit differential UDS responses with different DNA-damaging agents

International Nuclear Information System (INIS)

Dusenbery, R.L.

1987-01-01

5 mutagen-sensitive mutants of Drosophila melanogaster, reported to perform normal or only slightly reduced excision repair of UV damage, were examined by an unscheduled DNA synthesis (UDS) assay. 2 mutants, classified as completely or partially proficient for both excision and postreplication repair of UV damage, mus(1)103 and mus(2)205, were found to give positive UDS responses only for UV damage. These mutants exhibit no measurable UDS activity following DNA damage by several different alkylating agents and X-rays. 3 mutants, classified as having no defect in excision repair, but measurable defects in postreplication repair of UV damage, exhibit 3 different response patterns. The mutant mei-41 exhibits a highly positive UDS response following damage by all agents, consistent with its prior classification as excision-repair-proficient, but postreplication-repair-deficient for UV damage. The mutant mus(1)101, however, exhibits a strong positive UDS response following only UV damage and appears to be blocked in the excision repair of damage produced by both alkylating agents and X-irradiation. Finally, mus(3)310 exhibits no UDS response to alkylation, X-ray or UV damage. This is not consistent with its previous classification. Results obtained w0272the qualitative in vitro UDS assay are entirely consistent with the results from two separate in vivo measures of excision repair deficiency followign DNA damage, larval hypersensitivity to killing and hypermutability in the sex-linked recessive lethal test. (Auth.)

NCBI nr-aa BLAST: CBRC-STRI-01-2626 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2626 sp|Q8VBS7|VN1A6_MOUSE RecName: Full=Vomeronasal type-1 receptor A...6; AltName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A1; AltName: Full=Vomeronasa...l type-1 receptor A10 dbj|BAB79209.1| vomeronasal receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasa...l receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasal receptor V1RA10

HOX Gene Promoter Prediction and Inter-genomic Comparison: An Evo-Devo Study

Directory of Open Access Journals (Sweden)

Marla A. Endriga

2010-10-01

Full Text Available Homeobox genes direct the anterior-posterior axis of the body plan in eukaryotic organisms. Promoter regions upstream of the Hox genes jumpstart the transcription process. CpG islands found within the promoter regions can cause silencing of these promoters. The locations of the promoter regions and the CpG islands of Homeo sapiens sapiens (human, Pan troglodytes (chimpanzee, Mus musculus (mouse, and Rattus norvegicus (brown rat are compared and related to the possible influence on the specification of the mammalian body plan. The sequence of each gene in Hox clusters A-D of the mammals considered were retrieved from Ensembl and locations of promoter regions and CpG islands predicted using Exon Finder. The predicted promoter sequences were confirmed via BLAST and verified against the Eukaryotic Promoter Database. The significance of the locations was determined using the Kruskal-Wallis test. Among the four clusters, only promoter locations in cluster B showed significant difference. HOX B genes have been linked with the control of genes that direct the development of axial morphology, particularly of the vertebral column bones. The magnitude of variation among the body plans of closely-related species can thus be partially attributed to the promoter kind, location and number, and gene inactivation via CpG methylation.

NCBI nr-aa BLAST: CBRC-CPOR-01-1147 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1147 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-CPOR-01-0933 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-0933 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0130 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0130 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-PABE-04-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-04-0003 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-OCUN-01-1001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1001 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0137 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0137 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-RNOR-04-0241 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0241 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-CPOR-01-1167 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1167 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0138 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0138 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0124 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0124 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

Dicty_cDB: VHK791 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ificant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL15...142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA ...(cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006

Dicty_cDB: VHB767 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available vs Protein Score E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &...AL157766_4( AL157766 |pid:none) 111 7e-23 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 109 3e-22 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 108 3e-22 (Q9JLC8) RecName: Full=Sacsin; 108 3e-22 BC142916_1( BC142916 |pid:none) Danio rerio hypothetic

Effects of mutagen-sensitive mus mutations on spontaneous mitotic recombination in Aspergillus.

Science.gov (United States)

Zhao, P; Kafer, E

1992-04-01

Methyl methane-sulfonate (MMS)-sensitive, radiation-induced mutants of Aspergillus were shown to define nine new DNA repair genes, musK to musS. To test mus mutations for effects on mitotic recombination, intergenic crossing over was assayed between color markers and their centromeres, and intragenic recombination between two distinguishable adE alleles. Of eight mutants analyzed, four showed significant deviations from mus+ controls in both tests. Two mutations, musK and musL, reduced recombination, while musN and musQ caused increases. In contrast, musO diploids produced significantly higher levels only for intragenic recombination. Effects were relatively small, but averages between hypo- and hyperrec mus differed 15-20-fold. In musL diploids, most of the rare color segregants resulted from mitotic malsegregation rather than intergenic crossing over. This indicates that the musL gene product is required for recombination and that DNA lesions lead to chromosome loss when it is deficient. In addition, analysis of the genotypes of intragenic (ad+) recombinants showed that the musL mutation specifically reduced single allele conversion but increased complex conversion types (especially recombinants homozygous for ad+). Similar analysis revealed differences between the effects of two hyperrec mutations; musN apparently caused high levels solely of mitotic crossing over, while musQ increased various conversion types but not reciprocal crossovers. These results suggest that mitotic gene conversion and crossing over, while generally associated, are affected differentially in some of the mus strains of Aspergillus nidulans.

“Controlled, cross-species dataset for exploring biases in genome annotation and modification profiles”

Directory of Open Access Journals (Sweden)

Alison McAfee

2015-12-01

Full Text Available Since the sequencing of the honey bee genome, proteomics by mass spectrometry has become increasingly popular for biological analyses of this insect; but we have observed that the number of honey bee protein identifications is consistently low compared to other organisms [1]. In this dataset, we use nanoelectrospray ionization-coupled liquid chromatography–tandem mass spectrometry (nLC–MS/MS to systematically investigate the root cause of low honey bee proteome coverage. To this end, we present here data from three key experiments: a controlled, cross-species analyses of samples from Apis mellifera, Drosophila melanogaster, Caenorhabditis elegans, Saccharomyces cerevisiae, Mus musculus and Homo sapiens; a proteomic analysis of an individual honey bee whose genome was also sequenced; and a cross-tissue honey bee proteome comparison. The cross-species dataset was interrogated to determine relative proteome coverages between species, and the other two datasets were used to search for polymorphic sequences and to compare protein cleavage profiles, respectively.

Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes

Directory of Open Access Journals (Sweden)

Sadhna Phanse

2016-03-01

Full Text Available Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium discoideum, Saccharomyces cerevisiae and locally by targeted affinity-purification experiments. Here we provide details of our massive set of supporting biochemical fractionation data available via ProteomeXchange (http://www.ebi.ac.uk/pride/archive/projects/PXD002319-http://www.ebi.ac.uk/pride/archive/projects/PXD002328, PPIs via BioGRID (185267; and interaction network projections via (http://metazoa.med.utoronto.ca made fully accessible to allow further exploration. The datasets here are related to the research article on metazoan macromolecular complexes in Nature [1]. Keywords: Proteomics, Metazoa, Protein complexes, Biochemical, Fractionation

Misexpression of cyclin B3 leads to aberrant spermatogenesis.

Science.gov (United States)

Refik-Rogers, Jale; Manova, Katia; Koff, Andrew

2006-09-01

Mus musculus cyclin B3 is an early meiotic cyclin that is expressed in leptotene and zygotene phases during gametogenesis. In order to determine whether downregulation of cyclin B3 at zygotene-pachytene transition was important for normal spermatogenesis, we investigated the consequences of expressing H. sapiens cyclin B3 after zygotene in mouse testes. Prolonging expression of cyclin B3 until the end of meiosis led to a reduction in sperm counts and disruption of spermatogenesis in four independent lines of transgenic mice. There were three distinct morphological defects associated with the ectopic expression of cyclin B3. Seminiferous tubules were either depleted of germ cells, had an abnormal cell mass in the lumen, or were characterized by the presence of abnormal round spermatids. These defects were associated with increased apoptosis in the testes. These results suggest that downregulation of cyclin B3 at the zygotene-pachytene transition is required to ensure normal spermatogenesis.

Effects of Mutagen-Sensitive Mus Mutations on Spontaneous Mitotic Recombination in Aspergillus

OpenAIRE

Zhao, P.; Kafer, E.

1992-01-01

Methyl methane-sulfonate (MMS)-sensitive, radiation-induced mutants of Aspergillus were shown to define nine new DNA repair genes, musK to musS. To test mus mutations for effects on mitotic recombination, intergenic crossing over was assayed between color markers and their centromeres, and intragenic recombination between two distinguishable adE alleles. Of eight mutants analyzed, four showed significant deviations from mus(+) controls in both tests. Two mutations, musK and musL, reduced reco...

Dicty_cDB: VHF491 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ents: (bits) Value BC142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 97 6e-19 (Q9NZJ4) RecName: Full=Sacsi...n; &AL157766_4( AL157766 |pid:none) 97 9e-19 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 1e-18 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 2e-18 (Q9JLC8) RecName: Full=Sacsin; 96 2e-18 CP001577_292( CP001577 |pid:none) Mi

Dicty_cDB: VHE123 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available nificant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 4e-21 ...none) Micromonas sp. RCC299 chromosome... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 BC171956_1( BC17...1956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 AB006708_10( AB006708 |pid:none) Arabidopsis

Sacral Variability in Tailless Species: Homo sapiens and Ochotona princeps.

Science.gov (United States)

Tague, Robert G

2017-05-01

Homo sapiens is variable in number of sacral vertebrae, and this variability can lead to obstetrical complication. This study uses the comparative method to test the hypothesis that sacral variability in H. sapiens is associated with absence of a tail. Three species of lagomorphs are studied: Ochotona princeps (N = 271), which is tailless, and Lepus californicus (N = 212) and Sylvilagus audubonii (N = 206), which have tails. Results show that O. princeps has (1) higher diversity index for number of sacral vertebrae (0.49) compared to L. californicus (0.25) and S. audubonii (0.26) and (2) significantly higher percentage of individuals with the species-specific nonmodal number of sacral vertebrae (43.9%) compared to L. californicus (14.2%) and S. audubonii (15.5%). Comparison of H. sapiens (N = 1,030; individuals of age 20-39 years) with O. princeps shows similarities between the species in diversity index (also 0.49 in H. sapiens) and percentage of individuals with nonmodal number of sacral vertebrae (37.3% in H. sapiens). Homeotic transformation best explains the results. H. sapiens and O. princeps show propensity for caudal shift at the sacral-caudal border (i.e., homeotic transformation of the first caudal vertebra to a sacral vertebra). Caudal and cranial shift among presacral vertebrae increases or decreases this propensity, respectively. Increase in number of sacral vertebrae in H. sapiens by homeotic transformation reduces pelvic outlet capacity and can be obstetrically hazardous. Anat Rec, 300:798-809, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

Identification and field evaluation of attractants for the cranberry weevil, Anthonomus musculus Say.

Science.gov (United States)

Szendrei, Zsofia; Averill, Anne; Alborn, Hans; Rodriguez-Saona, Cesar

2011-04-01

Studies were conducted to develop an attractant for the cranberry weevil, Anthonomus musculus, a pest of blueberry and cranberry flower buds and flowers in the northeastern United States. In previous studies, we showed that cinnamyl alcohol, the most abundant blueberry floral volatile, and the green leaf volatiles (Z)-3-hexenyl acetate and hexyl acetate, emitted from both flowers and flower buds, elicit strong antennal responses from A. musculus. Here, we found that cinnamyl alcohol did not increase capture of A. musculus adults on yellow sticky traps compared with unbaited controls; however, weevils were highly attracted to traps baited with the Anthonomus eugenii Cano aggregation pheromone, indicating that these congeners share common pheromone components. To identify the A. musculus aggregation pheromone, headspace volatiles were collected from adults feeding on blueberry or cranberry flower buds and analyzed by gas chromatography-mass spectrometry. Three male-specific compounds were identified: (Z)-2-(3,3-dimethyl-cyclohexylidene) ethanol (Z grandlure II); (Z)-(3,3-dimethylcyclohexylidene) acetaldehyde (grandlure III); and (E)-(3,3- dimethylcyclohexylidene) acetaldehyde (grandlure IV). A fourth component, (E)-3,7-dimethyl-2,6-octadien-1-ol (geraniol), was emitted in similar quantities by males and females. The emission rates of these volatiles were about 2.8, 1.8, 1.3, and 0.9 ng/adult/d, respectively. Field experiments in highbush blueberry (New Jersey) and cranberry (Massachusetts) examined the attraction of A. musculus to traps baited with the male-produced compounds and geraniol presented alone and combined with (Z)-3-hexenyl acetate and hexyl acetate, and to traps baited with the pheromones of A. eugenii and A. grandis. In both states and crops, traps baited with the A. musculus male-produced compounds attracted the highest number of adults. Addition of the green leaf volatiles did not affect A. musculus attraction to its pheromone but skewed the sex ratio

The origin and evolution of Homo sapiens.

Science.gov (United States)

Stringer, Chris

2016-07-05

If we restrict the use of Homo sapiens in the fossil record to specimens which share a significant number of derived features in the skeleton with extant H. sapiens, the origin of our species would be placed in the African late middle Pleistocene, based on fossils such as Omo Kibish 1, Herto 1 and 2, and the Levantine material from Skhul and Qafzeh. However, genetic data suggest that we and our sister species Homo neanderthalensis shared a last common ancestor in the middle Pleistocene approximately 400-700 ka, which is at least 200 000 years earlier than the species origin indicated from the fossils already mentioned. Thus, it is likely that the African fossil record will document early members of the sapiens lineage showing only some of the derived features of late members of the lineage. On that basis, I argue that human fossils such as those from Jebel Irhoud, Florisbad, Eliye Springs and Omo Kibish 2 do represent early members of the species, but variation across the African later middle Pleistocene/early Middle Stone Age fossils shows that there was not a simple linear progression towards later sapiens morphology, and there was chronological overlap between different 'archaic' and 'modern' morphs. Even in the late Pleistocene within and outside Africa, we find H. sapiens specimens which are clearly outside the range of Holocene members of the species, showing the complexity of recent human evolution. The impact on species recognition of late Pleistocene gene flow between the lineages of modern humans, Neanderthals and Denisovans is also discussed, and finally, I reconsider the nature of the middle Pleistocene ancestor of these lineages, based on recent morphological and genetic data.This article is part of the themed issue 'Major transitions in human evolution'. © 2016 The Author(s).

Similar Pathogen Targets in Arabidopsis thaliana and Homo sapiens Protein Networks

Science.gov (United States)

2012-09-21

Similar Pathogen Targets in Arabidopsis thaliana and Homo sapiens Protein Networks Paulo Shakarian1*, J. Kenneth Wickiser2 1 Paulo Shakarian...significantly attacked. Citation: Shakarian P, Wickiser JK (2012) Similar Pathogen Targets in Arabidopsis thaliana and Homo sapiens Protein Networks...to 00-00-2012 4. TITLE AND SUBTITLE Similar Pathogen Targets in Arabidopsis thaliana and Homo sapiens Protein Networks 5a. CONTRACT NUMBER 5b

Analysis of Copy Number Variation in the Abp Gene Regions of Two House Mouse Subspecies Suggests Divergence during the Gene Family Expansions.

Science.gov (United States)

Pezer, Željka; Chung, Amanda G; Karn, Robert C; Laukaitis, Christina M

2017-06-01

The Androgen-binding protein ( Abp ) gene region of the mouse genome contains 64 genes, some encoding pheromones that influence assortative mating between mice from different subspecies. Using CNVnator and quantitative PCR, we explored copy number variation in this gene family in natural populations of Mus musculus domesticus ( Mmd ) and Mus musculus musculus ( Mmm ), two subspecies of house mice that form a narrow hybrid zone in Central Europe. We found that copy number variation in the center of the Abp gene region is very common in wild Mmd , primarily representing the presence/absence of the final duplications described for the mouse genome. Clustering of Mmd individuals based on this variation did not reflect their geographical origin, suggesting no population divergence in the Abp gene cluster. However, copy number variation patterns differ substantially between Mmd and other mouse taxa. Large blocks of Abp genes are absent in Mmm , Mus musculus castaneus and an outgroup, Mus spretus , although with differences in variation and breakpoint locations. Our analysis calls into question the reliance on a reference genome for interpreting the detailed organization of genes in taxa more distant from the Mmd reference genome. The polymorphic nature of the gene family expansion in all four taxa suggests that the number of Abp genes, especially in the central gene region, is not critical to the survival and reproduction of the mouse. However, Abp haplotypes of variable length may serve as a source of raw genetic material for new signals influencing reproductive communication and thus speciation of mice. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

Sperm morphology in two house mouse subspecies: Do wild-derived strains and wild mice tell the same story?

Czech Academy of Sciences Publication Activity Database

Albrechtová, Jana; Albrecht, Tomáš; Ďureje, Ľudovít; Pallazola, V. A.; Piálek, Jaroslav

2014-01-01

Roč. 9, č. 12 (2014), e115669 E-ISSN 1932-6203 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 Keywords : Mus musculus musculus * hybrid zone * multiple paternity * Passerine birds * Swimming velocity * Central Europe * Competition * Speciation * Common * Size Subject RIV: EG - Zoology Impact factor: 3.234, year: 2014

Identification of an active ID-like group of SINEs in the mouse.

Science.gov (United States)

Kass, David H; Jamison, Nicole

2007-09-01

The mouse genome consists of five known families of SINEs: B1, B2, B4/RSINE, ID, and MIR. Using RT-PCR we identified a germ-line transcript that demonstrates 92.7% sequence identity to ID (excluding primer sequence), yet a BLAST search identified numerous matches of 100% sequence identity. We analyzed four of these elements for their presence in orthologous genes in strains and subspecies of Mus musculus as well as other species of Mus using a PCR-based assay. All four analyzed elements were identified either only in M. musculus or exclusively in both M. musculus and M. domesticus, indicative of recent integrations. In conjunction with the identification of transcripts, we present an active ID-like group of elements that is not derived from the proposed BC1 master gene of ID elements. A BLAST of the rat genome indicated that these elements were not in the rat. Therefore, this family of SINEs has recently evolved, and since it has thus far been observed mainly in M. musculus, we refer to this family as MMIDL.

Morphological comparison of archaic Homo sapiens crania from China and Africa.

Science.gov (United States)

Wu, X; Bräuer, G

1993-12-01

Regional features play a great role in the analysis of the differentiations of Homo erectus and Homo sapiens. However, this poses the question how widespread and variable these features are. In order to examine this with regard to the features commonly seen in China their occurrence and variability were determined in Chinese as well as in African crania of archaic and late Pleistocene/Holocene modern Homo sapiens. Furthermore, some features known from Africa were examined with regard to their occurrence and variability in China. Although the variability might change due to new finds, the present results for some features point to larger morphological spectra in the African than in the Chinese archaic Homo sapiens. It is furthermore remarkable that the early modern Chinese in many features show deviations from the pattern of archaic Homo sapiens of this region and exhibit broader spectra similar to those seen in African archaic and early modern Homo sapiens.

The origin and evolution of Homo sapiens

OpenAIRE

Stringer, Chris

2016-01-01

If we restrict the use of Homo sapiens in the fossil record to specimens which share a significant number of derived features in the skeleton with extant H. sapiens, the origin of our species would be placed in the African late middle Pleistocene, based on fossils such as Omo Kibish 1, Herto 1 and 2, and the Levantine material from Skhul and Qafzeh. However, genetic data suggest that we and our sister species Homo neanderthalensis shared a last common ancestor in the middle Pleistocene approx...

Stravovacích návyky z hlediska fylogeneze Homo sapiens sapiens.

OpenAIRE

HOLÁ, Marcela

2010-01-01

This Bachelor's thesis on the synthesis of literature, is attempting to create an overview of our human ancestor's dietary habits. The time frame is from the oldest representative of the hominoid family, genus Ardipithecus ramidus, to neolithic Homo sapiens.This will show the connection between the changing food spectrum and the phylogeny of our species.

Phenotypic and epistatic grouping of hypo- and hyper-rec mus mutants in Aspergillus.

Science.gov (United States)

Kafer, E; Chae, S K

1994-03-01

The mutants musK to musS of Aspergillus nidulans are sensitive to methyl-methanesulfonate (MMS) and several of them are meiotic-defective and alter mitotic recombination frequencies. All were found to be cross-sensitive to 4-nitro-quinoline-N-oxide (4-NQO) but unexpectedly none of them was hypersensitive to gamma-rays and few to UV light. Double mus; uvs mutants were constructed to test for interactions with uvs mutations of the four epistatic groups of Aspergillus, "UvsF", "UvsC", "UvsI", and "UvsB". All meiotic-defective mus mutations caused some lethal interactions, usually with uvsF. None of them showed epistasis with UvsF or UvsB group mutants and one, musO, may represent a new group. Three mus mutations that affect recombination were assigned to the UvsC group, namely musN and K, and also musL which is recombination-defective and closely resembles uvsC. While uvsC mutants are mutators and lack UV-mutagenesis, most mus mutants had no effects on mutation. Only musR, which appeared epistatic with uvsI, showed reduced UV-reversion frequencies similar to uvsI. The recombination-proficient mus mutants appeared to be epistatic with more than one group, but in several cases sensitivities were slight and overlaps insufficient to obtain corroborating results with MMS and 4-NQO.

Fossil evidence for the origin of Homo sapiens.

Science.gov (United States)

Schwartz, Jeffrey H; Tattersall, Ian

2010-01-01

Our species Homo sapiens has never received a satisfactory morphological definition. Deriving partly from Linnaeus's exhortation simply to "know thyself," and partly from the insistence by advocates of the Evolutionary Synthesis in the mid-20th Century that species are constantly transforming ephemera that by definition cannot be pinned down by morphology, this unfortunate situation has led to huge uncertainty over which hominid fossils ought to be included in H. sapiens, and even over which of them should be qualified as "archaic" or as "anatomically modern," a debate that is an oddity in the broader context of paleontology. Here, we propose a suite of features that seems to characterize all H. sapiens alive today, and we review the fossil evidence in light of those features, paying particular attention to the bipartite brow and the "chin" as examples of how, given the continuum from developmentally regulated genes to adult morphology, we might consider features preserved in fossil specimens in a comparative analysis that includes extant taxa. We also suggest that this perspective on the origination of novelty, which has gained a substantial foothold in the general field of evolutionary developmental biology, has an intellectual place in paleoanthropology and hominid systematics, including in defining our species, H. sapiens. Beginning solely with the distinctive living species reveals a startling variety in morphologies among late middle and late Pleistocene hominids, none of which can be plausibly attributed to H. sapiens/H. neanderthalensis admixture. Allowing for a slightly greater envelope of variation than exists today, basic "modern" morphology seems to have appeared significantly earlier in time than the first stirrings of the modern symbolic cognitive system. Copyright © 2010 Wiley-Liss, Inc.

AcEST: BP916012 [AcEST

Lifescience Database Archive (English)

Full Text Available ne... 29 6.4 sp|P07335|KCRB_RAT Creatine kinase B-type OS=Rattus norvegicus G... 29 6.4 sp|Q04447|KCRB_MOUSE Creatine... kinase B-type OS=Mus musculus GN=C... 29 6.4 sp|P05122|KCRB_CHICK Creatine kinase B-type OS=Gallu...N=ARSH... 29 6.4 sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Sch... 29 8.3 sp|P24722|KCRT_ONCMY Creatine...6 LESGFDAQSRTKLSDLS 36 +ES +D +++ D+S Sbjct: 119 IESKYDVHTKSVTVDVS 135 >sp|P07335|KCRB_RAT Creatine...DGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPV 198 >sp|Q04447|KCRB_MOUSE Creatine kinase B-type OS=Mus musculus GN=Ckb PE

AcEST: DK962347 [AcEST

Lifescience Database Archive (English)

Full Text Available ... 33 1.1 sp|Q7TSF1|DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus GN=Dsg1b... 31... 30 7.4 sp|Q61495|DSG1A_MOUSE Desmoglein-1-alpha OS=Mus musculus GN=Dsg1... 30 7.4 sp|Q9SIB4|WOX3_ARATH WUSC...hia co... 30 9.6 sp|Q01550|TANA_XENLA Tanabin OS=Xenopus laevis PE=2 SV=1 30 9.6 sp|Q7TSF0|DSG1C_MOUSE Desmog...VAEYVTH 428 IVG WDE LP D V E+ E+V+H Sbjct: 322 IVGGNWDEVLPVDVRVPEEIQEFVSH 347 >sp|Q7TSF1|DSG1B_MOUSE Desmogl

Differential Evolutionary Constraints in the Evolution of Chemoreceptors: A Murine and Human Case Study

Directory of Open Access Journals (Sweden)

Ricardo D’Oliveira Albanus

2014-01-01

Full Text Available Chemoreception is among the most important sensory modalities in animals. Organisms use the ability to perceive chemical compounds in all major ecological activities. Recent studies have allowed the characterization of chemoreceptor gene families. These genes present strikingly high variability in copy numbers and pseudogenization degrees among different species, but the mechanisms underlying their evolution are not fully understood. We have analyzed the functional networks of these genes, their orthologs distribution, and performed phylogenetic analyses in order to investigate their evolutionary dynamics. We have modeled the chemosensory networks and compared the evolutionary constraints of their genes in Mus musculus, Homo sapiens, and Rattus norvegicus. We have observed significant differences regarding the constraints on the orthologous groups and network topologies of chemoreceptors and signal transduction machinery. Our findings suggest that chemosensory receptor genes are less constrained than their signal transducing machinery, resulting in greater receptor diversity and conservation of information processing pathways. More importantly, we have observed significant differences among the receptors themselves, suggesting that olfactory and bitter taste receptors are more conserved than vomeronasal receptors.

MUS81 is associated with cell proliferation and cisplatin sensitivity in serous ovarian cancer

Energy Technology Data Exchange (ETDEWEB)

Xie, Suhong; Zheng, Hui [Department of Clinical Laboratory, Fudan University Shanghai Cancer Center, Shanghai (China); Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Wen, Xuemei [Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Sun, Jiajun; Wang, Yanchun; Gao, Xiang; Guo, Lin [Department of Clinical Laboratory, Fudan University Shanghai Cancer Center, Shanghai (China); Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Lu, Renquan, E-mail: lurenquan@126.com [Department of Clinical Laboratory, Fudan University Shanghai Cancer Center, Shanghai (China); Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China)

2016-08-05

The dysfunction of DNA damage repair (DDR) pathway contributes to tumorigenesis and drug-resistance in cancer. MUS81 is a member of the conserved xeroderma pigmentosum group F (XPF) family protein of endonucleases, which is important to the DDR pathway. However, the role of MUS81 in the development of ovarian cancer remains uncertain. To explore the expression of MUS81 and its association to serous ovarian cancer (SOC), 43 biopsies of SOC patients were detected by qRT-PCR, and 29 specimens were further performed by immunohistochemistry analysis. Here, we observed that MUS81 was over-expressed in SOC tissues at both transcript and protein levels, and the expression level of MUS81 protein in ovarian cancer cell lines was also higher than that in human normal ovarian surface epithelial cell line (HOSEpiC). We also found that down-regulation of MUS81 expression in ovarian cancer cells inhibited cell proliferation and colony formation ability, and influenced cell cycle progression. Moreover, inhibition of MUS81 expression induced cellular senescence and enhanced the antitumor effect of cisplatin. Down-regulation of MUS81 expression could suppress the growth and development of SOC. These results indicate that MUS81 might play important roles in the progression of SOC and influence the antitumor effect of cisplatin. - Highlights: • MUS81 was overexpression in serous ovarian cancer (SOC). • Meanwhile down-regulation of inhibited cell proliferation and influenced cell cycle progression. • Inhibition of MUS81 induced cell cellular senescence and enhanced the antitumor effect of cisplatin. • Down-regulation of MUS81 expression could suppress the growth and development of SOC.

MUS81 is associated with cell proliferation and cisplatin sensitivity in serous ovarian cancer

International Nuclear Information System (INIS)

Xie, Suhong; Zheng, Hui; Wen, Xuemei; Sun, Jiajun; Wang, Yanchun; Gao, Xiang; Guo, Lin; Lu, Renquan

2016-01-01

The dysfunction of DNA damage repair (DDR) pathway contributes to tumorigenesis and drug-resistance in cancer. MUS81 is a member of the conserved xeroderma pigmentosum group F (XPF) family protein of endonucleases, which is important to the DDR pathway. However, the role of MUS81 in the development of ovarian cancer remains uncertain. To explore the expression of MUS81 and its association to serous ovarian cancer (SOC), 43 biopsies of SOC patients were detected by qRT-PCR, and 29 specimens were further performed by immunohistochemistry analysis. Here, we observed that MUS81 was over-expressed in SOC tissues at both transcript and protein levels, and the expression level of MUS81 protein in ovarian cancer cell lines was also higher than that in human normal ovarian surface epithelial cell line (HOSEpiC). We also found that down-regulation of MUS81 expression in ovarian cancer cells inhibited cell proliferation and colony formation ability, and influenced cell cycle progression. Moreover, inhibition of MUS81 expression induced cellular senescence and enhanced the antitumor effect of cisplatin. Down-regulation of MUS81 expression could suppress the growth and development of SOC. These results indicate that MUS81 might play important roles in the progression of SOC and influence the antitumor effect of cisplatin. - Highlights: • MUS81 was overexpression in serous ovarian cancer (SOC). • Meanwhile down-regulation of inhibited cell proliferation and influenced cell cycle progression. • Inhibition of MUS81 induced cell cellular senescence and enhanced the antitumor effect of cisplatin. • Down-regulation of MUS81 expression could suppress the growth and development of SOC.

Rethinking the dispersal of Homo sapiens out of Africa.

Science.gov (United States)

Groucutt, Huw S; Petraglia, Michael D; Bailey, Geoff; Scerri, Eleanor M L; Parton, Ash; Clark-Balzan, Laine; Jennings, Richard P; Lewis, Laura; Blinkhorn, James; Drake, Nick A; Breeze, Paul S; Inglis, Robyn H; Devès, Maud H; Meredith-Williams, Matthew; Boivin, Nicole; Thomas, Mark G; Scally, Aylwyn

2015-01-01

Current fossil, genetic, and archeological data indicate that Homo sapiens originated in Africa in the late Middle Pleistocene. By the end of the Late Pleistocene, our species was distributed across every continent except Antarctica, setting the foundations for the subsequent demographic and cultural changes of the Holocene. The intervening processes remain intensely debated and a key theme in hominin evolutionary studies. We review archeological, fossil, environmental, and genetic data to evaluate the current state of knowledge on the dispersal of Homo sapiens out of Africa. The emerging picture of the dispersal process suggests dynamic behavioral variability, complex interactions between populations, and an intricate genetic and cultural legacy. This evolutionary and historical complexity challenges simple narratives and suggests that hybrid models and the testing of explicit hypotheses are required to understand the expansion of Homo sapiens into Eurasia. © 2015 Wiley Periodicals, Inc.

NCBI nr-aa BLAST: CBRC-PABE-21-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-21-0006 sp|P97714|ADA1D_MOUSE Alpha-1D adrenergic receptor (Alpha 1D-adre...noceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic receptor) gb|AAB47042.1| alpha 1d-adrenergic recept...or [Mus sp.] dbj|BAA90312.1| alpha 1D adrenergic receptor [Mus musculus] P97714 0.0 78% ...

Phosphorylation by CK2 regulates MUS81/EME1 in mitosis and after replication stress.

Science.gov (United States)

Palma, Anita; Pugliese, Giusj Monia; Murfuni, Ivana; Marabitti, Veronica; Malacaria, Eva; Rinalducci, Sara; Minoprio, Anna; Sanchez, Massimo; Mazzei, Filomena; Zolla, Lello; Franchitto, Annapaola; Pichierri, Pietro

2018-06-01

The MUS81 complex is crucial for preserving genome stability through the resolution of branched DNA intermediates in mitosis. However, untimely activation of the MUS81 complex in S-phase is dangerous. Little is known about the regulation of the human MUS81 complex and how deregulated activation affects chromosome integrity. Here, we show that the CK2 kinase phosphorylates MUS81 at Serine 87 in late-G2/mitosis, and upon mild replication stress. Phosphorylated MUS81 interacts with SLX4, and this association promotes the function of the MUS81 complex. In line with a role in mitosis, phosphorylation at Serine 87 is suppressed in S-phase and is mainly detected in the MUS81 molecules associated with EME1. Loss of CK2-dependent MUS81 phosphorylation contributes modestly to chromosome integrity, however, expression of the phosphomimic form induces DSBs accumulation in S-phase, because of unscheduled targeting of HJ-like DNA intermediates, and generates a wide chromosome instability phenotype. Collectively, our findings describe a novel regulatory mechanism controlling the MUS81 complex function in human cells. Furthermore, they indicate that, genome stability depends mainly on the ability of cells to counteract targeting of branched intermediates by the MUS81/EME1 complex in S-phase, rather than on a correct MUS81 function in mitosis.

Are Homo sapiens nonsupranuchal fossa and Neanderthal suprainiac fossa convergent traits?

Science.gov (United States)

Nowaczewska, Wioletta

2011-04-01

The autapomorphic status of the Neanderthal suprainiac fossa was recently confirmed. This was a result of a detailed analysis of the internal bone composition in the area of the suprainiac depression on Neanderthal and Homo sapiens specimens. However, while anatomical differences between Neanderthal suprainiac fossa and the depression in the inion region of the occipital bone of fossil and recent Homo sapiens have been discussed in detail, the etiology of these structures has not been resolved. In this article, the hypothesis that the Homo sapiens non-supranuchal fossa and the Neanderthal suprainiac fossa both formed to maintain the optimal shape of the occipital plane (to minimize strain on the posterior cranial vault) is tested. First, the variation in the expression of the fossa above inion in the crania of recent Homo sapiens from European, African, and Australian samples was examined, and the degree of structural similarity between these depressions and the Neanderthal suprainiac fossa was assessed. Next, the relationship between the shape of the occipital squama in the midsagittal plane and two particular features (the degree of the occipital torus development and the occurrence of a depression in the inion region that is not the supranuchal fossa) were analyzed. Based on the results, it is suggested that the Homo sapiens non-supranuchal fossa and Neanderthal suprainiac fossa are convergent traits. Copyright © 2010 Wiley-Liss, Inc.

Dicty_cDB: Contig-U12567-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available S1) RecName: Full=Protein lava lamp; &AE014298_609(AE01429... 36 4.2 EU708920_1( EU708920 |pid:none) Canine rotavirus...none) Mus musculus B16 F10Y cells cDNA, ... 35 7.1 DQ005106_1( DQ005106 |pid:none) Human rotavirus... Full=Myosin-9; AltName: Full=Myosin heavy chai... 35 7.1 AY787649_1( AY787649 |pid:none) Human rotavirus A ...7211_1( AK147211 |pid:none) Mus musculus 15 days embryo liver ... 35 7.1 EF554090_1( EF554090 |pid:none) Human rotavirus...rotein 3; Short=... 35 7.1 EF672579_1( EF672579 |pid:none) Human rotavirus A strain DS-1 non-... 35 7.1 ( Q6

AcEST: DK962031 [AcEST

Lifescience Database Archive (English)

Full Text Available VSFLTGLGCPNCIECFTSQGLQ 392 >tr|B1AX90|B1AX90_MOUSE Transformation related protein 73 OS=Mus musculus GN=Trp7...tr|B1AX90|B1AX90_MOUSE Transformation related protein 73 OS=Mus ... 37 1.5 tr|B7Q4E7|B7Q4E7_IXOSC Putative u...rized protein OS=Mus m... 37 1.5 tr|Q9CU77|Q9CU77_MOUSE Putative uncharacterized protein (Fragmen... 37 1.5

Homo sapiens as physician and patient: a view from Darwinian medicine.

Science.gov (United States)

Román-Franco, Angel A

2013-09-01

Medicine's cardinal diagnostic and therapeutic resource is the clinical encounter. Over the last two centuries and particularly over the last five decades the function of the clinical encounter has been eroded to the point of near irrelevance because of the atomized and atomizing influence of technology and microspecialization. Meanwhile, over the past five decades the exceptionalist view of Homo sapiens inherent in the social and religious traditions of the West has similarly undergone radical changes. H. sapiens is now best understood as a microecosystem integrated into a much broader ecosystem: the biosphere. That human microecosystem is composed of constituents derived from the archaeal, bacterial, and eukaryan domains via endosymbiotic, commensalistic and mutualistic interactions. This amalgamation of 100 trillion cells and viral elements is regulated by a composite genome aggregated over the 3.8 billion years of evolutionary history of organic life. No component of H. sapiens or its genome can be identified as irreducibly and exclusively human. H. sapiens' humanity is an emergent property of the microecosystem. Ironically as H. sapiens is viewed by evolutionary science in a highly integrated manner medicine approaches it as a balkanized, deaggregated entity through the eye of 150 different specialties. To effectively address the needs of H sapiens in its role as patient by the same species in its role as physician the disparate views must be harmonized. Here I review some conceptual elements that would assist a physician in addressing the needs of the patient in integrum, as a microecosystem, by the former address the latter as a historical gestalt being. The optimal way to recover the harmony between patient and physician is through a revitalization of the clinical encounter via an ecological and Darwinian epistemology.

Mandibular molar root morphology in Neanderthals and Late Pleistocene and recent Homo sapiens.

Science.gov (United States)

Kupczik, Kornelius; Hublin, Jean-Jacques

2010-11-01

Neanderthals have a distinctive suite of dental features, including large anterior crown and root dimensions and molars with enlarged pulp cavities. Yet, there is little known about variation in molar root morphology in Neanderthals and other recent and fossil members of Homo. Here, we provide the first comprehensive metric analysis of permanent mandibular molar root morphology in Middle and Late Pleistocene Homo neanderthalensis, and Late Pleistocene (Aterian) and recent Homo sapiens. We specifically address the question of whether root form can be used to distinguish between these groups and assess whether any variation in root form can be related to differences in tooth function. We apply a microtomographic imaging approach to visualise and quantify the external and internal dental morphologies of both isolated molars and molars embedded in the mandible (n=127). Univariate and multivariate analyses reveal both similarities (root length and pulp volume) and differences (occurrence of pyramidal roots and dental tissue volume proportion) in molar root morphology among penecontemporaneous Neanderthals and Aterian H. sapiens. In contrast, the molars of recent H. sapiens are markedly smaller than both Pleistocene H. sapiens and Neanderthals, but share with the former the dentine volume reduction and a smaller root-to-crown volume compared with Neanderthals. Furthermore, we found the first molar to have the largest average root surface area in recent H. sapiens and Neanderthals, although in the latter the difference between M(1) and M(2) is small. In contrast, Aterian H. sapiens root surface areas peak at M(2). Since root surface area is linked to masticatory function, this suggests a distinct occlusal loading regime in Neanderthals compared with both recent and Pleistocene H. sapiens. Copyright © 2010 Elsevier Ltd. All rights reserved.

Sapiens a brief history of humankind

CERN Document Server

Harari, Yuval Noah

2015-01-01

From a renowned historian comes a groundbreaking narrative of humanity’s creation and evolution—a #1 international bestseller—that explores the ways in which biology and history have defined us and enhanced our understanding of what it means to be “human.” One hundred thousand years ago, at least six different species of humans inhabited Earth. Yet today there is only one—homo sapiens. What happened to the others? And what may happen to us? Most books about the history of humanity pursue either a historical or a biological approach, but Dr. Yuval Noah Harari breaks the mold with this highly original book that begins about 70,000 years ago with the appearance of modern cognition. From examining the role evolving humans have played in the global ecosystem to charting the rise of empires, Sapiens integrates history and science to reconsider accepted narratives, connect past developments with contemporary concerns, and examine specific events within the context of larger ideas. Dr. Harari also comp...

Experiment list: SRX655691 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fibroblast || ge...notype/variation=MED23 knockout || chip antibody=H2Bub http://dbarchive.bioscienc

Experiment list: SRX191071 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Mus musculus; ChIP-Seq source_name=Kdm2b knockdown mouse ES cells || chip antibody=Flag || antibody manufact... || cell type=embryonbic stem cells || genotype=Kdm2b knockdown http://dbarchive.

Experiment list: ERX144553 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available tene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57...,10.6,612 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachy

Experiment list: ERX144540 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available tene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57...,50.4,823 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachy

Experiment list: ERX144550 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available tene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57...,36.5,731 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachy

The evolution and development of cranial form in Homo sapiens

OpenAIRE

Lieberman, Daniel E.; McBratney, Brandeis M.; Krovitz, Gail

2002-01-01

Despite much data, there is no unanimity over how to define Homo sapiens in the fossil record. Here, we examine cranial variation among Pleistocene and recent human fossils by using a model of cranial growth to identify unique derived features (autapomorphies) that reliably distinguish fossils attributed to “anatomically modern” H. sapiens (AMHS) from those attributed to various taxa of “archaic” Homo spp. (AH) and to test hypotheses about the changes in cranial development that underlie the ...

New fossils from Jebel Irhoud, Morocco and the pan-African origin of Homo sapiens

OpenAIRE

Hublin, Jean-Jacques; Ben-Ncer, Abdelouahed; Bailey, Shara E.; Freidline, Sarah E.; Neubauer, Simon; Skinner, Matthew M.; Bergmann, Inga; Le Cabec, Adeline; Benazzi, Stefano; Harvati, Katerina; Gunz, Philipp

2017-01-01

Fossil evidence points to an African origin of Homo sapiens from a group called either H. heidelbergensis or H. rhodesiensis. However, the exact place and time of emergence of H. sapiens remain obscure because the fossil record is scarce and the chronological age of many key specimens remains uncertain. In particular, it is unclear whether the present day ‘modern’ morphology rapidly emerged approximately 200 thousand years ago (ka) among earlier representatives of H. sapiens1 or evolved gradu...

Rad54 and Mus81 cooperation promotes DNA damage repair and restrains chromosome missegregation

DEFF Research Database (Denmark)

Ghamrasni, S El; Cardoso, R; Li, L

2016-01-01

. The inefficient repair of DNA double-strand breaks (DSBs) in Rad54(-/-)Mus81(-/-) cells was accompanied by elevated levels of chromosome missegregation and cell death. Perhaps as a consequence, tumor incidence in Rad54(-/-)Mus81(-/-) mice remained comparable to that in Mus81(-/-) mice. Our study highlights...

AcEST: DK945557 [AcEST

Lifescience Database Archive (English)

Full Text Available S=Mus mus... 32 0.77 sp|Q7YR45|PS1C2_PANTR Psoriasis susceptibility 1 candidate g...ene ... 32 0.77 sp|Q9Y6Y8|S23IP_HUMAN SEC23-interacting protein OS=Homo sapiens ... 32 1.3 sp|Q9UIG4|PS1C2_HUMAN Psoriasis

Arabidopsis CDS blastp result: AK105677 [KOME

Lifescience Database Archive (English)

Full Text Available AK105677 001-201-B01 At2g39090.1 tetratricopeptide repeat (TPR)-containing protein low similarity to prediab...etic NOD sera-reactive autoantigen [Mus musculus] GI:6670773, anaphase-promoting co

Arabidopsis CDS blastp result: AK119376 [KOME

Lifescience Database Archive (English)

Full Text Available AK119376 001-132-A09 At2g39090.1 tetratricopeptide repeat (TPR)-containing protein low similarity to prediab...etic NOD sera-reactive autoantigen [Mus musculus] GI:6670773, anaphase-promoting co

Arabidopsis CDS blastp result: AK101105 [KOME

Lifescience Database Archive (English)

Full Text Available AK101105 J033025D11 At2g39090.1 tetratricopeptide repeat (TPR)-containing protein low similarity to prediabe...tic NOD sera-reactive autoantigen [Mus musculus] GI:6670773, anaphase-promoting com

Experiment list: SRX655693 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ut KO ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fib...roblast || genotype/variation=MED23 knockout http://dbarchive.biosciencedbc.jp/ky

Experiment list: ERX144535 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57B...,4.7,550 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachyt

Experiment list: ERX144534 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57B...,9.7,783 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachyt

Experiment list: ERX144518 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57B...,9.5,922 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachyt

Experiment list: ERX144532 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ene piRNA promoters in mammals Organism=Mus musculus || Sex=male || OrganismPart=testis || StrainOrLine=C57B...,5.0,146 Illumina Genome Analyzer II sequencing; Ricochet transcription of pachyt

One normal void and residual following MUS surgery is all that is necessary in most patients.

Science.gov (United States)

Ballard, Paul; Shawer, Sami; Anderson, Colette; Khunda, Aethele

2018-04-01

There is considerable variation worldwide on how the assessment of voiding function is performed following midurethral sling (MUS) surgery. There is potentially a financial cost, and reduction in efficiency when patient discharge is delayed. Using our current practice of two normal void and residual (V&R) readings before discharge, the aim of this retrospective study was to evaluate the likelihood of an abnormal second V&R test if the first V&R test was normal in order to determine if a policy of discharge after only one satisfactory V&R test is reasonable. Data from 400 patients who had had MUS surgery with or without other procedures were collected. Our unit protocol included two consecutive voids of greater than 200 ml with residuals less than 150 ml before discharge. The patients were divided into the following groups: MUS only, MUS plus anterior colporrhaphy (AR) plus any other procedures (MUS/AR), and MUS with any non-AR procedures (MUS+). Complete datasets were available for 335 patients. Once inadequate tests (low volume voids <200 ml) had been excluded (28% overall), the likelihood of an abnormal second V&R test if the first test was normal was 7.1% overall, but 3.6% for MUS, 11.5% for MUS/AR and 8.6% for MUS+. The findings in the MUS-only group indicate that it is probably safe to discharge patients after one satisfactory V&R test, as long as safety measures such as 'open access' are available so that patients have unhindered readmission if problems arise.

Phylogenetic relationship and time of divergence of Mus terricolor ...

Indian Academy of Sciences (India)

2016-06-06

Jun 6, 2016 ... ... Developmental Biology, National Heart Lung and Blood Institute, National Institutes of Health, .... matic short arms in homozygous conditions (Sen and Sharma ..... differences in selection pressure between M. musculus and.

Experiment list: SRX685873 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lance, and learn motor skills. 200858891,0.0,11.0,0 GSM1486386: P14 Cerebellum DNase-seq Rep 3; Mus musculus...cerebellar nuclei. Its function is to coordinate voluntary movements, maintain ba

Experiment list: SRX685868 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lance, and learn motor skills. 68545959,0.0,55.7,0 GSM1486381: P7 Cerebellum DNase-seq Rep 1; Mus musculus; ...cerebellar nuclei. Its function is to coordinate voluntary movements, maintain ba

Experiment list: SRX685869 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lance, and learn motor skills. 59999511,0.0,67.3,0 GSM1486382: P7 Cerebellum DNase-seq Rep 2; Mus musculus; ...cerebellar nuclei. Its function is to coordinate voluntary movements, maintain ba

Experiment list: SRX685870 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lance, and learn motor skills. 64161152,0.0,70.9,0 GSM1486383: P7 Cerebellum DNase-seq Rep 3; Mus musculus; ...cerebellar nuclei. Its function is to coordinate voluntary movements, maintain ba

Experiment list: SRX685875 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lance, and learn motor skills. 181337188,0.0,0.0,0 GSM1486388: P60 Cerebellum DNase-seq Rep 2; Mus musculus;...cerebellar nuclei. Its function is to coordinate voluntary movements, maintain ba

Experiment list: SRX685871 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lance, and learn motor skills. 160531350,0.0,11.8,0 GSM1486384: P14 Cerebellum DNase-seq Rep 1; Mus musculus...cerebellar nuclei. Its function is to coordinate voluntary movements, maintain ba

Experiment list: SRX286394 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 3: AR Cast1 [kidney, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=AR_Cast1 || strain=wild type ICR... || tissue=kidney || age=8-12 weeks old || treatment=castrated+vehicle || chip an

Avaliação de possível interferência do tabagismo na ovoposição de larvas de Calliphoridae (Díptera em carcaça de Mus musculus L. (Rodentia: Muriade em São Paulo, SP

Directory of Open Access Journals (Sweden)

Thais Souza Guerra

2016-04-01

Full Text Available A estimativa do intervalo post-mortem (IPM é uma das principais utilizações de insetos na perícia, que pode ser fundamentado no ciclo biológico, ecologia e distribuição geográfica de uma determinada espécie, bem como o comportamento de toda fauna presente em um corpo a fim de estimar o menor intervalo possível da ocorrência da morte. Diversos fatores podem interferir no ciclo de vida de um inseto, tais como temperatura, umidade e presença de substâncias nos tecidos de uma carcaça, promovendo, em certos casos, aceleração ou retardo neste ciclo afetando diretamente na estimativa do IPM. O presente estudo teve como objetivo avaliar a possível interferência do tabagismo na ovoposição de larvas de Calliphoridae (Díptera em carcaça de Mus musculus L. (Rodentia: Muridae, na zona leste de São Paulo, SP, correlacionando os estágios de decomposição da carcaça e o desenvolvimento larval de moscas. A captura das larvas foi realizada durante o mês de outubro de 2014, as quais as carcaças foram acondicionadas em aparato adequado para coleta de insetos imaturos e adultos: uma contendo a carcaça tabagista e outra com a carcaça não fumante. No curso da decomposição da carcaça não fumante, foram capturados 37 indivíduos adultos da família Calliphoridae emergidos durante o processo de decomposição, ao passo que, na carcaça com fumígeno, não foi coletado nenhuma espécie emergida deste substrato, porém, a mesma apresentou uma decomposição até a fase de esqueletização em menor tempo comparado á carcaça controle, sugerindo assim, uma possível interferência do ato de tabagismo na estimativa do IPM.

Le MusVerre, Sars-Poteries, Hauts-de-France

OpenAIRE

Schmitt , Daniel

2017-01-01

Le MusVerre, inauguré en 2016, présente une collection patrimoniale et contemporaine d'art verrier. Le scénario de la visite propose un parcours en deux temps avec une séquence historique : de l’histoire des « bousillés » à la création du musée avec une galerie technique qui donne un aperçu des gestes de l’art verrier. Puis une séquence contemporaine développe un panorama des collections d’art verrier d’aujourd’hui, dans leur grande richesse et originalité.

INTEGRAL/JEM-X detection of fading emission from GT Mus

DEFF Research Database (Denmark)

Fiocchi, M.; Chenevez, J.; Sguera, V.

2015-01-01

On November 15th 2015 the MAXI/GSC detected a big flare from the RS CVn star GT Mus with a flux of ~100 mCrab in the 2-20 keV energy band. (ATel #8285). During recent INTEGRAL observations of the Musca region performed between 17 Nov 16:08 and 18 Nov 00:05 (UTC) the source GT Mus was within the f...

Homo sapiens natriuretic peptide precursor type C (NPPC) mRNA,partial cds and 3' UTR.

OpenAIRE

Landi, Stefano; Melaiu, Ombretta; Cabiati, Manuela; Landi, Debora; Caselli, Chiara; Prescimone, Tommaso; Giannessi, Daniela; Gemignani, Federica; Del Ry, Silvia

2010-01-01

LOCUS HQ419060 318 bp mRNA linear PRI 24-NOV-2010 DEFINITION Homo sapiens natriuretic peptide precursor type C (NPPC) mRNA, partial cds and 3' UTR. ACCESSION HQ419060 VERSION HQ419060.1 GI:312261407 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 318) AUTHORS Landi,S., Melaiu,O., Cabiati,M., Landi,D., C...

Mouse lipocalins (MUP, OBP, LCN) are co-expressed in tissues involved in chemical communication

Czech Academy of Sciences Publication Activity Database

Stopková, R.; Vinkler, D.; Kuntová, B.; Šedo, O.; Albrecht, T.; Suchan, J.; Dvořáková-Hortová, Kateřina; Zdráhal, Z.; Stopka, P.

2016-01-01

Roč. 47, č. 4 (2016), s. 1-11 ISSN 2296-701X Institutional support: RVO:86652036 Keywords : lipocalin * odorant * chemical communication * Mus musculus * olfaction Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology

Experiment list: SRX655689 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 8698: pol2 KO ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embry...onic fibroblast || genotype/variation=MED23 knockout || chip antibody=Pol II http

Experiment list: SRX306691 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ,1728 GSM1164903: chipseq KO H3K27me3; Mus musculus; ChIP-Seq source_name=neonatal tail tip fibroblasts, Hotair knock...ts || genotype/variation=Hotair knockout http://dbarchive.biosciencedbc.jp/kyushu

Homo sapiens in Arabia by 85,000 years ago.

Science.gov (United States)

Groucutt, Huw S; Grün, Rainer; Zalmout, Iyad A S; Drake, Nick A; Armitage, Simon J; Candy, Ian; Clark-Wilson, Richard; Louys, Julien; Breeze, Paul S; Duval, Mathieu; Buck, Laura T; Kivell, Tracy L; Pomeroy, Emma; Stephens, Nicholas B; Stock, Jay T; Stewart, Mathew; Price, Gilbert J; Kinsley, Leslie; Sung, Wing Wai; Alsharekh, Abdullah; Al-Omari, Abdulaziz; Zahir, Muhammad; Memesh, Abdullah M; Abdulshakoor, Ammar J; Al-Masari, Abdu M; Bahameem, Ahmed A; Al Murayyi, Khaled M S; Zahrani, Badr; Scerri, Eleanor L M; Petraglia, Michael D

2018-05-01

Understanding the timing and character of the expansion of Homo sapiens out of Africa is critical for inferring the colonization and admixture processes that underpin global population history. It has been argued that dispersal out of Africa had an early phase, particularly ~130-90 thousand years ago (ka), that reached only the East Mediterranean Levant, and a later phase, ~60-50 ka, that extended across the diverse environments of Eurasia to Sahul. However, recent findings from East Asia and Sahul challenge this model. Here we show that H. sapiens was in the Arabian Peninsula before 85 ka. We describe the Al Wusta-1 (AW-1) intermediate phalanx from the site of Al Wusta in the Nefud desert, Saudi Arabia. AW-1 is the oldest directly dated fossil of our species outside Africa and the Levant. The palaeoenvironmental context of Al Wusta demonstrates that H. sapiens using Middle Palaeolithic stone tools dispersed into Arabia during a phase of increased precipitation driven by orbital forcing, in association with a primarily African fauna. A Bayesian model incorporating independent chronometric age estimates indicates a chronology for Al Wusta of ~95-86 ka, which we correlate with a humid episode in the later part of Marine Isotope Stage 5 known from various regional records. Al Wusta shows that early dispersals were more spatially and temporally extensive than previously thought. Early H. sapiens dispersals out of Africa were not limited to winter rainfall-fed Levantine Mediterranean woodlands immediately adjacent to Africa, but extended deep into the semi-arid grasslands of Arabia, facilitated by periods of enhanced monsoonal rainfall.

Tristania Sumatrana Effect On Female Mus Musculus Fertility

Science.gov (United States)

Syamsurizal, S.

2018-04-01

The use of traditional medicinal plants are generally based on empirical experience, therefore it is necessary scientific approach in order to bring traditional medicine into medical practice and the formal health services. Tristania sumatrana Miq. is one of the traditional medicinal plants are often used as a contraceptive for women in West Sumatra Tristania sumatrana Miq. extract can prolong the estrous cycle in mice to eleven days. This study aimed to influence Tristania sumatrana Miq. extract treatment on fertility of female mice. Experiments conducted a randomized block design 5x2. Five dose groups: control with no treatment, placebo, treatment with doses of 600, 900 and 1200 mg/kgbw and the old two treatment groups: 10 and 20 days. Fertility parameters studied were ovarian weight follicle Graaf number, the corpus luteum and fetal life. The research proves of Tristania sumatrana Miq. extract treatment causes a decrease very significantly the ovarian weight (treatment of 900 mg/kgbw for 10 days), follicles Graaf number (900 mg/kgbw for 20 days), the corpus luteum (600 mg/kgbw for 10 days) and live fetuses (900 mg/kgbw for 10 days). Tristania sumatrana Miq. extract treatment can lead to decreased fertility of female mice.

Pleistocene Homo sapiens from Middle Awash, Ethiopia.

Science.gov (United States)

White, Tim D; Asfaw, Berhane; DeGusta, David; Gilbert, Henry; Richards, Gary D; Suwa, Gen; Howell, F Clark

2003-06-12

The origin of anatomically modern Homo sapiens and the fate of Neanderthals have been fundamental questions in human evolutionary studies for over a century. A key barrier to the resolution of these questions has been the lack of substantial and accurately dated African hominid fossils from between 100,000 and 300,000 years ago. Here we describe fossilized hominid crania from Herto, Middle Awash, Ethiopia, that fill this gap and provide crucial evidence on the location, timing and contextual circumstances of the emergence of Homo sapiens. Radioisotopically dated to between 160,000 and 154,000 years ago, these new fossils predate classic Neanderthals and lack their derived features. The Herto hominids are morphologically and chronologically intermediate between archaic African fossils and later anatomically modern Late Pleistocene humans. They therefore represent the probable immediate ancestors of anatomically modern humans. Their anatomy and antiquity constitute strong evidence of modern-human emergence in Africa.

MiCroKit 3.0: an integrated database of midbody, centrosome and kinetochore.

Science.gov (United States)

Ren, Jian; Liu, Zexian; Gao, Xinjiao; Jin, Changjiang; Ye, Mingliang; Zou, Hanfa; Wen, Longping; Zhang, Zhaolei; Xue, Yu; Yao, Xuebiao

2010-01-01

During cell division/mitosis, a specific subset of proteins is spatially and temporally assembled into protein super complexes in three distinct regions, i.e. centrosome/spindle pole, kinetochore/centromere and midbody/cleavage furrow/phragmoplast/bud neck, and modulates cell division process faithfully. Although many experimental efforts have been carried out to investigate the characteristics of these proteins, no integrated database was available. Here, we present the MiCroKit database (http://microkit.biocuckoo.org) of proteins that localize in midbody, centrosome and/or kinetochore. We collected into the MiCroKit database experimentally verified microkit proteins from the scientific literature that have unambiguous supportive evidence for subcellular localization under fluorescent microscope. The current version of MiCroKit 3.0 provides detailed information for 1489 microkit proteins from seven model organisms, including Saccharomyces cerevisiae, Schizasaccharomyces pombe, Caenorhabditis elegans, Drosophila melanogaster, Xenopus laevis, Mus musculus and Homo sapiens. Moreover, the orthologous information was provided for these microkit proteins, and could be a useful resource for further experimental identification. The online service of MiCroKit database was implemented in PHP + MySQL + JavaScript, while the local packages were developed in JAVA 1.5 (J2SE 5.0).

Aligning Biomolecular Networks Using Modular Graph Kernels

Science.gov (United States)

Towfic, Fadi; Greenlee, M. Heather West; Honavar, Vasant

Comparative analysis of biomolecular networks constructed using measurements from different conditions, tissues, and organisms offer a powerful approach to understanding the structure, function, dynamics, and evolution of complex biological systems. We explore a class of algorithms for aligning large biomolecular networks by breaking down such networks into subgraphs and computing the alignment of the networks based on the alignment of their subgraphs. The resulting subnetworks are compared using graph kernels as scoring functions. We provide implementations of the resulting algorithms as part of BiNA, an open source biomolecular network alignment toolkit. Our experiments using Drosophila melanogaster, Saccharomyces cerevisiae, Mus musculus and Homo sapiens protein-protein interaction networks extracted from the DIP repository of protein-protein interaction data demonstrate that the performance of the proposed algorithms (as measured by % GO term enrichment of subnetworks identified by the alignment) is competitive with some of the state-of-the-art algorithms for pair-wise alignment of large protein-protein interaction networks. Our results also show that the inter-species similarity scores computed based on graph kernels can be used to cluster the species into a species tree that is consistent with the known phylogenetic relationships among the species.

Sexy gene conversions: locating gene conversions on the X-chromosome.

Science.gov (United States)

Lawson, Mark J; Zhang, Liqing

2009-08-01

Gene conversion can have a profound impact on both the short- and long-term evolution of genes and genomes. Here, we examined the gene families that are located on the X-chromosomes of human (Homo sapiens), chimpanzee (Pan troglodytes), mouse (Mus musculus) and rat (Rattus norvegicus) for evidence of gene conversion. We identified seven gene families (WD repeat protein family, Ferritin Heavy Chain family, RAS-related Protein RAB-40 family, Diphosphoinositol polyphosphate phosphohydrolase family, Transcription Elongation Factor A family, LDOC1-related family, Zinc Finger Protein ZIC, and GLI family) that show evidence of gene conversion. Through phylogenetic analyses and synteny evidence, we show that gene conversion has played an important role in the evolution of these gene families and that gene conversion has occurred independently in both primates and rodents. Comparing the results with those of two gene conversion prediction programs (GENECONV and Partimatrix), we found that both GENECONV and Partimatrix have very high false negative rates (i.e. failed to predict gene conversions), which leads to many undetected gene conversions. The combination of phylogenetic analyses with physical synteny evidence exhibits high resolution in the detection of gene conversions.

Experiment list: SRX1121725 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fibroblas...t || genotype/variation=MED23 knockout || chip antibody=H3K4me3 http://dbarchive.

Experiment list: SRX306689 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 7,15960 GSM1164901: chipseq KO H3K4me3; Mus musculus; ChIP-Seq source_name=neonatal tail tip fibroblasts, Hotair knock...sts || genotype/variation=Hotair knockout http://dbarchive.biosciencedbc.jp/kyush

Experiment list: SRX186172 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 1=YY1 || chip antibody manufacturer 1=Abcam || chip antibody 2=YY1 || chip antibody manufacturer 2=Santa Cru...ip-Seq; Mus musculus; ChIP-Seq source_name=Rag1 -/- pro-B cells || chip antibody

Mammalian life histories: their evolution and molecular-genetic mechanisms

Energy Technology Data Exchange (ETDEWEB)

Sacher, G.A.

1978-01-01

Survival curves for various species of mammals are discussed and a table is presented to show recorded maximum life spans of about 30 species of mammals. The range of longevities is from one year for shrews and moles up to more than 80 years for the fin whale. The constitutional correlates of longevity are discussed with regard to body size, brain weight,metabolic rates, and body temperature. It is concluded that longevity evolved as a positive trait, associated with the evolution of large body size and brain size. Life table data for man, the thorough-bred horse, beagle dogs, and the laboratory rodents, Mus musculus and Peromyscus leucopus are discussed. The data show a pattern of exponential increase of death rate with age. A laboratory model using Mus musculus and Peromyscus leucopus for the study of the longevity-assurance mechanisms is described. (HLW)

Acute MUS81 depletion leads to replication fork slowing and a constitutive DNA damage response

DEFF Research Database (Denmark)

Xing, Meichun; Wang, Xiaohui; Palmai-Pallag, Timea

2015-01-01

have investigated the role of MUS81 in human cells by acutely depleting the protein using shRNAs. We found that MUS81 depletion from human fibroblasts leads to accumulation of ssDNA and a constitutive DNA damage response that ultimately activates cellular senescence. Moreover, we show that MUS81...

Genetic dissection of a key reproductive barrier between nascent species of house mice.

Science.gov (United States)

White, Michael A; Steffy, Brian; Wiltshire, Tim; Payseur, Bret A

2011-09-01

Reproductive isolation between species is often caused by deleterious interactions among loci in hybrids. Finding the genes involved in these incompatibilities provides insight into the mechanisms of speciation. With recently diverged subspecies, house mice provide a powerful system for understanding the genetics of reproductive isolation early in the speciation process. Although previous studies have yielded important clues about the genetics of hybrid male sterility in house mice, they have been restricted to F1 sterility or incompatibilities involving the X chromosome. To provide a more complete characterization of this key reproductive barrier, we conducted an F2 intercross between wild-derived inbred strains from two subspecies of house mice, Mus musculus musculus and Mus musculus domesticus. We identified a suite of autosomal and X-linked QTL that underlie measures of hybrid male sterility, including testis weight, sperm density, and sperm morphology. In many cases, the autosomal loci were unique to a specific sterility trait and exhibited an effect only when homozygous, underscoring the importance of examining reproductive barriers beyond the F1 generation. We also found novel two-locus incompatibilities between the M. m. musculus X chromosome and M. m. domesticus autosomal alleles. Our results reveal a complex genetic architecture for hybrid male sterility and suggest a prominent role for reproductive barriers in advanced generations in maintaining subspecies integrity in house mice.

Genetic Dissection of a Key Reproductive Barrier Between Nascent Species of House Mice

Science.gov (United States)

White, Michael A.; Steffy, Brian; Wiltshire, Tim; Payseur, Bret A.

2011-01-01

Reproductive isolation between species is often caused by deleterious interactions among loci in hybrids. Finding the genes involved in these incompatibilities provides insight into the mechanisms of speciation. With recently diverged subspecies, house mice provide a powerful system for understanding the genetics of reproductive isolation early in the speciation process. Although previous studies have yielded important clues about the genetics of hybrid male sterility in house mice, they have been restricted to F1 sterility or incompatibilities involving the X chromosome. To provide a more complete characterization of this key reproductive barrier, we conducted an F2 intercross between wild-derived inbred strains from two subspecies of house mice, Mus musculus musculus and Mus musculus domesticus. We identified a suite of autosomal and X-linked QTL that underlie measures of hybrid male sterility, including testis weight, sperm density, and sperm morphology. In many cases, the autosomal loci were unique to a specific sterility trait and exhibited an effect only when homozygous, underscoring the importance of examining reproductive barriers beyond the F1 generation. We also found novel two-locus incompatibilities between the M. m. musculus X chromosome and M. m. domesticus autosomal alleles. Our results reveal a complex genetic architecture for hybrid male sterility and suggest a prominent role for reproductive barriers in advanced generations in maintaining subspecies integrity in house mice. PMID:21750261

Experiment list: SRX977433 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ates NA 65512838,98.3,15.4,34790 GSM1648684: RNAPII ChipSeq day15; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 15days of induction || cell type=reprogramming intermediate || genotype=RNAPII-GF

Experiment list: SRX977429 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ates NA 57685706,97.8,16.7,27894 GSM1648680: RNAPII ChipSeq day3; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 3days of induction || cell type=reprogramming intermediate || genotype=RNAPII-GFP/

Experiment list: SRX977432 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ates NA 56429535,98.1,16.9,32459 GSM1648683: RNAPII ChipSeq day11; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 11days of induction || cell type=reprogramming intermediate || genotype=RNAPII-GF

Protein: MPA1 [TP Atlas

Lifescience Database Archive (English)

Full Text Available MPA1 TLR signaling molecules Rsad2 Vig1 Radical S-adenosyl methionine domain-containing pr...otein 2 Viperin, Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible 10090 Mus musculus 58185 Q8CBB9 21435586 ...

Identification of the ancestral haplotype for apolipoprotein B suggests an African origin of Homo sapiens sapiens and traces their subsequent migration to Europe and the Pacific

Energy Technology Data Exchange (ETDEWEB)

Rapacz, J.; Hasler-Rapacz, J.O. (Univ. of Wisconsin, Madison (United States)); Chen, L.; Wu, Mingjiuan; Schumaker, V.N. (Univ. of California, Los Angeles (United States)); Butler-Brunner, E.; Butler, R. (Swiss Red Cross Blood Transfusion Service, Bern (Switzerland))

1991-02-15

The probable ancestral haplotype for human apolipoprotein B (apoB) has been identified through immunological analysis of chimpanzee and gorilla serum and sequence analysis of their DNA. Moreover, the frequency of this ancestral apoB haplotype among different human populations provides strong support for the African origin of Homo sapiens sapiens and their subsequent migration from Africa to Europe and to the Pacific. The approach used here for the identification of the ancestral human apoB haplotype is likely to be applicable to many other genes.

Identification of the ancestral haplotype for apolipoprotein B suggests an African origin of Homo sapiens sapiens and traces their subsequent migration to Europe and the Pacific

International Nuclear Information System (INIS)

Rapacz, J.; Hasler-Rapacz, J.O.; Chen, L.; Wu, Mingjiuan; Schumaker, V.N.; Butler-Brunner, E.; Butler, R.

1991-01-01

The probable ancestral haplotype for human apolipoprotein B (apoB) has been identified through immunological analysis of chimpanzee and gorilla serum and sequence analysis of their DNA. Moreover, the frequency of this ancestral apoB haplotype among different human populations provides strong support for the African origin of Homo sapiens sapiens and their subsequent migration from Africa to Europe and to the Pacific. The approach used here for the identification of the ancestral human apoB haplotype is likely to be applicable to many other genes

New fossils from Jebel Irhoud, Morocco and the pan-African origin of Homo sapiens.

Science.gov (United States)

Hublin, Jean-Jacques; Ben-Ncer, Abdelouahed; Bailey, Shara E; Freidline, Sarah E; Neubauer, Simon; Skinner, Matthew M; Bergmann, Inga; Le Cabec, Adeline; Benazzi, Stefano; Harvati, Katerina; Gunz, Philipp

2017-06-07

Fossil evidence points to an African origin of Homo sapiens from a group called either H. heidelbergensis or H. rhodesiensis. However, the exact place and time of emergence of H. sapiens remain obscure because the fossil record is scarce and the chronological age of many key specimens remains uncertain. In particular, it is unclear whether the present day 'modern' morphology rapidly emerged approximately 200 thousand years ago (ka) among earlier representatives of H. sapiens or evolved gradually over the last 400 thousand years. Here we report newly discovered human fossils from Jebel Irhoud, Morocco, and interpret the affinities of the hominins from this site with other archaic and recent human groups. We identified a mosaic of features including facial, mandibular and dental morphology that aligns the Jebel Irhoud material with early or recent anatomically modern humans and more primitive neurocranial and endocranial morphology. In combination with an age of 315 ± 34 thousand years (as determined by thermoluminescence dating), this evidence makes Jebel Irhoud the oldest and richest African Middle Stone Age hominin site that documents early stages of the H. sapiens clade in which key features of modern morphology were established. Furthermore, it shows that the evolutionary processes behind the emergence of H. sapiens involved the whole African continent.

Population genetic structure in a Robertsonian race of house mice: evidence from microsatellite polymorphism

NARCIS (Netherlands)

Dallas, J.F.; Bonhomme, F.; Boursot, P.; Britton-Davidian, J.; Bauchau, V.

1998-01-01

Genetic evidence was assessed for inbreeding and population subdivision in a Robertsonian fusion (Rb) race of the western European form of house mouse, Mus musculus domesticus, in central Belgium. Inbreeding, and the factors responsible for subdivision (genetic drift and extinction-recolonization)

Browse Title Index

African Journals Online (AJOL)

Items 801 - 850 of 1329 ... Vol 18, No 3 (2014), Kinetic Analysis of the Oxidation of Nitrate Ion by ... Vol 10, No 2 (2006), Lead Contamination and Microbial Lead ... Stations and its Biological Effects on Albino Mice, Mus musculus, Abstract PDF.

Protein: FBA7 [TP Atlas

Lifescience Database Archive (English)

Full Text Available FBA7 claudin-zona occluden Tjp1 Zo1 Tight junction protein ZO-1 Tight junction protein 1, Zona occludens pr...otein 1, Zonula occludens protein 1 10090 Mus musculus 21872 P39447 2RRM P39447 21431884 ...

Fellow travellers

DEFF Research Database (Denmark)

Jones, E. P.; Skirnisson, K.; McGovern, T. H.

2012-01-01

Background: House mice (Mus musculus) are commensals of humans and therefore their phylogeography can reflect human colonization and settlement patterns. Previous studies have linked the distribution of house mouse mitochondrial (mt) DNA clades to areas formerly occupied by the Norwegian Vikings ...

Experiment list: SRX286397 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 6476: Hnf4a Cast1a [kidney, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=Hnf4a_Cast1a || strain=wi...ld type ICR || tissue=kidney || age=8-12 weeks old || treatment=castrated+vehicle

Experiment list: SRX286398 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 6477: Hnf4a Cast1b [kidney, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=Hnf4a_Cast1b || strain=wi...ld type ICR || tissue=kidney || age=8-12 weeks old || treatment=castrated+vehicle

pp. 127-134, December, 2010 Original Article

African Journals Online (AJOL)

Owner

Blood Cells in Albino Mice, Mus musculus Exposed to Radiations from GSM ... Keywords: Bone marrow, GSM Base Station, Haematological effects, Mobile phone, Radiofrequency .... Measurement of Radiofrequency Radiation ... around the base stations based on electric .... stem cell proliferation and differentiation. This.

Dicty_cDB: Contig-U12550-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available e dilute myosin heavy chain gene for novel heav... 52 5e-10 2 ( DD464188 ) Method for screening pharmaceut...ical candidate sub... 52 5e-10 2 ( AY405224 ) Mus musculus MYO5A gene, VIRTUAL TRAN

Joint molecule resolution requires the redundant activities of MUS-81 and XPF-1 during Caenorhabditis elegans meiosis.

Directory of Open Access Journals (Sweden)

Nigel J O'Neil

Full Text Available The generation and resolution of joint molecule recombination intermediates is required to ensure bipolar chromosome segregation during meiosis. During wild type meiosis in Caenorhabditis elegans, SPO-11-generated double stranded breaks are resolved to generate a single crossover per bivalent and the remaining recombination intermediates are resolved as noncrossovers. We discovered that early recombination intermediates are limited by the C. elegans BLM ortholog, HIM-6, and in the absence of HIM-6 by the structure specific endonuclease MUS-81. In the absence of both MUS-81 and HIM-6, recombination intermediates persist, leading to chromosome breakage at diakinesis and inviable embryos. MUS-81 has an additional role in resolving late recombination intermediates in C. elegans. mus-81 mutants exhibited reduced crossover recombination frequencies suggesting that MUS-81 is required to generate a subset of meiotic crossovers. Similarly, the Mus81-related endonuclease XPF-1 is also required for a subset of meiotic crossovers. Although C. elegans gen-1 mutants have no detectable meiotic defect either alone or in combination with him-6, mus-81 or xpf-1 mutations, mus-81;xpf-1 double mutants are synthetic lethal. While mus-81;xpf-1 double mutants are proficient for the processing of early recombination intermediates, they exhibit defects in the post-pachytene chromosome reorganization and the asymmetric disassembly of the synaptonemal complex, presumably triggered by crossovers or crossover precursors. Consistent with a defect in resolving late recombination intermediates, mus-81; xpf-1 diakinetic bivalents are aberrant with fine DNA bridges visible between two distinct DAPI staining bodies. We were able to suppress the aberrant bivalent phenotype by microinjection of activated human GEN1 protein, which can cleave Holliday junctions, suggesting that the DNA bridges in mus-81; xpf-1 diakinetic oocytes are unresolved Holliday junctions. We propose that the

Crystal structure of Homo sapiens protein LOC79017

Energy Technology Data Exchange (ETDEWEB)

Bae, Euiyoung; Bingman, Craig A.; Aceti, David J.; Phillips, Jr., George N. (UW)

2010-02-08

LOC79017 (MW 21.0 kDa, residues 1-188) was annotated as a hypothetical protein encoded by Homo sapiens chromosome 7 open reading frame 24. It was selected as a target by the Center for Eukaryotic Structural Genomics (CESG) because it did not share more than 30% sequence identity with any protein for which the three-dimensional structure is known. The biological function of the protein has not been established yet. Parts of LOC79017 were identified as members of uncharacterized Pfam families (residues 1-95 as PB006073 and residues 104-180 as PB031696). BLAST searches revealed homologues of LOC79017 in many eukaryotes, but none of them have been functionally characterized. Here, we report the crystal structure of H. sapiens protein LOC79017 (UniGene code Hs.530024, UniProt code O75223, CESG target number go.35223).

Is Homo sapiens polytypic? Human taxonomic diversity and its implications.

Science.gov (United States)

Woodley, Michael A

2010-01-01

The term race is a traditional synonym for subspecies, however it is frequently asserted that Homo sapiens is monotypic and that what are termed races are nothing more than biological illusions. In this manuscript a case is made for the hypothesis that H. sapiens is polytypic, and in this way is no different from other species exhibiting similar levels of genetic and morphological diversity. First it is demonstrated that the four major definitions of race/subspecies can be shown to be synonymous within the context of the framework of race as a correlation structure of traits. Next the issue of taxonomic classification is considered where it is demonstrated that H. sapiens possesses high levels morphological diversity, genetic heterozygosity and differentiation (F(ST)) compared to many species that are acknowledged to be polytypic with respect to subspecies. Racial variation is then evaluated in light of the phylogenetic species concept, where it is suggested that the least inclusive monophyletic units exist below the level of species within H. sapiens indicating the existence of a number of potential human phylogenetic species; and the biological species concept, where it is determined that racial variation is too small to represent differentiation at the level of biological species. Finally the implications of this are discussed in the context of anthropology where an accurate picture of the sequence and timing of events during the evolution of human taxa are required for a complete picture of human evolution, and medicine, where a greater appreciation of the role played by human taxonomic differences in disease susceptibility and treatment responsiveness will save lives in the future.

Efecto de las nanopartículas industriales TiO 2 , SiO 2 y ZnO sobre la viabilidad celular y expresión génica en médula ósea roja de mus musculus

Directory of Open Access Journals (Sweden)

Jacquelyne Zarria-Romero

Full Text Available RESUMEN Objetivos Evaluar el efecto de las nanopartículas de ZnO, TiO2 y SiO2 sobre la viabilidad celular y la expresión génica de las interleuquinas 7 y 3 y del factor estimulante de colonias de granulocito - macrófago (GM-CSF en Mus musculus. Materiales y métodos Se extrajo médula ósea roja de cinco roedores (Balb/c para el estudio de viabilidad celular mediante la prueba de MTT. Por otro lado, grupos cinco roedores fueron inoculados vía intraperitoneal con dosis de 0,5; 1; 2,5; 5 y 10 mg/kg de nanopartículas de ZnO y SiO2 y de 5; 10; 15; 20 y 25 mg/kg de nanopartículas de TiO2, 30 h después, se obtuvo el ARN a partir de la médula ósea roja para los análisis de expresión génica empleando las técnicas de PCR y RT-PCR cuantitativa. Resultados Las nanopartículas de ZnO y SiO2 redujeron la viabilidad celular de una manera dosis-dependiente en un 37 y 26%, respectivamente, a partir de una dosis de 1 mg/kg. En cuanto al efecto sobre la expresión génica, a las dosis 5 y 10 mg/kg, las nanopartículas de TiO2 redujeron en mayor porcentaje la expresión de las interleuquinas 7 y 3 (55,3 y 70,2% respectivamente, con respecto a la expresión del GM-CSF, el mayor porcentaje de reducción lo produjo las nanopartículas de SiO2 (91%. Las nanopartículas de ZnO redujeron a partir de las dosis de 20 y 25 mg/kg. Conclusiones Las nanopartículas de ZnO, SiO2 y TiO2 alteran la viabilidad celular y la expresión génica en la médula ósea de ratón.

Sapiens: Hayvanlar insanar

OpenAIRE

Yalı, Sibel

2018-01-01

Bu yazıda sizlere satış rekorları kıran bir tarihkitabından bahsetmek istiyorum. Kitap, 2011'de ibranice, 2014'te ingilizceyayımlandı ve şimdiye dek otuz civarında dile çevrildi. “Sapiens: İnsan Türünün Kısa Bir Tarihi” başlığı ile dilimizeçevrilen kitapta insanlık tarihinin serüvenine 70 bin yıllık zaman sürecindenbakılmaya çalışılıyor. Öyle bir kitap ki Amerika Başkanı Obama halkına bukitabı okumasını tavsiye ediyor. Öyle etkili bir kitap ki Facebook’un kurucusuMark Zuckerberg sos...

The protective role of honey against cytotoxicity of cadmium chloride ...

African Journals Online (AJOL)

KJ

2016-11-16

Nov 16, 2016 ... central nervous system and DNA or cancer progression appeared as ... In this study, 30 adult Swiss albino mice (MUS musculus) were used, varying from ..... Effect of the type of nutrition and aflatoxin B1 on the structure of the.

Experiment list: SRX957819 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 34 GSM1635414: Input, proB cells; Mus musculus; ChIP-Seq source_name=Cultured ProB || strain=C57BL/6 || geno...type/variation=Rag1-/- || cell type=Cultured pro-B cells || antibody=none (input) http://dbarchive.bioscienc

Experiment list: SRX545926 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available rebellar nuclei. Its function is to coordinate voluntary movements, maintain balance, and learn motor skil...ls. 24896655,91.3,3.9,24901 GSM1388141: H3K9/14ac KO P22 B1; Mus musculus; ChIP-Seq

Experiment list: SRX545936 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available rebellar nuclei. Its function is to coordinate voluntary movements, maintain balance, and learn motor skil...ls. 22069752,95.0,8.6,28357 GSM1388151: H3K9/14ac KO P22 B2; Mus musculus; ChIP-Seq

Experiment list: SRX545930 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available rebellar nuclei. Its function is to coordinate voluntary movements, maintain balance, and learn motor skil...ls. 21979511,96.3,4.9,20177 GSM1388145: H3K9/14ac WT P6 B1; Mus musculus; ChIP-Seq

Experiment list: SRX545940 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available rebellar nuclei. Its function is to coordinate voluntary movements, maintain balance, and learn motor skil...ls. 21123206,91.9,6.8,21124 GSM1388155: H3K9/14ac WT P6 B2; Mus musculus; ChIP-Seq

Experiment list: SRX545935 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available rebellar nuclei. Its function is to coordinate voluntary movements, maintain balance, and learn motor skil...ls. 22126564,95.3,7.1,23193 GSM1388150: H3K9/14ac WT P22 B2; Mus musculus; ChIP-Seq

Experiment list: SRX545925 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available rebellar nuclei. Its function is to coordinate voluntary movements, maintain balance, and learn motor skil...ls. 24692816,89.7,3.8,22555 GSM1388140: H3K9/14ac WT P22 B1; Mus musculus; ChIP-Seq

AcEST: BP913064 [AcEST

Lifescience Database Archive (English)

Full Text Available _MOUSE Experimental autoimmune prostatitis antige... 31 5.2 sp|Q9NVV0|TM38B_HUMAN...|Q6QR59|EAPA2_MOUSE Experimental autoimmune prostatitis antigen 2 OS=Mus musculus GN=Eapa2 PE=2 SV=1 Length

Experiment list: SRX977378 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 23908,98.7,9.6,43208 GSM1648629: total Oct4 ChipSeq day11; Mus musculus; ChIP-Seq source_name=reprogramming ...intermediate after 11days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-

Experiment list: SRX977377 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 40719,98.1,13.8,57202 GSM1648628: total Oct4 ChipSeq day7; Mus musculus; ChIP-Seq source_name=reprogramming ...intermediate after 7days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M

Experiment list: SRX977366 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 60072229,98.6,9.6,78331 GSM1648617: flag Oct4 ChipSeq day1; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 24hour of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Ros

Experiment list: SRX977375 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 20178,94.6,10.8,52926 GSM1648626: total Oct4 ChipSeq day3; Mus musculus; ChIP-Seq source_name=reprogramming ...intermediate after 3days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M

Experiment list: SRX977379 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 93532,97.8,13.3,43901 GSM1648630: total Oct4 ChipSeq day15; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 15days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26

Experiment list: SRX977368 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 58474287,97.8,9.8,84163 GSM1648619: flag Oct4 ChipSeq day5; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 5days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa

Experiment list: SRX977369 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 58631406,98.5,10.3,72036 GSM1648620: flag Oct4 ChipSeq day7; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 7days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Ros

Experiment list: SRX684775 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ng || cell type=intermediate stage of somatic cell reprogramming || chip antibody=M...,29.2,290321 GSM1483904: pre-iPS.H3.MNase-ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogrammi

Experiment list: SRX977371 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 63273752,96.7,14.1,37891 GSM1648622: flag Oct4 ChipSeq day15; Mus musculus; ChIP-Seq source_name=reprogramming... intermediate after 15days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ R

Experiment list: SRX1090864 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ming || cell type=intermediate stage of somatic cell reprogramming || chip antibody...5,12.8,491 GSM1816301: pre-iPS rep.H3.MNase-ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogram

African Zoology - Vol 29, No 2 (1994)

African Journals Online (AJOL)

Population biology of house mice (Mus musculus L.) on sub-Antarctic Marion Island · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D.C. Matthewson, R.J. van Aarde, J.D. Skinner, 99-106 ...

GenBank blastx search result: AK111983 [KOME

Lifescience Database Archive (English)

Full Text Available ative exons 18 and 18a, and alternative splice products, complete cds.|ROD ROD 4e-34 +3 ... ...AK111983 001-012-H11 AF071946.1 Mus musculus protein tyrosine kinase Tec (Tec) gene, exons 16 and 17, altern

GenBank blastx search result: AK061938 [KOME

Lifescience Database Archive (English)

Full Text Available ative exons 18 and 18a, and alternative splice products, complete cds.|ROD ROD 1e-24 +2 ... ...AK061938 001-042-D07 AF071946.1 Mus musculus protein tyrosine kinase Tec (Tec) gene, exons 16 and 17, altern

GenBank blastx search result: AK060220 [KOME

Lifescience Database Archive (English)

Full Text Available ative exons 18 and 18a, and alternative splice products, complete cds.|ROD ROD 2e-36 +3 ... ...AK060220 001-002-F01 AF071946.1 Mus musculus protein tyrosine kinase Tec (Tec) gene, exons 16 and 17, altern

Experiment list: SRX286381 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 7,533 GSM1146460: AR Cast1b [prostate, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=AR_Cast1b || s...train=wild type ICR || tissue=prostate || age=8-12 weeks old || treatment=castrated+vehicle || chip antibody

Experiment list: SRX286404 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 2374,91.5,46.7,866 GSM1146483: AR Cast1 [caput epididymis, castrated+vehicle]; Mus musculus; ChIP-Seq source..._name=AR_Cast1 || strain=wild type ICR || tissue=caput epididymis || age=8-12 weeks old || treatment=castrated+vehicle

Experiment list: SRX286380 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 2,497 GSM1146459: AR Cast1a [prostate, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=AR_Cast1a || s...train=wild type ICR || tissue=prostate || age=8-12 weeks old || treatment=castrated+vehicle || chip antibody

Experiment list: SRX286386 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 60.2,17474 GSM1146465: FoxA1 Cast [prostate, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=FoxA1_Ca...st || strain=wild type ICR || tissue=prostate || age=8-12 weeks old || treatment=castrated+vehicle || chip a

POSSuMUS: a position sensitive scintillating muon SiPM detector

CERN Document Server

Ruschke, Alexander

The development of a modular designed large scale scintillation detector with a two-dimensional position sensitivity is presented in this thesis. This novel POsition Sensitive Scintillating MUon SiPM Detector is named POSSuMUS. The POSSuMUS detector is capable to determine the particle’s position in two space dimensions with a fast trigger capability. Each module is constructed from two trapezoidal shaped plastic scintillators to form one rectangular shaped detector module. Both trapezoids are optically insulated against each other. In both trapezoids the scintillation light is collected by plastic fibers and guided towards silicon photomultipliers (SiPMs). SiPMs are light sensors which are capable to detect even smallest amounts of light. By combining several detector modules, position sensitive areas from 100 cm2 to few m2 are achievable with few readout channels. Therefore, POSSuMUS provides a cost effective detector concept. The position sensitivity along the trapezoidal geometry of one detector module ...

Taxonomic differences in deciduous upper second molar crown outlines of Homo sapiens, Homo neanderthalensis and Homo erectus.

Science.gov (United States)

Bailey, Shara E; Benazzi, Stefano; Souday, Caroline; Astorino, Claudia; Paul, Kathleen; Hublin, Jean-Jacques

2014-07-01

A significant number of Middle to Late Pleistocene sites contain primarily (and sometimes only) deciduous teeth (e.g., Grotta del Cavallo, Mezmaiskaya, Blombos). Not surprisingly, there has been a recent renewed interest in deciduous dental variation, especially in the context of distinguishing Homo neanderthalensis and Homo sapiens. Most studies of the deciduous dentition of fossil hominins have focused on standard metrical variation but morphological (non-metric and morphometric) variation also promises to shed light on long standing taxonomic questions. This study examines the taxonomic significance of the crown outline of the deciduous upper second molar through principal components analysis and linear discriminant analysis. We examine whether or not the crown shape of the upper deciduous second molar separates H. neanderthalensis from H. sapiens and explore whether it can be used to correctly assign individuals to taxa. It builds on previous studies by focusing on crown rather than cervical outline and by including a large sample of geographically diverse recent human populations. Our samples include 17 H. neanderthalensis, five early H. sapiens, and 12 Upper Paleolithic H. sapiens. In addition, we include two Homo erectus specimens in order to evaluate the polarity of crown shape differences observed between H. neanderthalensis and H. sapiens. Our results show that crown outline shape discriminates H. sapiens and H. neanderthalensis quite well, but does not do well at distinguishing H. erectus from H. sapiens. We conclude that the crown outline shape observed in H. sapiens is a primitive retention and that the skewed shape observed in H. neanderthalensis is a derived condition. Finally, we explore the phylogenetic implications of the results for the H. erectus molars. Copyright © 2014 Elsevier Ltd. All rights reserved.

From Purgatorius ceratops to Homo sapiens - Primate Evolutionary ...

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 7. From Purgatorius ceratops to Homo sapiens - Primate Evolutionary History. Sindhu Radhakrishna. General Article Volume 11 Issue 7 July 2006 pp 51-60. Fulltext. Click here to view fulltext PDF. Permanent link:

The Homo sapiens 'hemibun': its developmental pattern and the problem of homology.

Science.gov (United States)

Nowaczewska, W; Kuźmiński, L

2009-01-01

The occipital bun is widely considered a Neanderthal feature. Its homology to the 'hemibun' observed in some European Upper Palaeolithic anatomically modern humans is a current problem. This study quantitatively evaluates the degree of occipital plane convexity in African and Australian modern human crania to analyse a relationship between this feature and some neurocranial variables. Neanderthal and European Upper Palaeolithic Homo sapiens crania were included in the analysis as well. The results of this study indicated that there is a significant relationship between the degree of occipital plane convexity and the following two features in the examined crania of modern humans: the ratio of the maximum neurocranial height to the maximum width of the vault and the ratio of bregma-lambda chord to bregma-lambda arc. The results also revealed that some H. sapiens crania (modern and fossil) show the Neanderthal shape of the occipital plane and that the neurocranial height and shape of parietal midsagittal profile has an influence on occipital plane convexity in the hominins included in this study. This study suggests that the occurrence of the great convexity of the occipital plane in the Neanderthals and H. sapiens is a "by-product" of the relationship between the same neurocranial features and there is no convincing evidence that the Neanderthal occipital bun and the similar structure in H. sapiens develop during ontogeny in the same way.

Cryptosporidium tyzzeri and Cryptosporidium muris originated from wild West-European house mice (Mus musculus domesticus) and East-European house mice (Mus musculus musculus) are non-infectious for pigs

Czech Academy of Sciences Publication Activity Database

Kváč, Martin; Kestřánová, M.; Květoňová, Dana; Kotková, M.; Ortega, Y.; McEvoy, J.; Sak, Bohumil

2012-01-01

Roč. 131, č. 1 (2012), s. 107-110 ISSN 0014-4894 R&D Projects: GA MŠk(CZ) LH11061 Grant - others:GA ČR(CZ) GA206/08/0640 Program:GA Institutional support: RVO:60077344 Keywords : Pigs * Cryptosporidium tyzzeri * Cryptosporidium muris * Experimental infection * PCR * Histology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.154, year: 2012 http://www.sciencedirect.com/science/article/pii/S0014489412001105

Les sens du musée

Directory of Open Access Journals (Sweden)

Laurent Grison

1999-09-01

Full Text Available Cet article, fondé sur l'exemple de la National Gallery de Londres, porte sur l'intégration dans le cadre urbain, l'aménagement et les dynamiques spatiales du lieu muséal. Sur le même thème, nous relatons un exercice réalisé avec des lycéens.

Experiment list: SRX957817 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 635412: Ikaros ChIP-Seq, preproB cells; Mus musculus; ChIP-Seq source_name=Cultured PreProB || strain=C57BL/...6 || genotype/variation=E2A-/- || cell type=Cultured pre-pro-B cells || antibody=Ikaros (Ik-C, rabbit antibo

Experiment list: SRX471838 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available : ChIPseq GS WT Bmi1; Mus musculus; ChIP-Seq source_name=Cultured germline stem cells || genotype/variation=...Wild-type || strain=CD1 x C57BL/6 || cell type=Cultured germline stem cells || chip antibody=Mouse anti-Bmi1

Experiment list: SRX957816 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available M1635411: Ikaros ChIP-Seq, proB cells; Mus musculus; ChIP-Seq source_name=Cultured ProB || strain=C57BL/6 ||... genotype/variation=Rag1-/- || cell type=Cultured pro-B cells || antibody=Ikaros (Ik-C, rabbit antibody (kin

Experiment list: SRX471836 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 0: ChIPseq GS WT Scml2; Mus musculus; ChIP-Seq source_name=Cultured germline stem cells || genotype/variatio...n=Wild-type || strain=CD1 x C57BL/6 || cell type=Cultured germline stem cells || chip antibody=Rabbit anti-S

REVIEW - Thermal Physiology of Laboratory Mice: Defining Thermoneutrality

Science.gov (United States)

In terms of total number of publications, the laboratory mouse (Mus musculus) has emerged as the most popular test subject in biomedical research. Mice are used as models to study obesity, diabetes, eNS diseases and variety of other pathologies. Mice are classified as homeotherms...

Experiment list: SRX977374 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 16864,98.6,9.4,51198 GSM1648625: total Oct4 ChipSeq day1; Mus musculus; ChIP-Seq source_name=reprogramming i...ntermediate after 24hour of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M

Experiment list: SRX977384 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 47241296,98.3,15.4,813 GSM1648635: input DNA day3; Mus musculus; ChIP-Seq source_name=reprogramming inter...mediate after 3days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtTA

Experiment list: SRX977387 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 56426857,98.7,10.2,674 GSM1648638: input DNA day11; Mus musculus; ChIP-Seq source_name=reprogramming inte...rmediate after 11days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rt

Experiment list: SRX977385 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 58688448,98.6,12.6,1031 GSM1648636: input DNA day5; Mus musculus; ChIP-Seq source_name=reprogramming inte...rmediate after 5days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtT

Experiment list: SRX977386 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 53476648,98.4,14.3,878 GSM1648637: input DNA day7; Mus musculus; ChIP-Seq source_name=reprogramming inter...mediate after 7days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtTA

Experiment list: SRX977388 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 56072187,98.6,9.2,704 GSM1648639: input DNA day15; Mus musculus; ChIP-Seq source_name=reprogramming inter...mediate after 15days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtT

Experiment list: SRX977383 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NA 59099899,98.6,14.0,974 GSM1648634: input DNA day1; Mus musculus; ChIP-Seq source_name=reprogramming inter...mediate after 24hour of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtT

Dicty_cDB: Contig-U04628-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 'e... 44 3.5 1 ( BB649149 ) Mus musculus 16 days embryo head cDNA, RIKEN full... 44 3.5 1 ( GH465909 ) CCUA5...860.b1 CCUA Peromyscus polionotus subgrisieu... 44 3.5 1 ( FG170345 ) AGN_RNC002x

Experiment list: SRX187245 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 6 || time_point=48h || application=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9...: SL12386; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL12382 || factor=Jmjd

Experiment list: SRX187226 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available F4 || time_point=48h || application=ChIP-Seq || cell type=Th0 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9... SL9852; Mus musculus; ChIP-Seq source_name=Th0 in vitro || genotype=Batf +/+ || control=SL9856 || factor=IR

Experiment list: SRX187224 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available a || time_point=48h || application=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9...: SL10572; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL10566 || factor=Hif1

Experiment list: SRX187244 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lication=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/... SL12384; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL12382 || factor=Jmjd3 || time_point=48h || app

Experiment list: SRX187227 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 4 || time_point=48h || application=ChIP-Seq || cell type=Th0 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/...SL9853; Mus musculus; ChIP-Seq source_name=Th0 in vitro || genotype=Batf -/- || control=SL9857 || factor=IRF

Experiment list: SRX187225 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available a || time_point=48h || application=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9...: SL10575; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL10569 || factor=Hif1

Experiment list: SRX187198 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lication=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/...: SL10570; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL10564 || factor=BATF || time_point=16h || app

Dicty_cDB: VFD746 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 0558 LLC cDN... 572 e-162 BC099966_1( BC099966 |pid:none) Mus musculus dyskeratosis congenit... 572 e-161 FJ...236702_1( FJ236702 |pid:none) Sus scrofa dyskeratosis congenita ... 571 e-161 BC123284_1( BC123284 |pid:none

Experiment list: SRX192254 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f offspring produced at one birth by a viviparous animal. 84324878,97.5,12.5,559 GSM1016423: A INPUT vehicle... donor1024; Mus musculus; ChIP-Seq source_name=whole liver extract || age=29-32 days || chip antibody=INPUT || treament=vehicle

Experiment list: SRX192258 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f offspring produced at one birth by a viviparous animal. 20609955,77.1,6.7,117 GSM1016427: B INPUT vehicle ...donor1; Mus musculus; ChIP-Seq source_name=whole liver extract || age=29-32 days || chip antibody=INPUT || treament=vehicle

Experiment list: SRX192259 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f offspring produced at one birth by a viviparous animal. 15402183,74.5,5.4,117 GSM1016428: B INPUT vehicle ...donor7; Mus musculus; ChIP-Seq source_name=whole liver extract || age=29-32 days || chip antibody=INPUT || treament=vehicle

Experiment list: SRX192267 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f offspring produced at one birth by a viviparous animal. 28874920,80.3,4.9,183 GSM1016436: C INPUT vehicle ...donor10; Mus musculus; ChIP-Seq source_name=whole liver extract || age=29-32 days || chip antibody=INPUT || treament=vehicle

Experiment list: SRX192266 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f offspring produced at one birth by a viviparous animal. 25871870,71.5,4.2,143 GSM1016435: C INPUT vehicle ...donor5; Mus musculus; ChIP-Seq source_name=whole liver extract || age=29-32 days || chip antibody=INPUT || treament=vehicle

Experiment list: SRX192253 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f offspring produced at one birth by a viviparous animal. 106959657,97.4,12.9,578 GSM1016422: A INPUT vehicle... donor1021; Mus musculus; ChIP-Seq source_name=whole liver extract || age=29-32 days || chip antibody=INPUT || treament=vehicle

Spot 1 Spot 2

Indian Academy of Sciences (India)

2011-08-23

M)[17]. Gel Idx/Pos. 137/F12. Plate [#] Name. [1] T056P10. Rank. Protein Name. Accession No. Protein. Protein. Total Ion. Total Ion. Score. Score. Score. C. I. %. C. I. %. 1. Serum albumin OS=Mus musculus GN=Alb PE=1 SV= ...

Gastrointestinal microbiota of wild and inbred individuals of two house mouse subspecies assessed using high-throughput parallel pyrosequencing

Czech Academy of Sciences Publication Activity Database

Kreisinger, Jakub; Čížková, Dagmar; Vohánka, J.; Piálek, Jaroslav

2014-01-01

Roč. 23, č. 20 (2014), s. 5048-5060 ISSN 0962-1083 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 Keywords : domestication * hybrid zone * metagenomics * microbiome * Mus musculus * symbiosis Subject RIV: EG - Zoology Impact factor: 6.494, year: 2014

Potential of MuS1 Transgenic Tobacco for Phytoremediation of the Urban Soils Contaminated with Cadmium

Science.gov (United States)

Kim, K. H.; Kim, Y. N.; Kim, S. H.

2010-05-01

Urban soils are prone to contamination by trace elements such as Cd, Cu, Pb and Zn. Phytoremediation is one of the attractive remediation methods for soils contaminated with trace elements due to its non-destructive and environmentally-friendly characteristic. Scientists have tried to find hyper-accumulator plants in nature or to develop transgenic plant through genetic engineering. This study was carried out to identify a potential of MuS1 transgenic tobacco for phytoremediation of the urban soils contaminated with Cd. MuS1 is known as a multiple stress related gene with several lines. The previous study using RT-PCR showed that the expression of MuS1 gene in tobacco plant induced tolerance to Cd stress. For this study, MuS1 transgenic tobacco and wild-type tobacco (control) were cultivated in a hydroponic system treated with Cd (0, 50, 100 and 200μM Cd) for 3 weeks. At harvest, both tobacco and nutrient solution were collected and were analyzed for Cd. Effect of Cd treatment on morphological change of the tobacco leaves was also observed by variable-pressure scanning electron microscopy (VP-SEM). The tolerance of MuS1 transgenic tobacco to Cd stress was better than that of wild-type tobacco at all Cd levels. Especially, wild-type tobacco showed chlorosis and withering with 200μM Cd treatment, whereas MuS1 transgenic tobacco gradually recovered from Cd damage. Wild-type tobacco accumulated more Cd (4.65mg per plant) than MuS1 transgenic tobacco (2.37mg per plant) with 200μM Cd treatment. Cd translocation rate from root to leaves was 81.8 % for wild-type tobacco compared to 37.1 % for MuS1 transgenic tobacco. Result of VP-SEM showed that the number of trichome in the leaves for wild-type tobacco increased in comparison with that for untreated samples after 3 weeks, while that for MuS1 transgenic tobacco was not changed by Cd treatment. Results showed that the mechanism of the recovery of the MuS1 tobacco plant was not by high level of Cd uptake and accumulation

Arabidopsis CDS blastp result: AK119613 [KOME

Lifescience Database Archive (English)

Full Text Available AK119613 002-117-G04 At4g33330.1 glycogenin glucosyltransferase (glycogenin)-related similar to glycogen...in glucosyltransferase (glycogenin-1) (EC 2.4.1.186) from Homo sapiens [SP|P46976], Mus

Arabidopsis CDS blastp result: AK120569 [KOME

Lifescience Database Archive (English)

Full Text Available AK120569 J013134B09 At4g33330.1 glycogenin glucosyltransferase (glycogenin)-related similar to glycogen...in glucosyltransferase (glycogenin-1) (EC 2.4.1.186) from Homo sapiens [SP|P46976], Mus

X-RAY DETECTION OF THE CLUSTER CONTAINING THE CEPHEID S MUS

Energy Technology Data Exchange (ETDEWEB)

Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan [Smithsonian Astrophysical Observatory, MS 4, 60 Garden Street, Cambridge, MA 02138 (United States); Guinan, Edward; Engle, Scott [Department of Astronomy and Astrophysics, Villanova University, 800 Lancaster Avenue, Villanova, PA 19085 (United States); Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Schaefer, Gail H., E-mail: nevans@cfa.harvard.edu [The CHARA Array of Georgia State University, Mount Wilson, CA 91023 (United States)

2014-04-20

The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J – K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator.

X-Ray Detection of the Cluster Containing the Cepheid S Mus

Science.gov (United States)

Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Guinan, Edward; Engle, Scott; Bond, Howard E.; Schaefer, Gail H.; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan

2014-04-01

The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J - K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator.

X-RAY DETECTION OF THE CLUSTER CONTAINING THE CEPHEID S MUS

International Nuclear Information System (INIS)

Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan; Guinan, Edward; Engle, Scott; Bond, Howard E.; Schaefer, Gail H.

2014-01-01

The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J – K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator

The Lake Ndutu cranium and early Homo sapiens in Africa.

Science.gov (United States)

Rightmire, G P

1983-06-01

The partial cranium from Lake Ndutu, near Olduvai Gorge in northern Tanzania, has generally been viewed as Homo erectus, although points of similarity to H. sapiens have also been recognized. Bones of the vault are in fact quite thick, and the cranium is small. Length and breadth dimensions are comparable to those of earlier H. erectus from Koobi Fora and Ileret, and the Ndutu individual is more similar in size to O.H. 12 than to O.H. 9. Unfortunately, the facial skeleton and frontal bone are very incomplete, and little useful information can be obtained from these parts of the existing reconstruction. The parietals are also damaged, but the left temporal is more satisfactorily preserved, and the occiput is nearly complete. Occipital morphology, mastoid shape, and characteristics of the glenoid cavity and tympanic plate probably provide the best available guide to affinities of the Ndutu hominid. In many of these features the cranium resembles Broken Hill, Elandsfontein, and other African fossils referred to archaic H. sapiens. There are some similarities to modern humans also, but no ties to the Neanderthals of Europe. Allocation of Ndutu to an African subspecies of H. sapiens seems most appropriate, even if the pattern of relationships between such archaic populations and recent humans is still unclear.

Forearm articular proportions and the antebrachial index in Homo sapiens, Australopithecus afarensis and the great apes.

Science.gov (United States)

Williams, Frank L'Engle; Cunningham, Deborah L; Amaral, Lia Q

2015-12-01

When hominin bipedality evolved, the forearms were free to adopt nonlocomotor tasks which may have resulted in changes to the articular surfaces of the ulna and the relative lengths of the forearm bones. Similarly, sex differences in forearm proportions may be more likely to emerge in bipeds than in the great apes given the locomotor constraints in Gorilla, Pan and Pongo. To test these assumptions, ulnar articular proportions and the antebrachial index (radius length/ulna length) in Homo sapiens (n=51), Gorilla gorilla (n=88), Pan troglodytes (n=49), Pongo pygmaeus (n=36) and Australopithecus afarensis A.L. 288-1 and A.L. 438-1 are compared. Intercept-adjusted ratios are used to control for size and minimize the effects of allometry. Canonical scores axes show that the proximally broad and elongated trochlear notch with respect to size in H. sapiens and A. afarensis is largely distinct from G. gorilla, P. troglodytes and P. pygmaeus. A cluster analysis of scaled ulnar articular dimensions groups H. sapiens males with A.L. 438-1 ulna length estimates, while one A.L. 288-1 ulna length estimate groups with Pan and another clusters most closely with H. sapiens, G. gorilla and A.L. 438-1. The relatively low antebrachial index characterizing H. sapiens and non-outlier estimates of A.L. 288-1 and A.L. 438-1 differs from those of the great apes. Unique sex differences in H. sapiens suggest a link between bipedality and forearm functional morphology. Copyright © 2015 Elsevier GmbH. All rights reserved.

Experiment list: SRX684777 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ing || cell type=intermediate stage of somatic cell reprogramming || chip antibody=...,98.5,5.8,239 GSM1483906: pre-iPS.H3K27me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogramm

Experiment list: SRX957818 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available SM1635413: Brg1 ChIP-Seq, proB cells; Mus musculus; ChIP-Seq source_name=Cultured ProB || strain=C57BL/6 || ...genotype/variation=Rag1-/- || cell type=Cultured pro-B cells || antibody=Brg1 (Millipore, catalog# 07-478, l

Experiment list: SRX483615 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 48 GSM1342523: iPSC SNEL3; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC ...SNEL3 || passage=15-20 || reprogramming factors=Sall4, Nanog, Esrrb and Lin28 || antibody=H2A.X (Xiao lab) h

Experiment list: SRX1090865 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available amming || cell type=intermediate stage of somatic cell reprogramming || chip antibo...,95.9,8.5,270 GSM1816302: pre-iPS rep.H3K4me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogr

Experiment list: SRX483614 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 32 GSM1342522: iPSC SNEL1; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC ...SNEL1 || passage=15-20 || reprogramming factors=Sall4, Nanog, Esrrb and Lin28 || antibody=H2A.X (Xiao lab) h

Experiment list: SRX483618 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 40 GSM1342526: iPSC OSKM test; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=i...PSC OSKM_test || passage=15-20 || reprogramming factors=Oct4, Sox2, Klf4 and Myc || antibody=H2A.X (Xiao lab

Experiment list: SRX684776 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ng || cell type=intermediate stage of somatic cell reprogramming || chip antibody=a...98.0,10.6,335 GSM1483905: pre-iPS.H3K4me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogrammi

Experiment list: SRX897943 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 153,97.9,13.9,15440 GSM1624628: ChIP seq Renilla Sox2 IP day3; Mus musculus; ChIP-Seq source_name=OKSM reprogramming... intermediates from Mouse Embryonic Fibroblasts || strain=Black6-129X1/SvJ || cell type=OKSM reprogramming

Experiment list: SRX684778 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 98.0,9.9,325 GSM1483907: pre-iPS.H3K9me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogrammin...g || cell type=intermediate stage of somatic cell reprogramming || chip antibody=an

Experiment list: SRX187194 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lication=ChIP-Seq || cell type=Th0 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/e...SL8348; Mus musculus; ChIP-Seq source_name=Th0 in vitro || genotype=IRF4 wt || control=SL8356 || factor=Batf || time_point=48h || app

Experiment list: SRX187263 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ication=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/e...: SL9624; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL9623 || factor=Stat3 || time_point=16h || appl

Experiment list: SRX187195 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lication=ChIP-Seq || cell type=Th0 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/e...SL8350; Mus musculus; ChIP-Seq source_name=Th0 in vitro || genotype=IRF4 ko || control=SL8346 || factor=Batf || time_point=48h || app

Experiment list: SRX187232 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available : SL9855; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL9859 || factor=IRF4 || time_point=16h || appli...cation=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/ea

Experiment list: SRX187211 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ication=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/e... SL10573; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL10567 || factor=Etv6 || time_point=48h || appl

Experiment list: SRX187197 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available lication=ChIP-Seq || cell type=Th0 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/e...SL9450; Mus musculus; ChIP-Seq source_name=Th0 in vitro || genotype=IRF4 ko || control=SL9446 || factor=Batf || time_point=48h || app

Experiment list: SRX187212 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ication=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/e... SL13368; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL13364 || factor=Etv6 || time_point=48h || appl

Experiment list: SRX187196 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available f || time_point=48h || application=ChIP-Seq || cell type=Th0 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/... SL9448; Mus musculus; ChIP-Seq source_name=Th0 in vitro || genotype=IRF4 wt || control=SL9444 || factor=Bat

Experiment list: SRX187264 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available : SL9626; Mus musculus; ChIP-Seq source_name=Th17 in vitro || genotype=wt || control=SL9625 || factor=Stat3 || time_point=3h || appli...cation=ChIP-Seq || cell type=Th17 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/ea

Predictive validity of a non-induced mouse model of compulsive-like behavior

NARCIS (Netherlands)

Greene-Schloesser, D. M.; Van der Zee, E. A.; Sheppard, D. K.; Castillo, M. R.; Gregg, K. A.; Burrow, T.; Foltz, H.; Slater, M.; Bult-Ito, A.

2011-01-01

A key to advancing the understanding of obsessive-compulsive disorder (OCD)-like symptoms is the development of spontaneous animal models. Over 55 generations of bidirectional selection for nest-building behavior in house mice, Mus musculus, resulted in a 40-fold difference in the amount of cotton

Dicty_cDB: Contig-U03036-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available DQ379469 ) Concholepas concholepas microsatellite Cc1H2 sequ... 50 0.17 1 ( AF10...e DKEY-65O14 in l... 50 0.17 1 ( AC118018 ) Mus musculus chromosome 17, clone RP23-458D20, co... 50 0.17 1 (

NCBI nr-aa BLAST: CBRC-CINT-01-0064 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CINT-01-0064 sp|Q9QY96|CASR_MOUSE Extracellular calcium-sensing receptor precu...rsor (CaSR) (Parathyroid Cell calcium-sensing receptor) gb|AAD28371.1|AF110178_1 calcium-sensing receptor [Mus musculus] Q9QY96 0.0 41% ...

Experiment list: SRX286391 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 7,47.9,41.3,666 GSM1146470: rIgG1a [prostate, castrated+vehicle]; Mus musculus; ChIP-Seq source_name=rIgG1a ...|| strain=wild type ICR || tissue=prostate || age=8-12 weeks old || treatment=castrated+vehicle || chip anti

Experiment list: SRX590292 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available -rep1; Mus musculus; ChIP-Seq source_name=R-Ctrl-Flag ChIP || strain background=C57BL/6 || genotype/variation=Foxd3 conditional knock...out || cell type=embryonic stem cells (ESCs; R cells) || cell line of origin=Foxd3 conditional knock

Dbf4-dependent kinase and the Rtt107 scaffold promote Mus81-Mms4 resolvase activation during mitosis.

Science.gov (United States)

Princz, Lissa N; Wild, Philipp; Bittmann, Julia; Aguado, F Javier; Blanco, Miguel G; Matos, Joao; Pfander, Boris

2017-03-01

DNA repair by homologous recombination is under stringent cell cycle control. This includes the last step of the reaction, disentanglement of DNA joint molecules (JMs). Previous work has established that JM resolving nucleases are activated specifically at the onset of mitosis. In case of budding yeast Mus81-Mms4, this cell cycle stage-specific activation is known to depend on phosphorylation by CDK and Cdc5 kinases. Here, we show that a third cell cycle kinase, Cdc7-Dbf4 (DDK), targets Mus81-Mms4 in conjunction with Cdc5-both kinases bind to as well as phosphorylate Mus81-Mms4 in an interdependent manner. Moreover, DDK-mediated phosphorylation of Mms4 is strictly required for Mus81 activation in mitosis, establishing DDK as a novel regulator of homologous recombination. The scaffold protein Rtt107, which binds the Mus81-Mms4 complex, interacts with Cdc7 and thereby targets DDK and Cdc5 to the complex enabling full Mus81 activation. Therefore, Mus81 activation in mitosis involves at least three cell cycle kinases, CDK, Cdc5 and DDK Furthermore, tethering of the kinases in a stable complex with Mus81 is critical for efficient JM resolution. © 2017 The Authors. Published under the terms of the CC BY NC ND 4.0 license.

PREVALENCE OF SOME HELMINTHS IN RODENTS CAPTURED FROM DIFFERENT CITY STRUCTURES INCLUDING POULTRY FARMS AND HUMAN POPULATION OF FAISALABAD, PAKISTAN

Directory of Open Access Journals (Sweden)

A. RAFIQUE, S. A. RANA, H. A. KHAN AND A. SOHAIL1

2009-07-01

Full Text Available The aim of the present study was to investigate prevalence of zoonotic helminths from human, Rattus rattus (R. rattus, Rattus norvegicus (R. norvegicus and Mus musculus of eight different structures, namely grain shops in grain market, departmental stores, railway godowns, food processing plants (bakeries, poultry farms, houses in kachi-abadies, houses in departmental colonies and posh residences and banglows in Faisalabad city. All the structures were sampled for 2 months each and completed in 16 months. Highest prevalence (70% of Vsmpirolepis spp. was observed in R. rattus sampled from poultry farms, which was significantly higher (P<0.05 than the prevalence of all the helminths recovered from other structures. Hymenolepis nana (H. nana was observed in 60% of the sampled Mus musculus collected from kachi-abadies, which was significantly higher (P<0.05 than all other structures studies for H. nana, except R. rattus from kachi-abadies (55% and R. norvegicus from grain shops in grain market (55%. The rodent’s endo-parasites viz., Hymenolepis nana, Teania taenaeformis, Entrobius spps and Trichuiris spps observed in R. rattus, R. norvegicus and M. musculus at different percentages were also recorded in human stool samples with an incidence of 48, 21, 76 and 10%, respectively.

Melanoides tuberculata (Mollusca: Thiaridae as an intermediate host of Centrocestus formosanus (Trematoda: Heterophyidae in Brazil Melanoides tuberculata (Mollusca: Thiaridae como hospedeiro intermediário de Centrocestus formosanus (Trematoda: Heterophyidae no Brasil

Directory of Open Access Journals (Sweden)

Hudson Alves Pinto

2010-08-01

Full Text Available Pleurolophocercous cercariae emerged from naturally infected Melanoides tuberculata from Minas Gerais State, Brazil, were used to perform experimental infection of laboratory-reared Poecilia reticulata. Mature metacercariae were obtained from the gills of fishes and force-fed to Mus musculus. The adult parasites which recovered from small intestines of mice were identified as Centrocestus formosanus. This is the first report of M. tuberculata as intermediate host of this heterophyid in Brazil.Cercárias do tipo pleurolofocerca emergidas de Melanoides tuberculata naturalmente infectados coletados na represa da Pampulha, Belo Horizonte, Minas Gerais, Brasil, foram utilizadas para a infecção experimental de Poecilia reticulata criados em laboratório. Metacercárias maduras foram obtidas nas brânquias dos peixes e administradas por via oral a Mus musculus. Parasitos adultos recuperados no intestino delgado dos camundongos foram identificados como Centrocestus formosanus. Este é o primeiro relato de M. tuberculata como hospedeiro intermediário deste parasito no Brasil.

A Comprehensive Exploration of Java Man: Bio-Cultural Evolution from Homo erectus to Homo sapiens

Directory of Open Access Journals (Sweden)

Samuel J Haryono

2017-02-01

An overlap of time period between Homo erectus and Homo sapiens has not been confirmed. In the history of man, there have been two missing links: one between man and ape, and one between progressive Homo erectus and archaic Homo sapiens.  Specimen dating on Java Man has been discrepant among research groups, and the use of molecular biology in ancient specimens has been a novelty. This study intends to use fossilised specimens, to harvest DNA to be sequenced for ribosomal DNA analysis for comparative phylogeny among ancient and modern man and other hominids. Dental calculus will be analysed to identify starch, carbohydrate, and protein to illustrate paleo dietary pattern. Soil samples will be examined for pollen and phytoliths to elaborate on ancient ecosystem. Blood samples will be procured from indigenous people along the riverflow region of Bengawan Solo to analyse modern human DNA. We hope that we may reconstruct the evolution pathway, construct the phylogenetic tree between ancient and modern hominids, and discover the uniqueness of Homo sapiens sapiens. Keywords: Java Man, Ribosomal DNA, Hominid Phylogenetic,

Stringent DDI-based prediction of H. sapiens-M. tuberculosis H37Rv protein-protein interactions.

Science.gov (United States)

Zhou, Hufeng; Rezaei, Javad; Hugo, Willy; Gao, Shangzhi; Jin, Jingjing; Fan, Mengyuan; Yong, Chern-Han; Wozniak, Michal; Wong, Limsoon

2013-01-01

H. sapiens-M. tuberculosis H37Rv protein-protein interaction (PPI) data are very important information to illuminate the infection mechanism of M. tuberculosis H37Rv. But current H. sapiens-M. tuberculosis H37Rv PPI data are very scarce. This seriously limits the study of the interaction between this important pathogen and its host H. sapiens. Computational prediction of H. sapiens-M. tuberculosis H37Rv PPIs is an important strategy to fill in the gap. Domain-domain interaction (DDI) based prediction is one of the frequently used computational approaches in predicting both intra-species and inter-species PPIs. However, the performance of DDI-based host-pathogen PPI prediction has been rather limited. We develop a stringent DDI-based prediction approach with emphasis on (i) differences between the specific domain sequences on annotated regions of proteins under the same domain ID and (ii) calculation of the interaction strength of predicted PPIs based on the interacting residues in their interaction interfaces. We compare our stringent DDI-based approach to a conventional DDI-based approach for predicting PPIs based on gold standard intra-species PPIs and coherent informative Gene Ontology terms assessment. The assessment results show that our stringent DDI-based approach achieves much better performance in predicting PPIs than the conventional approach. Using our stringent DDI-based approach, we have predicted a small set of reliable H. sapiens-M. tuberculosis H37Rv PPIs which could be very useful for a variety of related studies. We also analyze the H. sapiens-M. tuberculosis H37Rv PPIs predicted by our stringent DDI-based approach using cellular compartment distribution analysis, functional category enrichment analysis and pathway enrichment analysis. The analyses support the validity of our prediction result. Also, based on an analysis of the H. sapiens-M. tuberculosis H37Rv PPI network predicted by our stringent DDI-based approach, we have discovered some

Embriotoxicidad del bromato de potasio en raton (Mus musculus)

OpenAIRE

Grecia Landeo; José L. Pino

2013-01-01

Se evaluó in vivo los efectos de bromato de potasio (KBr0 3 ) sobre el desarrollo de embriones pre- implantacionales de ratón. Ratonas preñadas fueron tratadas con una dosis única de KBr0 3 (68,5 mg/kg de peso corporal; n= 8) y un grupo control (C) tratado con agua destilada (n= 7) en el día 1; al cuarto día de preñez, las hembras fueron sacrifi cadas, los embriones fueron extraidos de los oviductos y de los cuernos uterinos para la evaluación. El KBr0 3 produjo un retraso en el desar- rollo ...

Embriotoxicidad del bromato de potasio en raton (Mus musculus)

OpenAIRE

Gonzales, José M; Pino, José L

2007-01-01

Se evaluó in vivo los efectos de bromato de potasio (KBr0(3)) ()sobre el desarrollo de embriones preimplantacionales de ratón. Ratonas preñadas fueron tratadas con una dosis única de KBr0(3) (68,5 mg/kg de peso corporal; n= 8) y un grupo control (C) tratado con agua destilada (n= 7) en el día 1; al cuarto día de preñez, las hembras fueron sacrificadas, los embriones fueron extraidos de los oviductos y de los cuernos uterinos para la evaluación. El KBr0(3) produjo un retraso en el desarrollo e...

Embriotoxicidad del bromato de potasio en raton (Mus musculus

Directory of Open Access Journals (Sweden)

Grecia Landeo

2013-04-01

Full Text Available Se evaluó in vivo los efectos de bromato de potasio (KBr0 3 sobre el desarrollo de embriones pre- implantacionales de ratón. Ratonas preñadas fueron tratadas con una dosis única de KBr0 3 (68,5 mg/kg de peso corporal; n= 8 y un grupo control (C tratado con agua destilada (n= 7 en el día 1; al cuarto día de preñez, las hembras fueron sacrifi cadas, los embriones fueron extraidos de los oviductos y de los cuernos uterinos para la evaluación. El KBr0 3 produjo un retraso en el desar- rollo embrionario, encontrándose un 76,9±7,8 y 11,2±5,5 en porcentaje de blastocistos y mórulas respectivamente en el C en comparación de un 34,8±11,2 y 49,3±11,9 de la misma relación en el grupo tratado, mostrando diferencias signifi cativas(p<0,05. En cuanto a la calidad embrionaria, se observó un incremento en el porcentaje de embriones de baja calidad (grado III y degenerados en el grupo tratado, pero esta diferencia no es estadísticamente signifi cativa (p>0,05. En conclusión podemos decir que el KBr0 3 produce un efecto dañino sobre el embrión, causando retraso en su desarrollo.

Dicty_cDB: Contig-U14247-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 22555 ) Zebrafish DNA sequence from clone DKEY-19D21 in l... 44 7.5 1 ( BV440136 ) S237P6107RD7.T0 Portugu...eseWaterDog Canis familiar... 44 7.5 1 ( AC158364 ) Mus musculus BAC clone RP23-187

Dicty_cDB: Contig-U11740-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available cds. 46 3.0 1 ( AB016988 ) Mus musculus mRNA for Nibrin, complete cds. 46 3.0 1 ( DL001650 ) Methods for Molecular Toxicology...eling. 46 3.0 1 ( DD040769 ) Molecular Toxicology Modeling. 46 3.0 1 ( AX401127 ) Sequence 803 from Patent W

Unigene BLAST: CBRC-MMUS-14-0020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-14-0020 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 9e-37 29% ...

Unigene BLAST: CBRC-MMUS-03-0073 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-03-0073 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-27 27% ...

On the determination of Toxoplasma gondii virulence in mice

Science.gov (United States)

Toxoplasma gondii is one of the most successful pathogens on earth, capable of infecting mammals and birds. Numerous papers and reports are published on isolation of T .gondii from various natural sources worldwide. The house mouse (Mus musculus) has been used as the laboratory animal model to deter...

Experiment list: SRX648116 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 02 GSM1430423: iPSC OSK2; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC O...SK2 || passage=15-20 || reprogramming factors=Oct4, Sox2, Klf4 || antibody=H2A.X (Xiao lab) http://dbarchive

Experiment list: SRX897941 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 081,98.0,12.4,11292 GSM1624626: ChIP seq Chaf1a.166 Sox2 IP day3; Mus musculus; ChIP-Seq source_name=OKSM reprogramming... intermediates from Mouse Embryonic Fibroblasts || strain=Black6-129X1/SvJ || cell type=OKSM reprogramming

Experiment list: SRX648117 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 08 GSM1430424: iPSC OSK9; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC O...SK9 || passage=15-20 || reprogramming factors=Oct4, Sox2, Klf4 || antibody=H2A.X (Xiao lab) http://dbarchive

Experiment list: SRX648115 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 37 GSM1430422: iPSC OSK4; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC O...SK4 || passage=15-20 || reprogramming factors=Oct4, Sox2, Klf4 || antibody=H2A.X (Xiao lab) http://dbarchive

Experiment list: SRX483617 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 25 GSM1342525: iPSC OSKM8; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC ...OSKM8 || passage=15-20 || reprogramming factors=Oct4, Sox2, Klf4 and Myc || antibody=H2A.X (Xiao lab) http:/

Experiment list: SRX1090866 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available gramming || cell type=intermediate stage of somatic cell reprogramming || chip anti...1,96.8,4.5,197 GSM1816303: pre-iPS rep.H3K27me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell repro

Experiment list: SRX483616 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 54 GSM1342524: iPSC OSKM5; Mus musculus; ChIP-Seq source_name=reprogramming from MEF cell || cell line=iPSC ...OSKM5 || passage=15-20 || reprogramming factors=Oct4, Sox2, Klf4 and Myc || antibody=H2A.X (Xiao lab) http:/

Unigene BLAST: CBRC-MMUS-20-0033 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-20-0033 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 5e-78 42% ...

Unigene BLAST: CBRC-MMUS-01-0101 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-01-0101 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 3e-33 28% ...

Unigene BLAST: CBRC-MMUS-17-0171 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-17-0171 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-22 22% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-3247 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3247 sp|P97718|ADA1A_MOUSE Alpha-1A adrenergic receptor (Alpha 1A-adre...noceptor) (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic receptor) gb|AAC02658.1| alpha 1A-adrenergic receptor [Mus musculus] P97718 0.0 69% ...

NCBI nr-aa BLAST: CBRC-MMUS-14-0085 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-14-0085 sp|P97718|ADA1A_MOUSE Alpha-1A adrenergic receptor (Alpha 1A-adre...noceptor) (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic receptor) gb|AAC02658.1| alpha 1A-adrenergic receptor [Mus musculus] P97718 0.0 99% ...

AcEST: BP917335 [AcEST

Lifescience Database Archive (English)

Full Text Available _MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 Length = 993 Score = 42.4 bits (98),...THGEYTSAAE 635 >tr|Q9EQN5|Q9EQN5_RAT Antifreeze-enhancer binding protein AEP OS=Rattus norvegicus GN=Ighmbp2

Transfemoral implantation of an Edwards SAPIEN valve in a tricuspid bioprosthesis without fluoroscopic landmarks.

Science.gov (United States)

Calvert, Patrick A; Himbert, Dominique; Brochet, Eric; Radu, Costin; Iung, Bernard; Hvass, Ulrik; Darondel, Jean-Marc; Depoix, Jean-Pol; Nataf, Patrick; Vahanian, Alec

2012-03-01

We describe the first report of an Edwards SAPIEN valve implanted in a tricuspid bioprosthesis from the femoral vein. We highlight the feasibility of this previously avoided approach and the techniques involved. A 61-year-old woman with multiple valve replacements for rheumatic heart disease presented with NHYA IV dyspnoea secondary to a severely stenosed tricuspid bioprosthesis. After failed aggressive medical therapy and surgical turn down, an Edwards SAPIEN XT valve was deployed in the tricuspid bioprosthesis via the right femoral vein. Adaptations to the standard transfemoral transcatheter aortic valve implantation (TAVI) technique included: (1) crossing the tricuspid bioprosthesis with a balloon floatation catheter; (2) temporary pacing wire in the coronary sinus rather than the right ventricle; (3) mounting of the SAPIEN XT valve in the reverse orientation to transfemoral TAVI; and (4) fine positioning of the final valve position pre-deployment by 3D transoesophageal echocardiography (3D TOE) alone due to complete radiolucency of the tricuspid bioprosthesis. The procedure was completed without complication and resulted in significant symptomatic improvement. Deployment of an Edwards SAPIEN valve in a tricuspid bioprosthesis via the femoral vein is feasible and, with careful adaptations to established TAVI techniques, can be performed without complications and with good clinical response.

A Deconvolution Protocol for ChIP-Seq Reveals Analogous Enhancer Structures on the Mouse and Human Ribosomal RNA Genes

Directory of Open Access Journals (Sweden)

Jean-Clement Mars

2018-01-01

Full Text Available The combination of Chromatin Immunoprecipitation and Massively Parallel Sequencing, or ChIP-Seq, has greatly advanced our genome-wide understanding of chromatin and enhancer structures. However, its resolution at any given genetic locus is limited by several factors. In applying ChIP-Seq to the study of the ribosomal RNA genes, we found that a major limitation to resolution was imposed by the underlying variability in sequence coverage that very often dominates the protein–DNA interaction profiles. Here, we describe a simple numerical deconvolution approach that, in large part, corrects for this variability, and significantly improves both the resolution and quantitation of protein–DNA interaction maps deduced from ChIP-Seq data. This approach has allowed us to determine the in vivo organization of the RNA polymerase I preinitiation complexes that form at the promoters and enhancers of the mouse (Mus musculus and human (Homo sapiens ribosomal RNA genes, and to reveal a phased binding of the HMG-box factor UBF across the rDNA. The data identify and map a “Spacer Promoter” and associated stalled polymerase in the intergenic spacer of the human ribosomal RNA genes, and reveal a very similar enhancer structure to that found in rodents and lower vertebrates.

miRvestigator: web application to identify miRNAs responsible for co-regulated gene expression patterns discovered through transcriptome profiling.

Science.gov (United States)

Plaisier, Christopher L; Bare, J Christopher; Baliga, Nitin S

2011-07-01

Transcriptome profiling studies have produced staggering numbers of gene co-expression signatures for a variety of biological systems. A significant fraction of these signatures will be partially or fully explained by miRNA-mediated targeted transcript degradation. miRvestigator takes as input lists of co-expressed genes from Caenorhabditis elegans, Drosophila melanogaster, G. gallus, Homo sapiens, Mus musculus or Rattus norvegicus and identifies the specific miRNAs that are likely to bind to 3' un-translated region (UTR) sequences to mediate the observed co-regulation. The novelty of our approach is the miRvestigator hidden Markov model (HMM) algorithm which systematically computes a similarity P-value for each unique miRNA seed sequence from the miRNA database miRBase to an overrepresented sequence motif identified within the 3'-UTR of the query genes. We have made this miRNA discovery tool accessible to the community by integrating our HMM algorithm with a proven algorithm for de novo discovery of miRNA seed sequences and wrapping these algorithms into a user-friendly interface. Additionally, the miRvestigator web server also produces a list of putative miRNA binding sites within 3'-UTRs of the query transcripts to facilitate the design of validation experiments. The miRvestigator is freely available at http://mirvestigator.systemsbiology.net.

Comparative Analysis of Context-Dependent Mutagenesis Using Human and Mouse Models

Directory of Open Access Journals (Sweden)

Sofya A. Medvedeva

2013-01-01

Full Text Available Substitution rates strongly depend on their nucleotide context. One of the most studied examples is the excess of C > T mutations in the CG context in various groups of organisms, including vertebrates. Studies on the molecular mechanisms underlying this mutation regularity have provided insights into evolution, mutagenesis, and cancer development. Recently several other hypermutable motifs were identified in the human genome. There is an increased frequency of T > C mutations in the second position of the words ATTG and ATAG and an increased frequency of A > C mutations in the first position of the word ACAA. For a better understanding of evolution, it is of interest whether these mutation regularities are human specific or present in other vertebrates, as their presence might affect the validity of currently used substitution models and molecular clocks. A comprehensive analysis of mutagenesis in 4 bp mutation contexts requires a vast amount of mutation data. Such data may be derived from the comparisons of individual genomes or from single nucleotide polymorphism (SNP databases. Using this approach, we performed a systematical comparison of mutation regularities within 2–4 bp contexts in Mus musculus and Homo sapiens and uncovered that even closely related organisms may have notable differences in context-dependent mutation regularities.

GiSAO.db: a database for ageing research

Directory of Open Access Journals (Sweden)

Grillari Johannes

2011-05-01

Full Text Available Abstract Background Age-related gene expression patterns of Homo sapiens as well as of model organisms such as Mus musculus, Saccharomyces cerevisiae, Caenorhabditis elegans and Drosophila melanogaster are a basis for understanding the genetic mechanisms of ageing. For an effective analysis and interpretation of expression profiles it is necessary to store and manage huge amounts of data in an organized way, so that these data can be accessed and processed easily. Description GiSAO.db (Genes involved in senescence, apoptosis and oxidative stress database is a web-based database system for storing and retrieving ageing-related experimental data. Expression data of genes and miRNAs, annotation data like gene identifiers and GO terms, orthologs data and data of follow-up experiments are stored in the database. A user-friendly web application provides access to the stored data. KEGG pathways were incorporated and links to external databases augment the information in GiSAO.db. Search functions facilitate retrieval of data which can also be exported for further processing. Conclusions We have developed a centralized database that is very well suited for the management of data for ageing research. The database can be accessed at https://gisao.genome.tugraz.at and all the stored data can be viewed with a guest account.

IMP 2.0: a multi-species functional genomics portal for integration, visualization and prediction of protein functions and networks.

Science.gov (United States)

Wong, Aaron K; Krishnan, Arjun; Yao, Victoria; Tadych, Alicja; Troyanskaya, Olga G

2015-07-01

IMP (Integrative Multi-species Prediction), originally released in 2012, is an interactive web server that enables molecular biologists to interpret experimental results and to generate hypotheses in the context of a large cross-organism compendium of functional predictions and networks. The system provides biologists with a framework to analyze their candidate gene sets in the context of functional networks, expanding or refining their sets using functional relationships predicted from integrated high-throughput data. IMP 2.0 integrates updated prior knowledge and data collections from the last three years in the seven supported organisms (Homo sapiens, Mus musculus, Rattus norvegicus, Drosophila melanogaster, Danio rerio, Caenorhabditis elegans, and Saccharomyces cerevisiae) and extends function prediction coverage to include human disease. IMP identifies homologs with conserved functional roles for disease knowledge transfer, allowing biologists to analyze disease contexts and predictions across all organisms. Additionally, IMP 2.0 implements a new flexible platform for experts to generate custom hypotheses about biological processes or diseases, making sophisticated data-driven methods easily accessible to researchers. IMP does not require any registration or installation and is freely available for use at http://imp.princeton.edu. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

Bone strength and athletic ability in hominids: Ardipithecus ramidus to Homo sapiens

Science.gov (United States)

Lee, S. A.

2013-03-01

The ability of the femur to resist bending stresses is determined by its midlength cross-sectional geometry, its length and the elastic properties of the mineral part of the bone. The animal's athletic ability, determined by a ``bone strength index,'' is limited by this femoral bending strength in relation to the loads on the femur. This analysis is applied to the fossil record for Homo sapiens, Homo neanderthalensis, Homo erectus, Homo habilis, Australopithecus afarensis and Ardipithecus ramidus. Evidence that the femoral bone strength index of modern Homo sapiens has weakened over the last 50,000 years is found.

Environmental Impact Statement. Disposal and Reuse of Wurtsmith Air Force Base, Michigan

Science.gov (United States)

1993-09-01

Mephitis mephitis Meadow vole Microtus pennsy/vanicus House mouse Mus musculus Long-tailed weasel Mustela frenata Mink Mustela vison Little brown bat...fuels, such as coal and oil, are burned. SO2 is the main pollutant involved in the formation of acid rain. SO also can irritate the upper respiratory

Experiment list: SRX977401 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 98.9,13.8,95651 GSM1648652: H3K27ac ChipSeq day1; Mus musculus; ChIP-Seq source_name=reprogramming intermedi...ate after 24hour of induction || cell type=reprogramming intermediate || genotype=H3K27ac-GFP/ Rosa26-M2rtTA

Experiment list: SRX977402 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 98.8,11.6,43739 GSM1648653: H3K27ac ChipSeq day3; Mus musculus; ChIP-Seq source_name=reprogramming intermedi...ate after 3days of induction || cell type=reprogramming intermediate || genotype=H3K27ac-GFP/ Rosa26-M2rtTA

Experiment list: SRX977406 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 98.9,8.3,18501 GSM1648657: H3K27ac ChipSeq day15; Mus musculus; ChIP-Seq source_name=reprogramming intermedi...ate after 15days of induction || cell type=reprogramming intermediate || genotype=H3K27ac-GFP/ Rosa26-M2rtTA

Experiment list: SRX218536 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available strain=C57Bl/6 || age/gender=2-3 month old males || chip antibody=Santa Cruz Tech. rIgG (sc-2027) http://db....7,16.5,1194 GSM1067409: Rabbit IgG mouse liver ChIP-seq; Mus musculus; ChIP-Seq GEO Accession=GSM1067409 ||

InterProScan Result: FS873218 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available FS873218 FS873218_6_ORF2 0A64BA7E960F39C4 PANTHER PTHR18958:SF308 gb def: Mus musculus 10 days neonate cereb...ellum cDNA, RIKEN full-length enriched library 7.7e-09 T IPR020683 unintegrated ...

Experiment list: SRX286407 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 19696667,94.8,45.4,7089 GSM1146486: AP2a Cast1a [caput epididymis, castrated+vehicle]; Mus musculus; ChIP-Se...q source_name=AP2a_Cast1a || strain=wild type ICR || tissue=caput epididymis || age=8-12 weeks old || treatment=castrated+vehicle

Experiment list: SRX286408 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 15944359,94.3,40.0,7036 GSM1146487: AP2a Cast1b [caput epididymis, castrated+vehicle]; Mus musculus; ChIP-Se...q source_name=AP2a_Cast1b || strain=wild type ICR || tissue=caput epididymis || age=8-12 weeks old || treatment=castrated+vehicle

Experiment list: SRX977405 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 98.9,7.4,10239 GSM1648656: H3K27ac ChipSeq day11; Mus musculus; ChIP-Seq source_name=reprogramming intermedi...ate after 11days of induction || cell type=reprogramming intermediate || genotype=H3K27ac-GFP/ Rosa26-M2rtTA

Dicty_cDB: SHB534 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available s) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 99 2e-19... BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 97 6e-19 (Q9JLC8) RecName: Full=Sacsi

Dicty_cDB: Contig-U16312-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available nslandica notch mRN... 70 4e-10 AB001327_1( AB001327 |pid:none) Halocynthia roretzi... 4e-10 AF247637_1( AF247637 |pid:none) Mus musculus LDLR dan mRNA, comple... 70 4e-10 EU273942_1( EU273942 |pid:none) Amphimedon quee

76 FR 20706 - South Farallon Islands Nonnative Mouse Eradication Project; Farallon National Wildlife Refuge...

Science.gov (United States)

2011-04-13

... Noonday Rock. In 1969 the Refuge was expanded to include the South Farallon Islands and is still managed... eradicate nonnative mice from the South Farallon Islands, part of the Farallon National Wildlife Refuge off... eradicate nonnative house mice (Mus musculus) from the South Farallon Islands. The purpose of this project...